NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000344

Metagenome / Metatranscriptome Family F000344

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000344
Family Type Metagenome / Metatranscriptome
Number of Sequences 1257
Average Sequence Length 39 residues
Representative Sequence MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAH
Number of Associated Samples 703
Number of Associated Scaffolds 1257

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.12 %
% of genes near scaffold ends (potentially truncated) 98.65 %
% of genes from short scaffolds (< 2000 bps) 98.97 %
Associated GOLD sequencing projects 694
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.075 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(14.002 % of family members)
Environment Ontology (ENVO) Unclassified
(17.979 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(28.162 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 1257 Family Scaffolds
PF07859Abhydrolase_3 0.40
PF13414TPR_11 0.08
PF00270DEAD 0.08
PF00884Sulfatase 0.08
PF08447PAS_3 0.08

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 1257 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.40


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.07 %
UnclassifiedrootN/A41.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111013|DRAFT_Contig_40329Not Available533Open in IMG/M
2222084002|DRAFT_c135472Not Available532Open in IMG/M
2222084002|DRAFT_c44377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia546Open in IMG/M
2228664014|PheDRAFT_GXW9OCQ03G4BSS.67174Not Available528Open in IMG/M
2228664014|PheDRAFT_GXW9OCQ03GBLGT.25308Not Available515Open in IMG/M
2228664014|PheDRAFT_GXW9OCQ03HE39N.62062Not Available523Open in IMG/M
3300001808|JGI20218J20341_1003204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei825Open in IMG/M
3300001810|JGI20221J20338_1012266Not Available804Open in IMG/M
3300002341|JGI24213J29975_1001175All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia822Open in IMG/M
3300002343|JGI24214J29971_1001759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia829Open in IMG/M
3300002346|JGI24216J29974_1003104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia817Open in IMG/M
3300002675|Ga0005473J37261_100253Not Available831Open in IMG/M
3300002677|Ga0005475J37263_101507All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila828Open in IMG/M
3300002678|Ga0005477J37265_100269All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila828Open in IMG/M
3300002680|Ga0005483J37271_100800Not Available699Open in IMG/M
3300002681|Ga0005471J37259_100510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei833Open in IMG/M
3300002861|Ga0006842J43188_100758All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila836Open in IMG/M
3300002864|Ga0006764J43180_100054All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila823Open in IMG/M
3300002865|Ga0006761J43178_100035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae826Open in IMG/M
3300002868|Ga0006767J43181_100031All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila820Open in IMG/M
3300003158|Ga0006760J45825_100079All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei822Open in IMG/M
3300003158|Ga0006760J45825_100323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia778Open in IMG/M
3300003162|Ga0006778J45830_1000223All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila824Open in IMG/M
3300003289|Ga0006776J48906_101333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300003308|Ga0006777J48905_1001552All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila821Open in IMG/M
3300003505|JGIcombinedJ51221_10188597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei836Open in IMG/M
3300003563|Ga0007430J51106_102244Not Available507Open in IMG/M
3300003576|Ga0007413J51701_1000037All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila723Open in IMG/M
3300003611|Ga0007411J51799_100085All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila822Open in IMG/M
3300003672|Ga0001194_100273All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila587Open in IMG/M
3300003672|Ga0001194_100342Not Available513Open in IMG/M
3300003754|Ga0005853_1012315All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300004102|Ga0058888_1024922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei831Open in IMG/M
3300004120|Ga0058901_1032462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila828Open in IMG/M
3300004130|Ga0058895_1004745Not Available810Open in IMG/M
3300004131|Ga0058898_1010608Not Available802Open in IMG/M
3300004133|Ga0058892_1014231Not Available549Open in IMG/M
3300004134|Ga0058906_1018895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei844Open in IMG/M
3300004140|Ga0058894_1017365Not Available559Open in IMG/M
3300004282|Ga0066599_100934454Not Available624Open in IMG/M
3300004473|Ga0068919_1042149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Amel2xE9619Open in IMG/M
3300004530|Ga0066516_112556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia633Open in IMG/M
3300004567|Ga0066495_112065Not Available584Open in IMG/M
3300004622|Ga0058865_1089282Not Available570Open in IMG/M
3300004798|Ga0058859_10069550All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei823Open in IMG/M
3300004800|Ga0058861_10114364All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia832Open in IMG/M
3300004801|Ga0058860_10137912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei520Open in IMG/M
3300004801|Ga0058860_10166036All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei553Open in IMG/M
3300004801|Ga0058860_10187612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia623Open in IMG/M
3300004801|Ga0058860_12198574All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila825Open in IMG/M
3300005506|Ga0068912_11262868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia739Open in IMG/M
3300005544|Ga0070686_100957664Not Available700Open in IMG/M
3300005577|Ga0068857_101414585All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia677Open in IMG/M
3300005646|Ga0075040_1066867Not Available682Open in IMG/M
3300005662|Ga0078894_10009016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae7783Open in IMG/M
3300005805|Ga0079957_1241070Not Available845Open in IMG/M
3300005949|Ga0066791_10040477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila920Open in IMG/M
3300006230|Ga0082390_128012Not Available533Open in IMG/M
3300006235|Ga0082395_1023932Not Available705Open in IMG/M
3300006355|Ga0075501_1022023Not Available778Open in IMG/M
3300006366|Ga0075499_1045774Not Available596Open in IMG/M
3300006366|Ga0075499_1066309Not Available639Open in IMG/M
3300006373|Ga0075483_1005175Not Available807Open in IMG/M
3300006378|Ga0075498_1079059Not Available645Open in IMG/M
3300006378|Ga0075498_1089608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei724Open in IMG/M
3300006378|Ga0075498_1102472Not Available759Open in IMG/M
3300006401|Ga0075506_1008475Not Available811Open in IMG/M
3300006402|Ga0075511_1735251Not Available806Open in IMG/M
3300006426|Ga0075037_1029691All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila824Open in IMG/M
3300006602|Ga0075484_1080712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Amel2xE9664Open in IMG/M
3300006602|Ga0075484_1548442Not Available779Open in IMG/M
3300006641|Ga0075471_10431683Not Available658Open in IMG/M
3300006647|Ga0099772_1048080Not Available673Open in IMG/M
3300006727|Ga0031666_1104236All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei801Open in IMG/M
3300006731|Ga0079249_1359898All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei801Open in IMG/M
3300006917|Ga0075472_10709706Not Available507Open in IMG/M
3300006937|Ga0081243_1035118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300007159|Ga0075020_112575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei666Open in IMG/M
3300007219|Ga0075025_1008441Not Available520Open in IMG/M
3300007219|Ga0075025_1057764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia775Open in IMG/M
3300007232|Ga0075183_11491147Not Available766Open in IMG/M
3300007235|Ga0075184_10085099Not Available517Open in IMG/M
3300007237|Ga0075177_1022270All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia695Open in IMG/M
3300007237|Ga0075177_1051781Not Available656Open in IMG/M
3300007253|Ga0075182_10006725All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300007321|Ga0102692_1066196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300007327|Ga0075016_1001757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300007327|Ga0075016_1027394Not Available596Open in IMG/M
3300007327|Ga0075016_1043128Not Available809Open in IMG/M
3300007526|Ga0075022_1001036All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei575Open in IMG/M
3300007526|Ga0075022_1005570Not Available553Open in IMG/M
3300007526|Ga0075022_1009236All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei562Open in IMG/M
3300007526|Ga0075022_1029678All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei794Open in IMG/M
3300007602|Ga0099787_1020378Not Available798Open in IMG/M
3300007642|Ga0102876_1119078All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila712Open in IMG/M
3300008055|Ga0108970_11364623All Organisms → cellular organisms → Bacteria4326Open in IMG/M
3300008648|Ga0103610_100273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei712Open in IMG/M
3300008702|Ga0103614_1005141All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei791Open in IMG/M
3300008785|Ga0103638_1000597Not Available836Open in IMG/M
3300008785|Ga0103638_1003214All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei575Open in IMG/M
3300008787|Ga0103640_1000369Not Available871Open in IMG/M
3300008884|Ga0103746_10018082Not Available834Open in IMG/M
3300008884|Ga0103746_10018237All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia831Open in IMG/M
3300009196|Ga0103745_10024164All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila830Open in IMG/M
3300009196|Ga0103745_10024178Not Available829Open in IMG/M
3300009196|Ga0103745_10043580Not Available636Open in IMG/M
3300009199|Ga0103748_10033934All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300009199|Ga0103748_10050168Not Available706Open in IMG/M
3300009223|Ga0103850_1014855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei867Open in IMG/M
3300009223|Ga0103850_1016118Not Available837Open in IMG/M
3300009223|Ga0103850_1016131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei836Open in IMG/M
3300009223|Ga0103850_1016574Not Available827Open in IMG/M
3300009223|Ga0103850_1018386Not Available791Open in IMG/M
3300009225|Ga0103851_1031368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei845Open in IMG/M
3300009225|Ga0103851_1031441All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia844Open in IMG/M
3300009230|Ga0103855_10039029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei846Open in IMG/M
3300009230|Ga0103855_10039392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei843Open in IMG/M
3300009230|Ga0103855_10040556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia833Open in IMG/M
3300009233|Ga0103856_10040093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300009233|Ga0103856_10098241All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei555Open in IMG/M
3300009235|Ga0103857_10041782Not Available854Open in IMG/M
3300009235|Ga0103857_10044888Not Available830Open in IMG/M
3300009235|Ga0103857_10046169All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei820Open in IMG/M
3300009235|Ga0103857_10047967All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300009235|Ga0103857_10121787Not Available545Open in IMG/M
3300009239|Ga0103858_10070573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei845Open in IMG/M
3300009239|Ga0103858_10072321Not Available837Open in IMG/M
3300009239|Ga0103858_10075718Not Available820Open in IMG/M
3300009239|Ga0103858_10189463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei539Open in IMG/M
3300009243|Ga0103860_10045694All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei859Open in IMG/M
3300009243|Ga0103860_10049753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei831Open in IMG/M
3300009243|Ga0103860_10103133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia618Open in IMG/M
3300009243|Ga0103860_10124152Not Available574Open in IMG/M
3300009247|Ga0103861_10025046Not Available834Open in IMG/M
3300009247|Ga0103861_10027774Not Available803Open in IMG/M
3300009249|Ga0103862_1019401Not Available855Open in IMG/M
3300009249|Ga0103862_1019729Not Available850Open in IMG/M
3300009249|Ga0103862_1020055Not Available845Open in IMG/M
3300009249|Ga0103862_1020736Not Available834Open in IMG/M
3300009249|Ga0103862_1021217Not Available826Open in IMG/M
3300009249|Ga0103862_1021631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei821Open in IMG/M
3300009249|Ga0103862_1022752Not Available805Open in IMG/M
3300009252|Ga0103863_10017033Not Available846Open in IMG/M
3300009252|Ga0103863_10018050Not Available831Open in IMG/M
3300009257|Ga0103869_10066677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia845Open in IMG/M
3300009257|Ga0103869_10068586All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei836Open in IMG/M
3300009257|Ga0103869_10072114Not Available820Open in IMG/M
3300009257|Ga0103869_10172876Not Available582Open in IMG/M
3300009261|Ga0103870_1016044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei857Open in IMG/M
3300009261|Ga0103870_1016693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei844Open in IMG/M
3300009295|Ga0103747_10211330Not Available531Open in IMG/M
3300009337|Ga0103864_1002760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300009352|Ga0103865_1003212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei860Open in IMG/M
3300009387|Ga0103871_1007133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila838Open in IMG/M
3300009387|Ga0103871_1007770All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila811Open in IMG/M
3300009404|Ga0103853_1011648Not Available833Open in IMG/M
3300009579|Ga0115599_1012631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300009579|Ga0115599_1157363Not Available639Open in IMG/M
3300009580|Ga0115596_1051331Not Available709Open in IMG/M
3300009581|Ga0115600_1050543Not Available824Open in IMG/M
3300009581|Ga0115600_1116105Not Available814Open in IMG/M
3300009581|Ga0115600_1169221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei804Open in IMG/M
3300009581|Ga0115600_1183066All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300009582|Ga0115601_1116465Not Available827Open in IMG/M
3300009582|Ga0115601_1204443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila783Open in IMG/M
3300009583|Ga0115598_1066446Not Available766Open in IMG/M
3300009584|Ga0115597_1018823Not Available604Open in IMG/M
3300009584|Ga0115597_1215032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei815Open in IMG/M
3300009587|Ga0115602_1002101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila598Open in IMG/M
3300009587|Ga0115602_1046101Not Available506Open in IMG/M
3300009587|Ga0115602_1251606Not Available814Open in IMG/M
3300009649|Ga0105855_1309729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila504Open in IMG/M
3300009660|Ga0105854_1079379All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1011Open in IMG/M
3300009834|Ga0131969_101647Not Available830Open in IMG/M
3300010061|Ga0127462_129103Not Available787Open in IMG/M
3300010066|Ga0127427_127449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia578Open in IMG/M
3300010067|Ga0127432_150311Not Available580Open in IMG/M
3300010071|Ga0127477_115606Not Available628Open in IMG/M
3300010071|Ga0127477_136679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300010075|Ga0127434_157859Not Available798Open in IMG/M
3300010077|Ga0127437_131421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300010077|Ga0127437_137618Not Available793Open in IMG/M
3300010080|Ga0127448_141224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei799Open in IMG/M
3300010084|Ga0127461_1013484Not Available601Open in IMG/M
3300010090|Ga0127471_1027359Not Available774Open in IMG/M
3300010091|Ga0127485_1027306Not Available798Open in IMG/M
3300010094|Ga0127480_1029844All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia784Open in IMG/M
3300010096|Ga0127473_1120399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei573Open in IMG/M
3300010096|Ga0127473_1122397All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia806Open in IMG/M
3300010101|Ga0127481_1025173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia798Open in IMG/M
3300010101|Ga0127481_1026276All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia796Open in IMG/M
3300010103|Ga0127500_1104901All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia797Open in IMG/M
3300010109|Ga0127497_1069918All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia805Open in IMG/M
3300010110|Ga0126316_1058829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila783Open in IMG/M
3300010110|Ga0126316_1076803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia612Open in IMG/M
3300010117|Ga0127449_1082285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia797Open in IMG/M
3300010118|Ga0127465_1090214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300010118|Ga0127465_1131980Not Available652Open in IMG/M
3300010121|Ga0127438_1145009Not Available552Open in IMG/M
3300010124|Ga0127498_1062326Not Available609Open in IMG/M
3300010126|Ga0127482_1036106All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia800Open in IMG/M
3300010130|Ga0127493_1182172All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia800Open in IMG/M
3300010131|Ga0115594_1022662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei598Open in IMG/M
3300010134|Ga0127484_1067263Not Available781Open in IMG/M
3300010136|Ga0127447_1125015Not Available707Open in IMG/M
3300010138|Ga0115595_1172145Not Available624Open in IMG/M
3300010141|Ga0127499_1055468All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia643Open in IMG/M
3300010144|Ga0115593_1018048Not Available792Open in IMG/M
3300010145|Ga0126321_1195896Not Available813Open in IMG/M
3300010146|Ga0126320_1046145Not Available813Open in IMG/M
3300010146|Ga0126320_1278010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300010147|Ga0126319_1035450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia812Open in IMG/M
3300010147|Ga0126319_1061811All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei559Open in IMG/M
3300010147|Ga0126319_1090112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia819Open in IMG/M
3300010152|Ga0126318_10576338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia796Open in IMG/M
3300010152|Ga0126318_10996916Not Available810Open in IMG/M
3300010152|Ga0126318_11119365Not Available591Open in IMG/M
3300010154|Ga0127503_10303488All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila799Open in IMG/M
3300010305|Ga0129320_153689Not Available518Open in IMG/M
3300010354|Ga0129333_10055950All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3685Open in IMG/M
3300010854|Ga0126360_1002959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei567Open in IMG/M
3300010856|Ga0126358_1122215All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei774Open in IMG/M
3300010857|Ga0126354_1148095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei824Open in IMG/M
3300010857|Ga0126354_1182622All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila821Open in IMG/M
3300010857|Ga0126354_1187978All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila823Open in IMG/M
3300010857|Ga0126354_1188026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300010857|Ga0126354_1244711Not Available811Open in IMG/M
3300010859|Ga0126352_1111775Not Available825Open in IMG/M
3300010859|Ga0126352_1258316All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei809Open in IMG/M
3300010861|Ga0126349_1034579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia867Open in IMG/M
3300010861|Ga0126349_1064270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300010861|Ga0126349_1252631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia817Open in IMG/M
3300010862|Ga0126348_1075721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia877Open in IMG/M
3300010862|Ga0126348_1134099Not Available634Open in IMG/M
3300010862|Ga0126348_1284248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila729Open in IMG/M
3300010866|Ga0126344_1069110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila549Open in IMG/M
3300010869|Ga0126359_1267181All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila629Open in IMG/M
3300010869|Ga0126359_1633661All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei705Open in IMG/M
3300010895|Ga0138113_182315Not Available794Open in IMG/M
3300010896|Ga0138111_1157277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia775Open in IMG/M
3300011028|Ga0138577_135481Not Available779Open in IMG/M
3300011046|Ga0138600_110008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia817Open in IMG/M
3300011055|Ga0138550_105997All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300011057|Ga0138544_1039030Not Available817Open in IMG/M
3300011061|Ga0138534_1052826Not Available799Open in IMG/M
3300011062|Ga0138582_1091165Not Available801Open in IMG/M
3300011064|Ga0138525_1138328Not Available797Open in IMG/M
3300011072|Ga0138563_1128508Not Available806Open in IMG/M
3300011074|Ga0138559_1119427Not Available797Open in IMG/M
3300011075|Ga0138555_1081927Not Available825Open in IMG/M
3300011080|Ga0138568_1091467All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia550Open in IMG/M
3300011120|Ga0150983_14092091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei824Open in IMG/M
3300011281|Ga0138295_121388Not Available528Open in IMG/M
3300011282|Ga0138293_135249All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei781Open in IMG/M
3300011288|Ga0138391_108546Not Available849Open in IMG/M
3300011299|Ga0138294_1021829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia831Open in IMG/M
3300011332|Ga0126317_10569154Not Available571Open in IMG/M
3300011332|Ga0126317_10570157All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia703Open in IMG/M
3300011333|Ga0127502_10363092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia591Open in IMG/M
3300011333|Ga0127502_10587823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia809Open in IMG/M
3300011333|Ga0127502_10895450All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila778Open in IMG/M
3300011340|Ga0151652_10407272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia595Open in IMG/M
3300011340|Ga0151652_10547622All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila822Open in IMG/M
3300011340|Ga0151652_10597707Not Available807Open in IMG/M
3300011340|Ga0151652_10844208All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei758Open in IMG/M
3300011340|Ga0151652_11149189Not Available505Open in IMG/M
3300011340|Ga0151652_12859999Not Available813Open in IMG/M
3300011340|Ga0151652_14115620All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei583Open in IMG/M
3300012040|Ga0137461_1248896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei518Open in IMG/M
3300012212|Ga0150985_100792461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia571Open in IMG/M
3300012212|Ga0150985_110248360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium522Open in IMG/M
3300012212|Ga0150985_110345187Not Available805Open in IMG/M
3300012212|Ga0150985_120751669Not Available822Open in IMG/M
3300012212|Ga0150985_122367311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei519Open in IMG/M
3300012224|Ga0134028_1111718All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila516Open in IMG/M
3300012364|Ga0134027_1066500All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei668Open in IMG/M
3300012372|Ga0134037_1203624Not Available782Open in IMG/M
3300012373|Ga0134042_1194693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia817Open in IMG/M
3300012377|Ga0134029_1016963All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300012377|Ga0134029_1027194Not Available812Open in IMG/M
3300012378|Ga0134025_1060547Not Available694Open in IMG/M
3300012379|Ga0134058_1198032Not Available836Open in IMG/M
3300012380|Ga0134047_1040513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei777Open in IMG/M
3300012380|Ga0134047_1043829Not Available679Open in IMG/M
3300012382|Ga0134038_1063076All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila867Open in IMG/M
3300012383|Ga0134033_1167677Not Available812Open in IMG/M
3300012390|Ga0134054_1086144Not Available639Open in IMG/M
3300012390|Ga0134054_1265256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei699Open in IMG/M
3300012391|Ga0134035_1029501Not Available788Open in IMG/M
3300012392|Ga0134043_1061746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia809Open in IMG/M
3300012393|Ga0134052_1136793Not Available569Open in IMG/M
3300012393|Ga0134052_1287267All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila691Open in IMG/M
3300012393|Ga0134052_1301125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300012395|Ga0134044_1276969All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila725Open in IMG/M
3300012397|Ga0134056_1048513Not Available809Open in IMG/M
3300012397|Ga0134056_1082128Not Available831Open in IMG/M
3300012398|Ga0134051_1099543All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300012398|Ga0134051_1323354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia592Open in IMG/M
3300012399|Ga0134061_1026261All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300012400|Ga0134048_1191137Not Available808Open in IMG/M
3300012401|Ga0134055_1250411Not Available822Open in IMG/M
3300012401|Ga0134055_1391399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300012402|Ga0134059_1053584All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei618Open in IMG/M
3300012403|Ga0134049_1176934Not Available749Open in IMG/M
3300012403|Ga0134049_1339081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia818Open in IMG/M
3300012405|Ga0134041_1106610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia775Open in IMG/M
3300012405|Ga0134041_1334769All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300012407|Ga0134050_1062020Not Available799Open in IMG/M
3300012409|Ga0134045_1469085All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila786Open in IMG/M
3300012410|Ga0134060_1222351All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei831Open in IMG/M
3300012411|Ga0153880_1372731All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia821Open in IMG/M
3300012469|Ga0150984_105614918Not Available592Open in IMG/M
3300012469|Ga0150984_106355751Not Available816Open in IMG/M
3300012469|Ga0150984_109660854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia817Open in IMG/M
3300012471|Ga0129334_1006661Not Available809Open in IMG/M
3300012686|Ga0157560_1059294All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300012689|Ga0157565_1138443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300012690|Ga0157575_157387All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila832Open in IMG/M
3300012691|Ga0157569_1053320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila615Open in IMG/M
3300012699|Ga0157593_1130223Not Available883Open in IMG/M
3300012703|Ga0157572_1104904All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia832Open in IMG/M
3300012707|Ga0157623_1190754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300012724|Ga0157611_1036480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei806Open in IMG/M
3300012747|Ga0157564_1089083All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila839Open in IMG/M
3300012754|Ga0138278_1069522Not Available609Open in IMG/M
3300012755|Ga0138281_1131450Not Available799Open in IMG/M
3300012757|Ga0157628_1002409Not Available813Open in IMG/M
3300012761|Ga0138288_1085781All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei820Open in IMG/M
3300012761|Ga0138288_1136755Not Available873Open in IMG/M
3300012764|Ga0157624_1102211All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei565Open in IMG/M
3300012768|Ga0138276_1256837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia776Open in IMG/M
3300012769|Ga0138279_1167324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia819Open in IMG/M
3300012772|Ga0138287_1093386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei819Open in IMG/M
3300012775|Ga0138280_1052218Not Available512Open in IMG/M
3300012776|Ga0138275_1358487Not Available673Open in IMG/M
3300012777|Ga0138292_1117756All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei704Open in IMG/M
3300012778|Ga0138269_1318988All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300012781|Ga0138286_1066449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300012962|Ga0129335_1038064All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300012962|Ga0129335_1061255Not Available746Open in IMG/M
3300012963|Ga0129340_1258432Not Available809Open in IMG/M
3300012967|Ga0129343_1051912Not Available813Open in IMG/M
3300013043|Ga0154018_103206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia805Open in IMG/M
3300013043|Ga0154018_107640All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300013043|Ga0154018_120495All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300013044|Ga0154019_104155Not Available781Open in IMG/M
3300013045|Ga0154016_103219Not Available555Open in IMG/M
3300013046|Ga0079038_111975Not Available621Open in IMG/M
3300013052|Ga0154014_108711All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei510Open in IMG/M
3300013052|Ga0154014_145961Not Available555Open in IMG/M
3300013052|Ga0154014_162060Not Available800Open in IMG/M
3300013059|Ga0154012_173746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei828Open in IMG/M
3300013059|Ga0154012_174473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300013068|Ga0157563_1091432All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila821Open in IMG/M
3300013078|Ga0153914_1031402All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei835Open in IMG/M
3300013078|Ga0153914_1137802All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei809Open in IMG/M
3300013080|Ga0153913_1367550All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei802Open in IMG/M
3300013232|Ga0170573_10668365All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1007Open in IMG/M
3300013295|Ga0170791_15339077Not Available889Open in IMG/M
3300015197|Ga0167638_1054412All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300016678|Ga0180045_143081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei820Open in IMG/M
3300016680|Ga0180046_108439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei707Open in IMG/M
3300016682|Ga0180044_1051675All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila632Open in IMG/M
3300016688|Ga0180039_1067141All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila835Open in IMG/M
3300016699|Ga0180058_1068864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei558Open in IMG/M
3300016705|Ga0181507_1018262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila633Open in IMG/M
3300016728|Ga0181500_1198936All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila826Open in IMG/M
3300016733|Ga0182042_1120420Not Available816Open in IMG/M
3300016734|Ga0182092_1342324Not Available798Open in IMG/M
3300016736|Ga0182049_1232857Not Available797Open in IMG/M
3300016754|Ga0182072_1035575Not Available808Open in IMG/M
3300016766|Ga0182091_1082964Not Available805Open in IMG/M
3300018549|Ga0188832_100582Not Available811Open in IMG/M
3300018610|Ga0188884_1006126Not Available817Open in IMG/M
3300019158|Ga0184580_124020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300019191|Ga0180035_1049864Not Available717Open in IMG/M
3300019198|Ga0180033_127252All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300019199|Ga0187789_1113438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei821Open in IMG/M
3300019199|Ga0187789_1136771All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia615Open in IMG/M
3300019199|Ga0187789_1137891Not Available570Open in IMG/M
3300019199|Ga0187789_1196027All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia824Open in IMG/M
3300019199|Ga0187789_1203214Not Available719Open in IMG/M
3300019199|Ga0187789_1216354All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila823Open in IMG/M
3300019200|Ga0180036_1056776Not Available823Open in IMG/M
3300019201|Ga0180032_1038877Not Available810Open in IMG/M
3300019201|Ga0180032_1059998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei703Open in IMG/M
3300019201|Ga0180032_1105807All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300019201|Ga0180032_1140408All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300019205|Ga0179940_1145367Not Available820Open in IMG/M
3300019208|Ga0180110_1033754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei812Open in IMG/M
3300019208|Ga0180110_1035077Not Available810Open in IMG/M
3300019208|Ga0180110_1183874Not Available675Open in IMG/M
3300019209|Ga0179951_1175207Not Available695Open in IMG/M
3300019211|Ga0187799_1004179Not Available556Open in IMG/M
3300019211|Ga0187799_1065824All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila575Open in IMG/M
3300019211|Ga0187799_1158596All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila750Open in IMG/M
3300019211|Ga0187799_1184107Not Available536Open in IMG/M
3300019211|Ga0187799_1270429All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia812Open in IMG/M
3300019212|Ga0180106_1011942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
3300019212|Ga0180106_1120522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia706Open in IMG/M
3300019212|Ga0180106_1258650Not Available809Open in IMG/M
3300019212|Ga0180106_1332329Not Available779Open in IMG/M
3300019213|Ga0179950_1162529Not Available807Open in IMG/M
3300019215|Ga0179945_1161842Not Available505Open in IMG/M
3300019216|Ga0179939_1092704Not Available570Open in IMG/M
3300019221|Ga0179941_1082789All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia820Open in IMG/M
3300019225|Ga0179949_1071399Not Available721Open in IMG/M
3300019225|Ga0179949_1191352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300019228|Ga0180119_1030740All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei790Open in IMG/M
3300019228|Ga0180119_1046778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei783Open in IMG/M
3300019228|Ga0180119_1157792All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila836Open in IMG/M
3300019228|Ga0180119_1183839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila565Open in IMG/M
3300019229|Ga0180116_1170829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei804Open in IMG/M
3300019231|Ga0179935_1038689Not Available823Open in IMG/M
3300019232|Ga0180114_1016710All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei808Open in IMG/M
3300019233|Ga0184645_1093024Not Available666Open in IMG/M
3300019233|Ga0184645_1176705Not Available546Open in IMG/M
3300019234|Ga0172288_1207612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei537Open in IMG/M
3300019238|Ga0180112_1083482Not Available693Open in IMG/M
3300019238|Ga0180112_1187868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia735Open in IMG/M
3300019241|Ga0187793_1026502Not Available607Open in IMG/M
3300019241|Ga0187793_1098578Not Available778Open in IMG/M
3300019241|Ga0187793_1098708All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia604Open in IMG/M
3300019241|Ga0187793_1104441All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia683Open in IMG/M
3300019241|Ga0187793_1132528All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila619Open in IMG/M
3300019241|Ga0187793_1145272Not Available740Open in IMG/M
3300019241|Ga0187793_1148324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei815Open in IMG/M
3300019241|Ga0187793_1153197All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila817Open in IMG/M
3300019241|Ga0187793_1173016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila699Open in IMG/M
3300019241|Ga0187793_1325110Not Available627Open in IMG/M
3300019241|Ga0187793_1326533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei739Open in IMG/M
3300019241|Ga0187793_1365655All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei815Open in IMG/M
3300019241|Ga0187793_1467017Not Available773Open in IMG/M
3300019244|Ga0180111_1003401Not Available814Open in IMG/M
3300019244|Ga0180111_1052705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300019244|Ga0180111_1080154All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300019244|Ga0180111_1111576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia722Open in IMG/M
3300019244|Ga0180111_1201721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei695Open in IMG/M
3300019245|Ga0187791_1061334All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila715Open in IMG/M
3300019245|Ga0187791_1109415Not Available686Open in IMG/M
3300019245|Ga0187791_1112557Not Available568Open in IMG/M
3300019245|Ga0187791_1130524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300019245|Ga0187791_1207985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila787Open in IMG/M
3300019245|Ga0187791_1210298All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
3300019245|Ga0187791_1239764Not Available569Open in IMG/M
3300019245|Ga0187791_1254573Not Available808Open in IMG/M
3300019245|Ga0187791_1255385Not Available571Open in IMG/M
3300019245|Ga0187791_1268395All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia509Open in IMG/M
3300019245|Ga0187791_1293012Not Available564Open in IMG/M
3300019245|Ga0187791_1306918Not Available693Open in IMG/M
3300019245|Ga0187791_1406989All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia681Open in IMG/M
3300019245|Ga0187791_1490477Not Available802Open in IMG/M
3300019245|Ga0187791_1491170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia756Open in IMG/M
3300019247|Ga0179937_1273644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei585Open in IMG/M
3300019247|Ga0179937_1352272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei574Open in IMG/M
3300019248|Ga0180117_1277740Not Available1096Open in IMG/M
3300019248|Ga0180117_1406836Not Available806Open in IMG/M
3300019249|Ga0184648_1196753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300019249|Ga0184648_1389811Not Available795Open in IMG/M
3300019249|Ga0184648_1396464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei576Open in IMG/M
3300019250|Ga0187790_1031091Not Available772Open in IMG/M
3300019250|Ga0187790_1032053All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300019250|Ga0187790_1070194Not Available569Open in IMG/M
3300019250|Ga0187790_1130124All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei721Open in IMG/M
3300019250|Ga0187790_1278065Not Available608Open in IMG/M
3300019250|Ga0187790_1515950Not Available602Open in IMG/M
3300019250|Ga0187790_1516312All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300019251|Ga0187795_1241290All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia797Open in IMG/M
3300019252|Ga0172286_1128282Not Available593Open in IMG/M
3300019252|Ga0172286_1575701All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei689Open in IMG/M
3300019254|Ga0184641_1159135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300019254|Ga0184641_1284322All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia685Open in IMG/M
3300019255|Ga0184643_1016971Not Available540Open in IMG/M
3300019255|Ga0184643_1102985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila788Open in IMG/M
3300019255|Ga0184643_1224327All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300019255|Ga0184643_1450821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei559Open in IMG/M
3300019255|Ga0184643_1483960All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila539Open in IMG/M
3300019257|Ga0180115_1065666Not Available626Open in IMG/M
3300019257|Ga0180115_1232962Not Available695Open in IMG/M
3300019257|Ga0180115_1275745All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300019257|Ga0180115_1433649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei778Open in IMG/M
3300019258|Ga0181504_1047795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300019259|Ga0184646_1115780All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300019259|Ga0184646_1352276All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei570Open in IMG/M
3300019260|Ga0181506_1428572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia829Open in IMG/M
3300019263|Ga0184647_1153131Not Available628Open in IMG/M
3300019264|Ga0187796_1016823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia758Open in IMG/M
3300019264|Ga0187796_1179213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300019265|Ga0187792_1010282Not Available757Open in IMG/M
3300019265|Ga0187792_1062911All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300019265|Ga0187792_1108545All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6821Open in IMG/M
3300019265|Ga0187792_1111267Not Available619Open in IMG/M
3300019265|Ga0187792_1466986Not Available816Open in IMG/M
3300019265|Ga0187792_1467545All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila581Open in IMG/M
3300019265|Ga0187792_1518908Not Available784Open in IMG/M
3300019265|Ga0187792_1670893Not Available702Open in IMG/M
3300019267|Ga0182069_1550896Not Available799Open in IMG/M
3300019268|Ga0181514_1302546All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila509Open in IMG/M
3300019269|Ga0184644_1018121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia511Open in IMG/M
3300019269|Ga0184644_1140312All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300019269|Ga0184644_1162112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300019269|Ga0184644_1561824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei569Open in IMG/M
3300019270|Ga0181512_1733983All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae820Open in IMG/M
3300019273|Ga0187794_1191119Not Available552Open in IMG/M
3300019273|Ga0187794_1729646Not Available731Open in IMG/M
3300019277|Ga0182081_1414865Not Available808Open in IMG/M
3300019278|Ga0187800_1232521All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300019279|Ga0184642_1125711All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei583Open in IMG/M
3300019279|Ga0184642_1160229All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei584Open in IMG/M
3300019279|Ga0184642_1223338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300019281|Ga0182077_1638096Not Available798Open in IMG/M
3300020014|Ga0182044_1308742Not Available798Open in IMG/M
3300020063|Ga0180118_1240710Not Available541Open in IMG/M
3300020063|Ga0180118_1249981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia727Open in IMG/M
3300020064|Ga0180107_1048060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia604Open in IMG/M
3300020065|Ga0180113_1142737Not Available532Open in IMG/M
3300020067|Ga0180109_1207337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia646Open in IMG/M
3300020067|Ga0180109_1294984Not Available703Open in IMG/M
3300020067|Ga0180109_1346602Not Available791Open in IMG/M
3300020068|Ga0184649_1466547Not Available699Open in IMG/M
3300020069|Ga0197907_10868337All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300020070|Ga0206356_10089135All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300020070|Ga0206356_10324389All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei622Open in IMG/M
3300020070|Ga0206356_10624353Not Available808Open in IMG/M
3300020070|Ga0206356_11586386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila796Open in IMG/M
3300020075|Ga0206349_1528926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei819Open in IMG/M
3300020075|Ga0206349_1919198Not Available804Open in IMG/M
3300020075|Ga0206349_1983355All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei809Open in IMG/M
3300020076|Ga0206355_1014171All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia824Open in IMG/M
3300020076|Ga0206355_1223512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei789Open in IMG/M
3300020076|Ga0206355_1432055All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia651Open in IMG/M
3300020078|Ga0206352_10675235Not Available836Open in IMG/M
3300020078|Ga0206352_10847518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei825Open in IMG/M
3300020080|Ga0206350_10723501All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei815Open in IMG/M
3300020080|Ga0206350_11199828All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300020159|Ga0211734_10525328All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia6631Open in IMG/M
3300020610|Ga0154015_1352082Not Available582Open in IMG/M
3300020610|Ga0154015_1352812Not Available586Open in IMG/M
3300020610|Ga0154015_1454081Not Available714Open in IMG/M
3300021151|Ga0179584_1002334All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila811Open in IMG/M
3300021151|Ga0179584_1195440Not Available783Open in IMG/M
3300021257|Ga0210329_110538All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300021258|Ga0210345_113787All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300021258|Ga0210345_145963Not Available806Open in IMG/M
3300021267|Ga0210353_108348Not Available808Open in IMG/M
3300021268|Ga0210294_108936All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300021269|Ga0210356_184170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei574Open in IMG/M
3300021270|Ga0210360_104205All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300021270|Ga0210360_168898Not Available812Open in IMG/M
3300021273|Ga0210340_1055452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei552Open in IMG/M
3300021273|Ga0210340_1072860Not Available588Open in IMG/M
3300021274|Ga0210327_144236Not Available815Open in IMG/M
3300021282|Ga0210303_1040864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei577Open in IMG/M
3300021283|Ga0210357_1025290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila823Open in IMG/M
3300021283|Ga0210357_1033738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei919Open in IMG/M
3300021283|Ga0210357_1046699Not Available827Open in IMG/M
3300021283|Ga0210357_1066894All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei591Open in IMG/M
3300021283|Ga0210357_1082684All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila824Open in IMG/M
3300021284|Ga0210299_138866Not Available780Open in IMG/M
3300021286|Ga0179583_1026051Not Available575Open in IMG/M
3300021286|Ga0179583_1029711All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300021286|Ga0179583_1033041Not Available816Open in IMG/M
3300021286|Ga0179583_1069692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia787Open in IMG/M
3300021286|Ga0179583_1093290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300021287|Ga0210338_187285All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300021292|Ga0210355_1001928All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300021292|Ga0210355_1006454Not Available810Open in IMG/M
3300021294|Ga0210325_1049988All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila685Open in IMG/M
3300021294|Ga0210325_1089473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300021302|Ga0210328_1046169All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila757Open in IMG/M
3300021307|Ga0179585_1000491Not Available766Open in IMG/M
3300021307|Ga0179585_1054032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia709Open in IMG/M
3300021307|Ga0179585_1073473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300021314|Ga0210370_1098544All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila619Open in IMG/M
3300021315|Ga0179958_1006382Not Available807Open in IMG/M
3300021315|Ga0179958_1168788Not Available710Open in IMG/M
3300021316|Ga0210351_1346438Not Available732Open in IMG/M
3300021317|Ga0210309_1165861Not Available814Open in IMG/M
3300021323|Ga0210295_1176534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei543Open in IMG/M
3300021325|Ga0210301_1233841Not Available808Open in IMG/M
3300021329|Ga0210362_1189058All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei721Open in IMG/M
3300021331|Ga0210347_1084265All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300021333|Ga0210324_1037381Not Available592Open in IMG/M
3300021333|Ga0210324_1331515Not Available511Open in IMG/M
3300021333|Ga0210324_1376167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei712Open in IMG/M
3300021336|Ga0210307_1118661Not Available881Open in IMG/M
3300021336|Ga0210307_1391277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300021602|Ga0194060_10304470Not Available786Open in IMG/M
3300021849|Ga0210304_1091496All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300021849|Ga0210304_1091733All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei500Open in IMG/M
3300021852|Ga0210317_1158564Not Available806Open in IMG/M
3300021853|Ga0210323_1000051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei810Open in IMG/M
3300021853|Ga0210323_1013760Not Available824Open in IMG/M
3300021853|Ga0210323_1091753Not Available565Open in IMG/M
3300021853|Ga0210323_1110211All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300021853|Ga0210323_1124078Not Available571Open in IMG/M
3300021855|Ga0213854_1045478Not Available792Open in IMG/M
3300021855|Ga0213854_1148403Not Available633Open in IMG/M
3300021855|Ga0213854_1289087Not Available544Open in IMG/M
3300021856|Ga0213850_1190645Not Available795Open in IMG/M
3300021857|Ga0213849_1154416Not Available834Open in IMG/M
3300021858|Ga0213852_1427172Not Available815Open in IMG/M
3300021859|Ga0210334_11124455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila763Open in IMG/M
3300021860|Ga0213851_1029242All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila666Open in IMG/M
3300021860|Ga0213851_1448690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei568Open in IMG/M
3300021860|Ga0213851_1449686Not Available650Open in IMG/M
3300021860|Ga0213851_1820740All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300021861|Ga0213853_10730074Not Available807Open in IMG/M
3300021929|Ga0213845_1006679All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei819Open in IMG/M
3300021929|Ga0213845_1071832All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia800Open in IMG/M
3300021929|Ga0213845_1175638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei806Open in IMG/M
3300021929|Ga0213845_1176680All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300021938|Ga0213847_1076007Not Available815Open in IMG/M
3300021938|Ga0213847_1080382All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia837Open in IMG/M
3300021938|Ga0213847_1094289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila580Open in IMG/M
3300021938|Ga0213847_1203589All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300021947|Ga0213856_1046634Not Available800Open in IMG/M
3300021947|Ga0213856_1138262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila827Open in IMG/M
3300021947|Ga0213856_1217620Not Available599Open in IMG/M
3300021967|Ga0213848_1054807All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila566Open in IMG/M
3300021967|Ga0213848_1097035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300021969|Ga0232063_1150340Not Available811Open in IMG/M
3300021970|Ga0232057_1146079Not Available819Open in IMG/M
3300022141|Ga0213933_111487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300022141|Ga0213933_111659Not Available812Open in IMG/M
3300022144|Ga0213855_1030310Not Available792Open in IMG/M
3300022144|Ga0213855_1121591Not Available779Open in IMG/M
3300022147|Ga0213930_106789Not Available807Open in IMG/M
3300022147|Ga0213930_115518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila575Open in IMG/M
3300022151|Ga0232064_116146Not Available804Open in IMG/M
3300022154|Ga0213929_1010774All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300022154|Ga0213929_1012323Not Available770Open in IMG/M
3300022154|Ga0213929_1025151All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia584Open in IMG/M
3300022156|Ga0213934_1033450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei697Open in IMG/M
3300022156|Ga0213934_1037801Not Available660Open in IMG/M
3300022161|Ga0213931_1042297Not Available550Open in IMG/M
3300022161|Ga0213931_1049746Not Available515Open in IMG/M
3300022166|Ga0213932_1031102Not Available779Open in IMG/M
3300022166|Ga0213932_1038936Not Available695Open in IMG/M
3300022171|Ga0213857_1013308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei822Open in IMG/M
3300022171|Ga0213857_1014015Not Available808Open in IMG/M
3300022171|Ga0213857_1014288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia803Open in IMG/M
3300022185|Ga0079039_1279275Not Available533Open in IMG/M
3300022195|Ga0222625_1166924Not Available663Open in IMG/M
3300022222|Ga0226658_10177212Not Available974Open in IMG/M
3300022372|Ga0210293_113382All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300022373|Ga0210319_1009974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300022385|Ga0210376_1024531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila856Open in IMG/M
3300022467|Ga0224712_10244001Not Available828Open in IMG/M
3300022498|Ga0242644_1011172Not Available808Open in IMG/M
3300022498|Ga0242644_1011215All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300022499|Ga0242641_1010772All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300022499|Ga0242641_1010814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300022499|Ga0242641_1031200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei585Open in IMG/M
3300022502|Ga0242646_1008778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300022503|Ga0242650_1006099Not Available811Open in IMG/M
3300022504|Ga0242642_1024331All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei844Open in IMG/M
3300022504|Ga0242642_1034803Not Available741Open in IMG/M
3300022504|Ga0242642_1051925All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila641Open in IMG/M
3300022504|Ga0242642_1064465Not Available592Open in IMG/M
3300022505|Ga0242647_1011516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei799Open in IMG/M
3300022506|Ga0242648_1022935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei814Open in IMG/M
3300022506|Ga0242648_1024155All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300022506|Ga0242648_1029495Not Available753Open in IMG/M
3300022507|Ga0222729_1016858Not Available829Open in IMG/M
3300022507|Ga0222729_1017804All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia815Open in IMG/M
3300022507|Ga0222729_1030445All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila682Open in IMG/M
3300022510|Ga0242652_1013905All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300022510|Ga0242652_1035447All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia589Open in IMG/M
3300022511|Ga0242651_1011801All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila826Open in IMG/M
3300022528|Ga0242669_1035922Not Available796Open in IMG/M
3300022529|Ga0242668_1052500Not Available731Open in IMG/M
3300022530|Ga0242658_1062238Not Available818Open in IMG/M
3300022530|Ga0242658_1080057Not Available749Open in IMG/M
3300022530|Ga0242658_1123191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei644Open in IMG/M
3300022530|Ga0242658_1127813Not Available636Open in IMG/M
3300022531|Ga0242660_1068560Not Available812Open in IMG/M
3300022531|Ga0242660_1071090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei802Open in IMG/M
3300022531|Ga0242660_1072622All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila796Open in IMG/M
3300022531|Ga0242660_1090278Not Available735Open in IMG/M
3300022645|Ga0232058_1428658Not Available811Open in IMG/M
3300022652|Ga0232059_1042497Not Available817Open in IMG/M
3300022708|Ga0242670_1019051All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300022708|Ga0242670_1019052Not Available805Open in IMG/M
3300022708|Ga0242670_1056399Not Available571Open in IMG/M
3300022709|Ga0222756_1024020All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei800Open in IMG/M
3300022712|Ga0242653_1013140All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1064Open in IMG/M
3300022712|Ga0242653_1029676Not Available812Open in IMG/M
3300022713|Ga0242677_1005541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1227Open in IMG/M
3300022713|Ga0242677_1019862Not Available821Open in IMG/M
3300022714|Ga0242671_1030202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei814Open in IMG/M
3300022718|Ga0242675_1095671Not Available565Open in IMG/M
3300022720|Ga0242672_1029518Not Available821Open in IMG/M
3300022720|Ga0242672_1030293Not Available815Open in IMG/M
3300022720|Ga0242672_1031077Not Available809Open in IMG/M
3300022720|Ga0242672_1031084Not Available809Open in IMG/M
3300022720|Ga0242672_1058211Not Available669Open in IMG/M
3300022721|Ga0242666_1057848All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila830Open in IMG/M
3300022721|Ga0242666_1060809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei815Open in IMG/M
3300022721|Ga0242666_1074351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila753Open in IMG/M
3300022721|Ga0242666_1079755All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila732Open in IMG/M
3300022721|Ga0242666_1144316Not Available579Open in IMG/M
3300022722|Ga0242657_1069928All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300022722|Ga0242657_1071586Not Available805Open in IMG/M
3300022722|Ga0242657_1073391All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300022724|Ga0242665_10114621All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300022724|Ga0242665_10118816Not Available804Open in IMG/M
3300022724|Ga0242665_10119267All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300022724|Ga0242665_10189017Not Available672Open in IMG/M
3300022726|Ga0242654_10137646Not Available804Open in IMG/M
3300022726|Ga0242654_10138018All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300022726|Ga0242654_10140649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300022726|Ga0242654_10425745Not Available514Open in IMG/M
3300023691|Ga0228704_108629Not Available794Open in IMG/M
3300023691|Ga0228704_124127Not Available506Open in IMG/M
3300023697|Ga0228706_1019808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei819Open in IMG/M
3300023697|Ga0228706_1019865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia818Open in IMG/M
3300023697|Ga0228706_1020803Not Available800Open in IMG/M
3300023697|Ga0228706_1027927Not Available696Open in IMG/M
3300023700|Ga0228707_1069418Not Available514Open in IMG/M
3300023703|Ga0228708_1030052Not Available811Open in IMG/M
3300023703|Ga0228708_1030417All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300023703|Ga0228708_1044729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila661Open in IMG/M
3300023703|Ga0228708_1074573Not Available514Open in IMG/M
3300023706|Ga0232123_1052718Not Available812Open in IMG/M
3300023708|Ga0228709_1052377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei834Open in IMG/M
3300023708|Ga0228709_1054241All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300023708|Ga0228709_1054396All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300023708|Ga0228709_1055176All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300023708|Ga0228709_1064781Not Available741Open in IMG/M
3300023708|Ga0228709_1071950All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei701Open in IMG/M
3300023708|Ga0228709_1083555All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia646Open in IMG/M
3300023708|Ga0228709_1110606Not Available558Open in IMG/M
3300023709|Ga0232122_1075236Not Available809Open in IMG/M
(restricted) 3300024054|Ga0233425_10017412All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia7116Open in IMG/M
3300024346|Ga0244775_10246639All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1489Open in IMG/M
3300024480|Ga0255223_1079597Not Available565Open in IMG/M
3300024481|Ga0256330_1058344Not Available821Open in IMG/M
3300024481|Ga0256330_1059862Not Available810Open in IMG/M
3300024481|Ga0256330_1069789All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei745Open in IMG/M
3300024481|Ga0256330_1092809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia638Open in IMG/M
3300024481|Ga0256330_1096000All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia626Open in IMG/M
3300024481|Ga0256330_1127038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei538Open in IMG/M
3300024482|Ga0255265_1102034Not Available550Open in IMG/M
3300024483|Ga0255224_1055390Not Available818Open in IMG/M
3300024483|Ga0255224_1067494All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila742Open in IMG/M
3300024484|Ga0256332_1061453Not Available804Open in IMG/M
3300024484|Ga0256332_1080449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila696Open in IMG/M
3300024484|Ga0256332_1118979Not Available565Open in IMG/M
3300024485|Ga0256318_1086764Not Available669Open in IMG/M
3300024495|Ga0255164_1030495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia887Open in IMG/M
3300024513|Ga0255144_1043406All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia760Open in IMG/M
3300024531|Ga0255228_1053867Not Available808Open in IMG/M
3300024532|Ga0256352_1044095Not Available799Open in IMG/M
3300024532|Ga0256352_1048645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia759Open in IMG/M
3300024532|Ga0256352_1051121All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila740Open in IMG/M
3300024533|Ga0256299_1048120Not Available840Open in IMG/M
3300024533|Ga0256299_1087347All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila620Open in IMG/M
3300024534|Ga0256357_1049199Not Available820Open in IMG/M
3300024534|Ga0256357_1114774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei522Open in IMG/M
3300024535|Ga0255303_1052697Not Available809Open in IMG/M
3300024536|Ga0256338_1067946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300024537|Ga0255225_1037922Not Available808Open in IMG/M
3300024537|Ga0255225_1038016All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300024537|Ga0255225_1046126All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila735Open in IMG/M
3300024539|Ga0255231_1045460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei703Open in IMG/M
3300024540|Ga0255300_1086999All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei523Open in IMG/M
3300024541|Ga0256343_1040319All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila832Open in IMG/M
3300024541|Ga0256343_1042982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300024541|Ga0256343_1052751Not Available718Open in IMG/M
3300024542|Ga0256350_1043391All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei800Open in IMG/M
3300024542|Ga0256350_1046774Not Available769Open in IMG/M
3300024542|Ga0256350_1047326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia765Open in IMG/M
3300024542|Ga0256350_1069637All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia626Open in IMG/M
3300024542|Ga0256350_1084094Not Available568Open in IMG/M
3300024542|Ga0256350_1100221Not Available519Open in IMG/M
3300024543|Ga0256348_1038471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300024543|Ga0256348_1039167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei801Open in IMG/M
3300024543|Ga0256348_1040732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila785Open in IMG/M
3300024543|Ga0256348_1073384Not Available578Open in IMG/M
3300024543|Ga0256348_1085479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei535Open in IMG/M
3300024544|Ga0255294_1042572Not Available812Open in IMG/M
3300024544|Ga0255294_1043579Not Available802Open in IMG/M
3300024544|Ga0255294_1059447All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila681Open in IMG/M
3300024544|Ga0255294_1083976Not Available568Open in IMG/M
3300024545|Ga0256347_1057893All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia867Open in IMG/M
3300024546|Ga0256356_1100816All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila533Open in IMG/M
3300024546|Ga0256356_1104833Not Available523Open in IMG/M
3300024547|Ga0255292_1052695Not Available800Open in IMG/M
3300024548|Ga0256342_1067400All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
3300024548|Ga0256342_1072377All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila785Open in IMG/M
3300024548|Ga0256342_1077584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila755Open in IMG/M
3300024549|Ga0256308_1059060Not Available819Open in IMG/M
3300024550|Ga0255266_1072269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei816Open in IMG/M
3300024555|Ga0255280_1053399All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila823Open in IMG/M
3300024555|Ga0255280_1061338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei761Open in IMG/M
3300024555|Ga0255280_1099143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei579Open in IMG/M
3300024557|Ga0255283_1059496Not Available832Open in IMG/M
3300024559|Ga0255284_1058831All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei824Open in IMG/M
3300024559|Ga0255284_1060331All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia812Open in IMG/M
3300024559|Ga0255284_1060977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300024559|Ga0255284_1077216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia706Open in IMG/M
3300024560|Ga0256306_1075694All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei800Open in IMG/M
3300024561|Ga0255288_1065614All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300024562|Ga0256336_1061287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300024562|Ga0256336_1062009All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300024563|Ga0255236_1070757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300024565|Ga0255273_1070085All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia806Open in IMG/M
3300024565|Ga0255273_1082598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei737Open in IMG/M
3300024566|Ga0256309_1086456All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei797Open in IMG/M
3300024568|Ga0255238_1077142All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei802Open in IMG/M
3300024568|Ga0255238_1166793Not Available518Open in IMG/M
3300024569|Ga0255243_1082221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300024570|Ga0255276_1092449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300024571|Ga0256302_1071342Not Available816Open in IMG/M
3300024571|Ga0256302_1156591Not Available536Open in IMG/M
3300024572|Ga0255268_1114997Not Available672Open in IMG/M
3300024573|Ga0256337_1077883All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila836Open in IMG/M
3300024573|Ga0256337_1097026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila738Open in IMG/M
3300024574|Ga0255275_1116848All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei727Open in IMG/M
3300024574|Ga0255275_1147304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila634Open in IMG/M
3300024848|Ga0255229_1038077Not Available824Open in IMG/M
3300024848|Ga0255229_1040761Not Available797Open in IMG/M
3300024851|Ga0255293_1062751All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila683Open in IMG/M
3300024852|Ga0255295_1050729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300024852|Ga0255295_1050737All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia803Open in IMG/M
3300024854|Ga0255287_1065660All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila820Open in IMG/M
3300024858|Ga0255286_1058784All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia787Open in IMG/M
3300024859|Ga0255278_1051559All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei814Open in IMG/M
3300024862|Ga0256317_1065215All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300024863|Ga0255246_1073100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300024864|Ga0255271_1092462Not Available661Open in IMG/M
3300024865|Ga0256340_1136600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei590Open in IMG/M
3300024865|Ga0256340_1154924Not Available549Open in IMG/M
3300024866|Ga0255272_1099712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila727Open in IMG/M
3300024867|Ga0255267_1067981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia827Open in IMG/M
3300024867|Ga0255267_1090077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila709Open in IMG/M
3300024867|Ga0255267_1121628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia602Open in IMG/M
3300025726|Ga0255258_103478All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila840Open in IMG/M
3300025746|Ga0255241_1027000Not Available836Open in IMG/M
3300025753|Ga0255235_1032931All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila762Open in IMG/M
3300025757|Ga0256313_1029161All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae811Open in IMG/M
3300025757|Ga0256313_1072687Not Available512Open in IMG/M
3300025760|Ga0255249_1039300All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300025910|Ga0207684_11473206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei555Open in IMG/M
3300025920|Ga0207649_11318281Not Available571Open in IMG/M
3300025960|Ga0207651_11222390Not Available675Open in IMG/M
3300026275|Ga0209901_1062530All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300026276|Ga0209847_1110620All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila505Open in IMG/M
3300026386|Ga0213909_107533Not Available680Open in IMG/M
3300026402|Ga0255304_1021214All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300026402|Ga0255304_1021417Not Available811Open in IMG/M
3300026405|Ga0256296_1019377Not Available807Open in IMG/M
3300026405|Ga0256296_1020147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia793Open in IMG/M
3300026405|Ga0256296_1030325Not Available653Open in IMG/M
3300026412|Ga0256326_1031750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia809Open in IMG/M
3300026425|Ga0256300_1025784All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila820Open in IMG/M
3300026425|Ga0256300_1029429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila770Open in IMG/M
3300026428|Ga0255309_1039168Not Available825Open in IMG/M
3300026428|Ga0255309_1059496Not Available654Open in IMG/M
3300026435|Ga0256297_1032005All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300026439|Ga0256361_1038493Not Available807Open in IMG/M
3300026444|Ga0256364_1039288Not Available822Open in IMG/M
3300026454|Ga0256319_1052517Not Available804Open in IMG/M
3300026454|Ga0256319_1054275All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia790Open in IMG/M
3300026562|Ga0255285_1061317All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila740Open in IMG/M
3300026563|Ga0256355_1040856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300026563|Ga0256355_1063548All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei647Open in IMG/M
3300026563|Ga0256355_1079087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia579Open in IMG/M
3300026564|Ga0256359_1028382Not Available1082Open in IMG/M
3300026564|Ga0256359_1050692Not Available801Open in IMG/M
3300026564|Ga0256359_1066465All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila695Open in IMG/M
3300026565|Ga0256311_1149018Not Available503Open in IMG/M
3300026566|Ga0256334_1068898All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300026566|Ga0256334_1069328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia805Open in IMG/M
3300026571|Ga0255289_1068510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300026572|Ga0255270_1080656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei821Open in IMG/M
3300026572|Ga0255270_1083200All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300026573|Ga0255269_1096565Not Available806Open in IMG/M
3300026573|Ga0255269_1098040All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia799Open in IMG/M
3300027079|Ga0255188_1005495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae3140Open in IMG/M
3300027155|Ga0255081_1038332All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1032Open in IMG/M
3300027541|Ga0255158_1034779All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300027835|Ga0209515_10568444Not Available574Open in IMG/M
3300028074|Ga0256320_119287Not Available654Open in IMG/M
3300028079|Ga0255305_1025236All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300028080|Ga0256324_1028706All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila855Open in IMG/M
3300028081|Ga0255260_1037087Not Available756Open in IMG/M
3300028089|Ga0255299_1046754Not Available808Open in IMG/M
3300028097|Ga0255261_1035294Not Available813Open in IMG/M
3300028100|Ga0256363_1038568Not Available810Open in IMG/M
3300028100|Ga0256363_1039677All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300028100|Ga0256363_1062840Not Available624Open in IMG/M
3300028101|Ga0256349_1039482All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia806Open in IMG/M
3300028101|Ga0256349_1039856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300028101|Ga0256349_1040043All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300028101|Ga0256349_1044902Not Available755Open in IMG/M
3300028101|Ga0256349_1047116Not Available736Open in IMG/M
3300028108|Ga0256305_1075015Not Available827Open in IMG/M
3300028108|Ga0256305_1094732All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia723Open in IMG/M
3300028108|Ga0256305_1130921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei600Open in IMG/M
3300028112|Ga0256335_1087020Not Available824Open in IMG/M
3300028112|Ga0256335_1087950Not Available819Open in IMG/M
3300028112|Ga0256335_1165006Not Available576Open in IMG/M
3300028113|Ga0255234_1196593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei528Open in IMG/M
3300028247|Ga0256346_106187All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300028266|Ga0255227_1031163All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia813Open in IMG/M
3300028266|Ga0255227_1031266Not Available811Open in IMG/M
3300028266|Ga0255227_1063286Not Available574Open in IMG/M
3300028267|Ga0256358_1052669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia802Open in IMG/M
3300028267|Ga0256358_1089504Not Available606Open in IMG/M
3300028267|Ga0256358_1103803All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila560Open in IMG/M
3300028286|Ga0256331_1069486All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300028286|Ga0256331_1071471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia786Open in IMG/M
3300028286|Ga0256331_1072262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei781Open in IMG/M
3300028286|Ga0256331_1100917Not Available652Open in IMG/M
3300028329|Ga0210315_1035321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei645Open in IMG/M
3300028530|Ga0255279_1040257Not Available810Open in IMG/M
3300028530|Ga0255279_1043480All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila777Open in IMG/M
3300028619|Ga0257136_1043068Not Available818Open in IMG/M
3300028619|Ga0257136_1043267Not Available816Open in IMG/M
3300028619|Ga0257136_1043341Not Available815Open in IMG/M
3300028620|Ga0257139_1039399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300028621|Ga0257142_1043153Not Available821Open in IMG/M
3300028621|Ga0257142_1062397All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei664Open in IMG/M
3300028621|Ga0257142_1063050All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia660Open in IMG/M
3300028623|Ga0257141_1044914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila834Open in IMG/M
3300028623|Ga0257141_1045628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia827Open in IMG/M
3300028623|Ga0257141_1046275Not Available820Open in IMG/M
3300028623|Ga0257141_1049063Not Available793Open in IMG/M
3300028647|Ga0272412_1199209Not Available829Open in IMG/M
3300028670|Ga0257143_1029526Not Available825Open in IMG/M
3300028670|Ga0257143_1030981Not Available801Open in IMG/M
3300029288|Ga0265297_10976346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei505Open in IMG/M
3300029636|Ga0222749_10316693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300029639|Ga0265597_101538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei839Open in IMG/M
3300029639|Ga0265597_101652Not Available815Open in IMG/M
3300029640|Ga0206093_102773Not Available814Open in IMG/M
3300029640|Ga0206093_102827All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae806Open in IMG/M
3300029640|Ga0206093_102851Not Available804Open in IMG/M
3300029640|Ga0206093_102886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae799Open in IMG/M
3300029646|Ga0206092_106893Not Available770Open in IMG/M
3300029649|Ga0206085_105960Not Available696Open in IMG/M
3300029655|Ga0206091_107615Not Available814Open in IMG/M
3300029659|Ga0206094_108832Not Available813Open in IMG/M
3300029666|Ga0265600_114177Not Available812Open in IMG/M
3300029666|Ga0265600_125034Not Available584Open in IMG/M
3300029674|Ga0265604_114853Not Available803Open in IMG/M
3300029674|Ga0265604_115169Not Available794Open in IMG/M
3300029685|Ga0265603_1019653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei832Open in IMG/M
3300029685|Ga0265603_1019998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila824Open in IMG/M
3300029685|Ga0265603_1020505Not Available812Open in IMG/M
3300029687|Ga0265602_1024623All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia825Open in IMG/M
3300029687|Ga0265602_1025012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
3300029691|Ga0265598_1030935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia849Open in IMG/M
3300029691|Ga0265598_1031775Not Available835Open in IMG/M
3300029691|Ga0265598_1033587Not Available808Open in IMG/M
3300029691|Ga0265598_1034227All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei799Open in IMG/M
3300029693|Ga0257137_1036508Not Available830Open in IMG/M
3300029699|Ga0255233_1040737All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila917Open in IMG/M
3300029701|Ga0222748_1111912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei542Open in IMG/M
3300030533|Ga0247632_1008042All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei664Open in IMG/M
3300030543|Ga0210289_1601832All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila680Open in IMG/M
3300030550|Ga0247631_1012043All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei880Open in IMG/M
3300030552|Ga0247654_1157302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei554Open in IMG/M
3300030552|Ga0247654_1172611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei539Open in IMG/M
3300030565|Ga0247635_1070802All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae805Open in IMG/M
3300030571|Ga0247652_1108877Not Available616Open in IMG/M
3300030576|Ga0247644_1051787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei774Open in IMG/M
3300030579|Ga0247633_10253033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei553Open in IMG/M
3300030592|Ga0247612_1089060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei691Open in IMG/M
3300030600|Ga0247659_1223887Not Available509Open in IMG/M
3300030609|Ga0247634_10243949All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei682Open in IMG/M
3300030610|Ga0247613_10121279All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia820Open in IMG/M
3300030610|Ga0247613_10186084All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia716Open in IMG/M
3300030621|Ga0247655_10262201Not Available547Open in IMG/M
3300030623|Ga0265392_1182969Not Available567Open in IMG/M
3300030628|Ga0247629_10366356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei542Open in IMG/M
3300030634|Ga0247636_10101282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei800Open in IMG/M
3300030683|Ga0247621_1180245Not Available533Open in IMG/M
3300030730|Ga0307482_1077979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei867Open in IMG/M
3300030730|Ga0307482_1094371Not Available809Open in IMG/M
3300030730|Ga0307482_1094564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei808Open in IMG/M
3300030730|Ga0307482_1121260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei736Open in IMG/M
3300030741|Ga0265459_13491397Not Available551Open in IMG/M
3300030751|Ga0102764_1889346Not Available531Open in IMG/M
3300030764|Ga0265720_1004023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300030783|Ga0102752_1651507Not Available539Open in IMG/M
3300030790|Ga0138304_1339393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300030803|Ga0074037_1877790Not Available533Open in IMG/M
3300030805|Ga0265756_103403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila862Open in IMG/M
3300030811|Ga0265735_101861All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300030812|Ga0265734_105876Not Available539Open in IMG/M
3300030815|Ga0265746_1023535All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila762Open in IMG/M
3300030816|Ga0265729_101226Not Available794Open in IMG/M
3300030816|Ga0265729_103685Not Available563Open in IMG/M
3300030824|Ga0265726_101528Not Available819Open in IMG/M
3300030829|Ga0308203_1024334All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300030829|Ga0308203_1024459All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia807Open in IMG/M
3300030829|Ga0308203_1053745All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei616Open in IMG/M
3300030829|Ga0308203_1094107Not Available507Open in IMG/M
3300030830|Ga0308205_1016829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300030831|Ga0308152_103510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia807Open in IMG/M
3300030831|Ga0308152_115188Not Available514Open in IMG/M
3300030833|Ga0265736_101328All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300030833|Ga0265736_101565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei776Open in IMG/M
3300030834|Ga0265738_101649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei814Open in IMG/M
3300030834|Ga0265738_101701All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300030855|Ga0075374_10060392Not Available809Open in IMG/M
3300030872|Ga0265723_1007029All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila720Open in IMG/M
3300030873|Ga0265751_103955All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300030875|Ga0265727_100923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila821Open in IMG/M
3300030875|Ga0265727_101482All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila711Open in IMG/M
3300030876|Ga0265730_101105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300030880|Ga0265776_102992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300030887|Ga0265733_101997All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei707Open in IMG/M
3300030902|Ga0308202_1043753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300030902|Ga0308202_1043776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia801Open in IMG/M
3300030902|Ga0308202_1079947Not Available648Open in IMG/M
3300030902|Ga0308202_1113700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei572Open in IMG/M
3300030903|Ga0308206_1054017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300030903|Ga0308206_1054221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300030903|Ga0308206_1076842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei712Open in IMG/M
3300030904|Ga0308198_1026127Not Available811Open in IMG/M
3300030904|Ga0308198_1026825All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300030905|Ga0308200_1042384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei825Open in IMG/M
3300030905|Ga0308200_1044419All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila811Open in IMG/M
3300030923|Ga0138296_1094899Not Available766Open in IMG/M
3300030937|Ga0138302_1448429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila776Open in IMG/M
3300030937|Ga0138302_1524914All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei573Open in IMG/M
3300030967|Ga0075399_10034821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei635Open in IMG/M
3300030968|Ga0075376_10031380All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila555Open in IMG/M
3300030973|Ga0075395_10035760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei826Open in IMG/M
3300030977|Ga0265721_1002177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300030977|Ga0265721_1010252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei582Open in IMG/M
3300030982|Ga0265748_102591Not Available762Open in IMG/M
3300030982|Ga0265748_106277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei588Open in IMG/M
3300030986|Ga0308154_104398All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300030987|Ga0308155_1008061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300030988|Ga0308183_1055217All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei809Open in IMG/M
3300030988|Ga0308183_1056001All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300030989|Ga0308196_1017593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300030989|Ga0308196_1027346Not Available701Open in IMG/M
3300030989|Ga0308196_1062544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei537Open in IMG/M
3300030990|Ga0308178_1043405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei816Open in IMG/M
3300030993|Ga0308190_1057354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia768Open in IMG/M
3300030993|Ga0308190_1130594All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei580Open in IMG/M
3300030993|Ga0308190_1138717Not Available568Open in IMG/M
3300030997|Ga0073997_10092227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila613Open in IMG/M
3300030998|Ga0073996_10085032Not Available686Open in IMG/M
3300031016|Ga0265732_101193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300031016|Ga0265732_101200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300031023|Ga0073998_11642557Not Available546Open in IMG/M
3300031036|Ga0073978_1628217Not Available811Open in IMG/M
3300031042|Ga0265749_101105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300031043|Ga0265779_103959All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila775Open in IMG/M
3300031058|Ga0308189_10131572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei836Open in IMG/M
3300031058|Ga0308189_10139809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia819Open in IMG/M
3300031058|Ga0308189_10143489Not Available811Open in IMG/M
3300031058|Ga0308189_10143705All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300031058|Ga0308189_10170243All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila765Open in IMG/M
3300031058|Ga0308189_10276527Not Available646Open in IMG/M
3300031058|Ga0308189_10423806Not Available556Open in IMG/M
3300031058|Ga0308189_10495677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei525Open in IMG/M
3300031081|Ga0308185_1029933Not Available655Open in IMG/M
3300031082|Ga0308192_1026830All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia779Open in IMG/M
3300031082|Ga0308192_1053102Not Available613Open in IMG/M
3300031091|Ga0308201_10110588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei808Open in IMG/M
3300031091|Ga0308201_10113660Not Available801Open in IMG/M
3300031091|Ga0308201_10340547Not Available547Open in IMG/M
3300031092|Ga0308204_10092718All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300031092|Ga0308204_10100727Not Available796Open in IMG/M
3300031092|Ga0308204_10175506Not Available653Open in IMG/M
3300031092|Ga0308204_10179790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei647Open in IMG/M
3300031093|Ga0308197_10106814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila838Open in IMG/M
3300031093|Ga0308197_10117898All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300031094|Ga0308199_1051906All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia804Open in IMG/M
3300031095|Ga0308184_1012828All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300031095|Ga0308184_1022968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei683Open in IMG/M
3300031095|Ga0308184_1030368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila627Open in IMG/M
3300031096|Ga0308193_1023488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei809Open in IMG/M
3300031096|Ga0308193_1029797Not Available747Open in IMG/M
3300031096|Ga0308193_1047177Not Available639Open in IMG/M
3300031097|Ga0308188_1031849Not Available548Open in IMG/M
3300031097|Ga0308188_1037871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei517Open in IMG/M
3300031099|Ga0308181_1048539All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300031099|Ga0308181_1108218All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei609Open in IMG/M
3300031100|Ga0308180_1010439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei806Open in IMG/M
3300031100|Ga0308180_1010648Not Available801Open in IMG/M
3300031100|Ga0308180_1011548All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila780Open in IMG/M
3300031114|Ga0308187_10134214Not Available808Open in IMG/M
3300031114|Ga0308187_10138856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila799Open in IMG/M
3300031114|Ga0308187_10334837All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila579Open in IMG/M
3300031123|Ga0308195_1021120All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300031123|Ga0308195_1034873All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei678Open in IMG/M
3300031124|Ga0308151_1012552All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300031125|Ga0308182_1006920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia815Open in IMG/M
3300031125|Ga0308182_1012082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia674Open in IMG/M
3300031125|Ga0308182_1019026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia577Open in IMG/M
3300031231|Ga0170824_106755217All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila535Open in IMG/M
3300031231|Ga0170824_124056069Not Available589Open in IMG/M
3300031239|Ga0265328_10464098Not Available502Open in IMG/M
3300031251|Ga0265327_10455832Not Available552Open in IMG/M
3300031421|Ga0308194_10206893All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila638Open in IMG/M
3300031421|Ga0308194_10259673Not Available586Open in IMG/M
3300031422|Ga0308186_1009544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia825Open in IMG/M
3300031422|Ga0308186_1009791Not Available818Open in IMG/M
3300031422|Ga0308186_1023192Not Available610Open in IMG/M
3300031423|Ga0308177_1020617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei580Open in IMG/M
3300031424|Ga0308179_1014527All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei808Open in IMG/M
3300031424|Ga0308179_1014719All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300031424|Ga0308179_1016347All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila778Open in IMG/M
3300031424|Ga0308179_1025757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia673Open in IMG/M
3300031446|Ga0170820_16813510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei792Open in IMG/M
3300031469|Ga0170819_11991618All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila830Open in IMG/M
3300031469|Ga0170819_13232460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei713Open in IMG/M
3300031469|Ga0170819_17740139Not Available651Open in IMG/M
3300031476|Ga0314827_108448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia811Open in IMG/M
3300031476|Ga0314827_108564Not Available806Open in IMG/M
3300031481|Ga0314816_1020033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia825Open in IMG/M
3300031484|Ga0314822_104619All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
3300031487|Ga0314823_105224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei831Open in IMG/M
3300031487|Ga0314823_105270All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia827Open in IMG/M
3300031490|Ga0314825_105166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei808Open in IMG/M
3300031491|Ga0314824_103270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300031493|Ga0314826_114137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300031493|Ga0314826_114191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia801Open in IMG/M
3300031493|Ga0314826_116185All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei752Open in IMG/M
3300031495|Ga0314817_113892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia698Open in IMG/M
3300031499|Ga0314818_106200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
3300031502|Ga0314819_105025Not Available808Open in IMG/M
3300031503|Ga0314820_104806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae813Open in IMG/M
3300031548|Ga0307408_100606272All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila974Open in IMG/M
3300031560|Ga0265605_1029644Not Available807Open in IMG/M
3300031560|Ga0265605_1047370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila609Open in IMG/M
3300031590|Ga0307483_1009736All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila827Open in IMG/M
3300031595|Ga0265313_10120317All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 61146Open in IMG/M
3300031661|Ga0307274_1022690Not Available819Open in IMG/M
3300031677|Ga0307480_1005068All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei810Open in IMG/M
3300031677|Ga0307480_1022182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei518Open in IMG/M
3300031940|Ga0310901_10423827Not Available584Open in IMG/M
3300031960|Ga0307272_1038116Not Available812Open in IMG/M
3300032149|Ga0315302_1045495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei828Open in IMG/M
3300032168|Ga0316593_10247567All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila666Open in IMG/M
3300032177|Ga0315276_11099557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia842Open in IMG/M
3300032256|Ga0315271_10160808All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae1769Open in IMG/M
3300032893|Ga0335069_11615716All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia694Open in IMG/M
3300032955|Ga0335076_11497692Not Available562Open in IMG/M
3300033004|Ga0335084_10923998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila882Open in IMG/M
3300033524|Ga0316592_1066360All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300033527|Ga0316586_1061206Not Available684Open in IMG/M
3300033528|Ga0316588_1075994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila828Open in IMG/M
3300033528|Ga0316588_1082540Not Available797Open in IMG/M
3300033529|Ga0316587_1044137Not Available809Open in IMG/M
3300033529|Ga0316587_1092893Not Available577Open in IMG/M
3300034106|Ga0335036_0398093All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei886Open in IMG/M
3300034160|Ga0370510_0131509Not Available765Open in IMG/M
3300034357|Ga0335064_0754562Not Available598Open in IMG/M
3300034448|Ga0370540_04018Not Available771Open in IMG/M
3300034479|Ga0314785_005053All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila856Open in IMG/M
3300034479|Ga0314785_005895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei813Open in IMG/M
3300034479|Ga0314785_009479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei694Open in IMG/M
3300034480|Ga0314789_007886Not Available830Open in IMG/M
3300034480|Ga0314789_008281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei817Open in IMG/M
3300034480|Ga0314789_008772Not Available802Open in IMG/M
3300034480|Ga0314789_012624Not Available708Open in IMG/M
3300034481|Ga0315299_09137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei821Open in IMG/M
3300034482|Ga0326770_009772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae815Open in IMG/M
3300034643|Ga0370545_153818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei531Open in IMG/M
3300034644|Ga0370548_039891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300034652|Ga0316598_099494All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300034653|Ga0316599_088225Not Available806Open in IMG/M
3300034653|Ga0316599_088254Not Available806Open in IMG/M
3300034653|Ga0316599_088355All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei805Open in IMG/M
3300034653|Ga0316599_121671All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei687Open in IMG/M
3300034659|Ga0314780_052756Not Available819Open in IMG/M
3300034659|Ga0314780_053333Not Available816Open in IMG/M
3300034659|Ga0314780_054541All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
3300034659|Ga0314780_055443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia806Open in IMG/M
3300034659|Ga0314780_067018Not Available756Open in IMG/M
3300034659|Ga0314780_067083Not Available756Open in IMG/M
3300034659|Ga0314780_154667Not Available568Open in IMG/M
3300034660|Ga0314781_019554All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1042Open in IMG/M
3300034660|Ga0314781_038859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila817Open in IMG/M
3300034660|Ga0314781_039131Not Available815Open in IMG/M
3300034660|Ga0314781_052627Not Available734Open in IMG/M
3300034660|Ga0314781_057532Not Available711Open in IMG/M
3300034660|Ga0314781_099839Not Available583Open in IMG/M
3300034661|Ga0314782_052062All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia818Open in IMG/M
3300034661|Ga0314782_052063All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300034661|Ga0314782_070939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia737Open in IMG/M
3300034661|Ga0314782_147198Not Available574Open in IMG/M
3300034661|Ga0314782_150529Not Available570Open in IMG/M
3300034661|Ga0314782_188441All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia528Open in IMG/M
3300034661|Ga0314782_191929Not Available525Open in IMG/M
3300034662|Ga0314783_042398Not Available829Open in IMG/M
3300034662|Ga0314783_071859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila692Open in IMG/M
3300034662|Ga0314783_163740Not Available522Open in IMG/M
3300034663|Ga0314784_021821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1011Open in IMG/M
3300034663|Ga0314784_041381All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila813Open in IMG/M
3300034663|Ga0314784_096301Not Available611Open in IMG/M
3300034664|Ga0314786_032446All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila907Open in IMG/M
3300034664|Ga0314786_046243All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia806Open in IMG/M
3300034664|Ga0314786_085439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia657Open in IMG/M
3300034664|Ga0314786_093690Not Available636Open in IMG/M
3300034664|Ga0314786_095145All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei633Open in IMG/M
3300034665|Ga0314787_030791All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia814Open in IMG/M
3300034665|Ga0314787_033334All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300034665|Ga0314787_039039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia748Open in IMG/M
3300034665|Ga0314787_055510Not Available661Open in IMG/M
3300034665|Ga0314787_063316Not Available631Open in IMG/M
3300034666|Ga0314788_048321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia830Open in IMG/M
3300034666|Ga0314788_058514All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia780Open in IMG/M
3300034666|Ga0314788_152301All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia565Open in IMG/M
3300034667|Ga0314792_070292Not Available815Open in IMG/M
3300034667|Ga0314792_078391All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia785Open in IMG/M
3300034667|Ga0314792_093712Not Available737Open in IMG/M
3300034668|Ga0314793_041240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300034668|Ga0314793_042493Not Available807Open in IMG/M
3300034668|Ga0314793_044274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila796Open in IMG/M
3300034668|Ga0314793_051199All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia758Open in IMG/M
3300034668|Ga0314793_089996Not Available625Open in IMG/M
3300034669|Ga0314794_137383Not Available556Open in IMG/M
3300034669|Ga0314794_160155Not Available527Open in IMG/M
3300034670|Ga0314795_121086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila544Open in IMG/M
3300034671|Ga0314796_036533Not Available884Open in IMG/M
3300034672|Ga0314797_038384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia831Open in IMG/M
3300034672|Ga0314797_042212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia804Open in IMG/M
3300034672|Ga0314797_046737Not Available776Open in IMG/M
3300034672|Ga0314797_049016All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei762Open in IMG/M
3300034672|Ga0314797_073197Not Available663Open in IMG/M
3300034672|Ga0314797_083407Not Available633Open in IMG/M
3300034673|Ga0314798_045230Not Available809Open in IMG/M
3300034673|Ga0314798_104064Not Available604Open in IMG/M
3300034674|Ga0314799_013513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei811Open in IMG/M
3300034674|Ga0314799_035629Not Available574Open in IMG/M
3300034675|Ga0314800_061120All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei556Open in IMG/M
3300034676|Ga0314801_051366All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei818Open in IMG/M
3300034676|Ga0314801_053389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300034676|Ga0314801_053594All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300034676|Ga0314801_059330Not Available777Open in IMG/M
3300034677|Ga0314802_006656All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila986Open in IMG/M
3300034677|Ga0314802_020078Not Available671Open in IMG/M
3300034678|Ga0314803_035191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300034678|Ga0314803_036322All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia804Open in IMG/M
3300034678|Ga0314803_061697Not Available670Open in IMG/M
3300034678|Ga0314803_143555All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia502Open in IMG/M
3300034680|Ga0370541_015725All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300034680|Ga0370541_055113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei528Open in IMG/M
3300034681|Ga0370546_025527All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia811Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.33%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland4.77%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.69%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.53%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water3.98%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds3.18%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater2.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.31%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.86%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.59%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.11%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.43%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.03%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.95%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.88%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.48%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.48%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.48%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.48%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.40%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.40%
Anaerobic Bioreactor BiomassEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass0.40%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.32%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.32%
Wastewater TreatmentEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment0.32%
Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil0.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.24%
Wetland SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil0.24%
Subtropical SoilEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil0.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.16%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.16%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.16%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.16%
Subsurface WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water0.16%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.08%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.08%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.08%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.08%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.08%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.08%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.08%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.08%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.08%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.08%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.08%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.08%
Enriched Soil AggregateEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate0.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.08%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.08%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.08%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.08%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.08%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.08%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.08%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.08%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.08%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.08%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111013Subtropical soil microbial communities from Bundaberg Australia-rainforestEnvironmentalOpen in IMG/M
2222084002Subtropical soil microbial communities from Bundaberg Australia-sugarcane farmEnvironmentalOpen in IMG/M
2228664014Contaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31EnvironmentalOpen in IMG/M
3300001808Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300001810Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300002341Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - D_52min_Anaerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300002343Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300002346Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - J_51min_Aerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300002675Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF122 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002677Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002678Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF126 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002680Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF132 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002681Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002864Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300002865Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300002868Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003158Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003162Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003289Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_19 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003308Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300003563Grassland soil microbial communities from Hopland, California, USA - Sample H4_Bulk_46 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003576Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003611Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003672Estuarine microbial mat communities from Elkhorn Slough, Moss Landing, CA, USA - CR2A Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004102Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004120Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004130Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF226 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004131Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF232 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004133Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004134Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004140Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004473Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004530Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 40_LOW7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004567Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 9_HOW4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004622Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005506Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005646Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300006230Marine sediment microbial communities, 15.1 km from oil contamination, ambient, Gulf of Mexico ? BC155EnvironmentalOpen in IMG/M
3300006235Marine sediment microbial communities, 33.9 km from oil contamination, ambient, Gulf of Mexico ? BC463EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006366Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006647Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_4R (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300006727Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0619 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006731Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 AAIW_A metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006937Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007159Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2013 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007219Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2013 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007232Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007235Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 D RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007237Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 A RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007321Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007327Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007526Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007602Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_B6L_H (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008648Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-60EnvironmentalOpen in IMG/M
3300008702Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-46EnvironmentalOpen in IMG/M
3300008785Microbial communities from wetland soil in Czech Republic - R1_cDNAEnvironmentalOpen in IMG/M
3300008787Microbial communities from wetland soil in Czech Republic - R3_cDNAEnvironmentalOpen in IMG/M
3300008884Microbial communities of wastewater sludge from Singapore - Sludge3_b2_FebruaryEnvironmentalOpen in IMG/M
3300009196Microbial communities of wastewater sludge from Singapore - Sludge1_b2_FebruaryEnvironmentalOpen in IMG/M
3300009199Microbial communities of wastewater sludge from Singapore - Sludge7_b2_FebruaryEnvironmentalOpen in IMG/M
3300009223Microbial communities of water from Amazon river, Brazil - RCM3EnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009228Microbial communities of water from Amazon river, Brazil - RCM7EnvironmentalOpen in IMG/M
3300009230Microbial communities of water from Amazon river, Brazil - RCM8EnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009247Microbial communities of water from Amazon river, Brazil - RCM14EnvironmentalOpen in IMG/M
3300009249Microbial communities of water from Amazon river, Brazil - RCM15EnvironmentalOpen in IMG/M
3300009252Microbial communities of water from Amazon river, Brazil - RCM16EnvironmentalOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300009261Microbial communities of water from Amazon river, Brazil - RCM23EnvironmentalOpen in IMG/M
3300009295Microbial communities of wastewater sludge from Singapore - Sludge5_b2_FebruaryEnvironmentalOpen in IMG/M
3300009337Microbial communities of water from Amazon river, Brazil - RCM17EnvironmentalOpen in IMG/M
3300009352Microbial communities of water from Amazon river, Brazil - RCM18EnvironmentalOpen in IMG/M
3300009387Microbial communities of water from Amazon river, Brazil - RCM24EnvironmentalOpen in IMG/M
3300009404Microbial communities of water from Amazon river, Brazil - RCM6EnvironmentalOpen in IMG/M
3300009579Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009580Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009581Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009582Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009583Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009584Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009587Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009834Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 2, 6m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010061Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010066Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010067Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010071Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010075Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010077Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010080Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010084Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010090Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010091Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010094Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010096Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010101Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010103Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010109Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010110Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010118Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010121Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010124Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010126Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010130Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010136Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010138Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010144Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010854Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010856Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010857Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010895Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011028Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011046Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011055Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011057Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011061Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011062Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011064Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011281Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_6R (Metagenome Metatranscriptome) (version 2)EngineeredOpen in IMG/M
3300011282Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011288Marine microbial communities from the Southern Atlantic ocean - KN S17 NADW_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011299Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_D5L_HD (Metagenome Metatranscriptome) (version 2)EngineeredOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012372Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012377Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012380Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012382Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012686Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012689Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012690Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES078 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012691Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012699Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012703Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA- GEODES074 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012747Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012754Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012755Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012761Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012764Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012768Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012769Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012776Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012777Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012778Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012781Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013043Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013044Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013045Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013046Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013052Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013059Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013068Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES062 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013078Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013080Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013232Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1EngineeredOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300016678Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES102 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016680Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES103 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016682Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES101 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016688Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016699Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018549Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p8EnvironmentalOpen in IMG/M
3300018610Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2EnvironmentalOpen in IMG/M
3300019158Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019198Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019199Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019205Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC045_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019209Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW3_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019211Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019212Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019213Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019215Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC12_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019216Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019221Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019225Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019231Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019234Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019241Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019245Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019247Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC028_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019250Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019251Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019252Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019267Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021257Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.272 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021258Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021267Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021268Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63.3A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021269Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021270Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.593 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021273Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021274Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.268 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021283Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021286Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021287Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.380 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021292Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.493 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021294Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.264 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021302Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.270 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021314Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021315Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021316Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021331Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021852Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021853Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021855Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021856Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021857Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021929Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021938Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021967Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021969Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_7 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300021970Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300022141Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022144Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_31 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022147Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022151Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_8 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300022154Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022156Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022161Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022166Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022171Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022185Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022222Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022373Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022385Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022503Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022505Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022645Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_2 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300022652Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_3 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023691Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023697Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023700Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023703Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023708Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024481Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024482Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024495Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024531Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024533Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024534Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024535Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024537Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024539Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024540Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024541Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024542Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024543Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024545Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024546Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024547Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024548Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024550Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024555Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024561Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024563Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024565Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024569Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024570Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024574Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024848Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024851Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024854Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024858Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024859Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024862Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024864Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024866Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024867Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025726Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025746Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025753Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025757Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025760Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026275Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes)EnvironmentalOpen in IMG/M
3300026276Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes)EnvironmentalOpen in IMG/M
3300026386Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0907-MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026402Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026405Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026412Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026428Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026435Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026439Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026444Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026454Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026563Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026564Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026565Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026566Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026571Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027079Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027155Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027541Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300028074Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028079Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028080Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028081Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028089Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028097Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028100Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028101Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028112Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028247Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028266Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028267Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028530Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028619Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028620Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028621Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028623Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300028670Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_50m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300029288Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91EngineeredOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029639Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029640Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029646Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029649Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029655Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029659Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029666Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_80m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029674Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029685Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029687Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029691Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029693Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029699Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030533Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030571Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030576Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030683Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030751Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030764Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030783Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030803Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030805Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030811Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030812Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030816Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030824Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030833Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030834Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030873Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030875Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030876Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030880Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030887Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030967Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030977Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030982Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030986Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030987Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031016Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031042Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031043Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031124Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031125Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031423Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031476Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031481Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031484Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031487Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031490Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031491Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031493Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031495Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031499Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031502Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031503Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031560Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_60m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031661Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031677Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031960Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG08 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032149Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_1000m_931 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032168Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033524Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033527Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033528Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033529Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034160Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M
3300034448Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034479Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034480Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034481Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_Tmax_1102 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034482Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S02 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034653Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034670Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034674Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034677Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DRAFT_002877002209111013Subtropical SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKKKK
DRAFT_003211702222084002Subtropical SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHS
DRAFT_004983202222084002Subtropical SoilMRPKHPHAAESGVGKHTTRESERAQACAAGKERVAN
PheDRAFT_000340302228664014Contaminated SoilMRPRHPHAAESGVGKYTARESESAKACAIGKERVANA
PheDRAFT_000631202228664014Contaminated SoilMRPRHPHAAESGVGKYTARESESAKACAIGKERVANAHY
PheDRAFT_000457202228664014Contaminated SoilMRPRHPHAAESGVGKYTARESESAKACAIGKERVANAHS
JGI20218J20341_100320423300001808WetlandMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHNW
JGI20221J20338_101226623300001810WetlandMRPRSAHAALSSVGEHTTRESEGAKCCAEGKERVANAHP
JGI24213J29975_100117533300002341Wastewater TreatmentMRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPHKL
JGI24214J29971_100175923300002343Wastewater TreatmentMRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPHKLAP
JGI24216J29974_100310423300002346Wastewater TreatmentMRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPH
Ga0005473J37261_10025323300002675Forest SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPH
Ga0005475J37263_10150713300002677Forest SoilMRPRHPRAAESGVGKHTARESESAKACAVGKERVANAHPHKLAP
Ga0005477J37265_10026923300002678Forest SoilMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHKL
Ga0005483J37271_10080013300002680Forest SoilMRPRHPHAAESGVGKHTARESESAKACAVGKERVANAHPH
Ga0005471J37259_10051013300002681Forest SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLA
Ga0006842J43188_10075823300002861Peatlands SoilMRPKHLHAAESGVGKHTARESERVQACAAGKEHVTNAHPH
Ga0006764J43180_10005423300002864Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNWPR
Ga0006761J43178_10003533300002865Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHK
Ga0006767J43181_10003123300002868Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNW
Ga0006760J45825_10007933300003158Avena Fatua RhizosphereMRPKHPHAAESGVGKHIARESESVQACAAGKERVTNAHPH
Ga0006760J45825_10032313300003158Avena Fatua RhizosphereMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSH
Ga0006778J45830_100022313300003162Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESESVQACAAGKERVTNAHPHKLA
Ga0006776J48906_10133323300003289Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIW
Ga0006777J48905_100155223300003308Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPR
JGIcombinedJ51221_1018859713300003505Forest SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLAP
Ga0007430J51106_10224413300003563Avena Fatua RhizosphereMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPH
Ga0007413J51701_100003713300003576Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKQKQ
Ga0007411J51799_10008523300003611Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKAK
Ga0001194_10027323300003672EstuarineMRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAHPH
Ga0001194_10034223300003672EstuarineMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPH
Ga0005853_101231523300003754Freshwater And SedimentMRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQ
Ga0058888_102492213300004102Forest SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQ
Ga0058901_103246213300004120Forest SoilMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQ
Ga0058895_100474513300004130Forest SoilMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPQ
Ga0058898_101060813300004131Forest SoilMRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANAHPH
Ga0058892_101423113300004133Forest SoilMRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPP
Ga0058906_101889513300004134Forest SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPRYIRVPRR
Ga0058894_101736513300004140Forest SoilMRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPHKLA
Ga0066599_10093445423300004282FreshwaterMRPRSAHAALSGVGEHTARESESAQCCADGKERVANAHPHFEPGTARSRV
Ga0068919_104214913300004473Peatlands SoilMRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAHPH
Ga0066516_11255613300004530Freshwater SedimentMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLAP
Ga0066495_11206523300004567Freshwater SedimentMRPKHPPAAESGVGKHTARESERAQSCATGKERVANAHPQIW
Ga0058865_108928213300004622Wastewater TreatmentMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPH
Ga0058859_1006955023300004798Host-AssociatedMRPKHPRAAESGVGKHIARESESAKACAAGKERVANAHPQ
Ga0058861_1011436413300004800Host-AssociatedMRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLAP
Ga0058860_1013791213300004801Host-AssociatedMRLKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPE
Ga0058860_1016603613300004801Host-AssociatedMRPRHPHAAESGVGKHTARESESAQECVAGKERVANAHPQ
Ga0058860_1018761213300004801Host-AssociatedMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL
Ga0058860_1219857413300004801Host-AssociatedMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQI
Ga0068912_1126286813300005506SoilMRPKHPHAAESGVGKHNARESERVQACATGKERVTNAHP
Ga0070686_10095766423300005544Switchgrass RhizosphereMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLAPEAS
Ga0068857_10141458513300005577Corn RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEAS
Ga0075040_106686713300005646Permafrost SoilMRPRHPHAAVSGVGKHIARESERVQACAAGKERVT
Ga0078894_1000901623300005662Freshwater LakeMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRN*
Ga0079957_124107023300005805LakeMRPRHPHAAESGVGKHTARESESAQACVSGKERVANAHSHISP
Ga0066791_1004047723300005949SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALEPQGSGAILFLA
Ga0082390_12801213300006230MarineMRPRSTHAALSGVGEHPARKCESAKWCAIGKERVA
Ga0082395_102393213300006235MarineMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAPEP
Ga0075501_102202323300006355AqueousMRPRSAHAALSGVGEHTARESESAKCCAAGKERVANAHS
Ga0075499_104577423300006366AqueousMRPKHPHAAESGVGKHTARESERAQACADGEERVANAHSH
Ga0075499_106630913300006366AqueousMRPRHPHAAESGVGKYTARESESAQACATGKERVANAH
Ga0075483_100517513300006373AqueousMRPKSAHAALSGVGEHPARESESAKWCATGKERVANAH
Ga0075498_107905913300006378AqueousMRPRHPHAAESGVGKYTARESESAQACATGKERVANAHSH
Ga0075498_108960823300006378AqueousMRPRHPHAAESGVGKHTARESESAQACATGKERVAN
Ga0075498_110247223300006378AqueousMRPKHPHAAESGVGKHITRESERAQACAIGKERVA
Ga0075506_100847533300006401AqueousMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPH
Ga0075511_173525113300006402AqueousMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHS
Ga0075037_102969113300006426Permafrost SoilMRPKHPHAAESGVGKCTARESERAQSYTTGKEHVANAHPQIW
Ga0075484_108071213300006602AqueousMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPHFEP
Ga0075484_154844213300006602AqueousMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAH
Ga0075471_1043168323300006641AqueousHAAESGVGKHTARESESAQACADGEERVANAHSRN*
Ga0099772_104808023300006647Activated SludgeMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAS
Ga0031666_110423613300006727Deep OceanMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHP
Ga0079249_135989813300006731MarineMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANA
Ga0075472_1070970613300006917AqueousPHAAESGVGKHTARESESAQACADGEERVANAHSRN*
Ga0081243_103511813300006937Tropical Rainforest SoilMRPKHLHAAESGVGKHTTRESERAQACAAGKERVANAH
Ga0075020_11257513300007159WatershedsMRPRHPHAAESGVGKHTARESERAQACATGKERVAN
Ga0075025_100844113300007219WatershedsMRPRHPPAAESGVGKHTARESERAQACATGKERVANA
Ga0075025_105776413300007219WatershedsMRPRHPHAAESGVGKHTARESERVQACATGKERVT
Ga0075183_1149114713300007232Wastewater EffluentMRPRHPLAAESGVGKHTARESERAQSCANGKERVANAH
Ga0075184_1008509913300007235Wastewater EffluentMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLASEAQ
Ga0075177_102227013300007237Wastewater EffluentMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPHK
Ga0075177_105178113300007237Wastewater EffluentMRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHPHK
Ga0075182_1000672513300007253Wastewater EffluentMRPRHPLAAESGVGKHTARESERVQACAAGKERVTNA
Ga0102692_106619613300007321Freshwater LakeMRPKHPHAAESGVGKHTARESESAQACATGKERVANAHS
Ga0075016_100175723300007327WatershedsMRPRHPHAAESGVGEHKARESESAQHCAAGKERVANAH
Ga0075016_102739413300007327WatershedsMRPKHPHAAESGVGKHIARESERAQACATGKERVANAHP
Ga0075016_104312813300007327WatershedsMRPKHPPAAESGVGKHIARESERVQACAAGKERVTNA
Ga0075022_100103613300007526WatershedsMRPRNPHAAESGVGKHTARESERVQACAAGKERVTN
Ga0075022_100557013300007526WatershedsMRPKHPHDAESGVGKHTARESERAQACAAGKERVANAH
Ga0075022_100923613300007526WatershedsMRPRHPHAAESGVGKHIARESERAQACATGKERVAN
Ga0075022_102967813300007526WatershedsMRPKHPHAVESGVGKHTARESERVQACAAGKERVTNA
Ga0099787_102037813300007602Activated SludgeMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL
Ga0102876_111907823300007642EstuarineMRPRHPHAAESGVGKHTARESESAQACVNGKERVANAHSHISPGDRK
Ga0108970_1136462323300008055EstuaryMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSRN*
Ga0103610_10027313300008648Hydrothermal VentsMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKT
Ga0103614_100514113300008702Hydrothermal VentsMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKKTP
Ga0103638_100059713300008785Wetland SoilMRPKHPHAAESGVGEHKARESESAQRCAAGKERVANAHPQKEKKK
Ga0103638_100321413300008785Wetland SoilMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPEASKTS
Ga0103640_100036913300008787Wetland SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKL
Ga0103746_1001808213300008884Wastewater SludgeMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAPE
Ga0103746_1001823713300008884Wastewater SludgeMRPRHPHAAESGVGKHTARESERAQSCANGKERVANAHPQIWPR
Ga0103745_1002416423300009196Wastewater SludgeMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAP
Ga0103745_1002417813300009196Wastewater SludgeMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPHFEPG
Ga0103745_1004358013300009196Wastewater SludgeMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAP
Ga0103748_1003393413300009199Wastewater SludgeMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAPGP
Ga0103748_1005016813300009199Wastewater SludgeMRPRSAHAALSGVGEHTARESESAQCCANGKERVANPHPHFEP
Ga0103850_101485523300009223River WaterMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSGAK
Ga0103850_101611813300009223River WaterMRPKHPHAAESGVGKHTARESERAQACATGKERVAHAHPQIWPRDRKAPG
Ga0103850_101613113300009223River WaterMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSGAK
Ga0103850_101657413300009223River WaterMRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIW
Ga0103850_101838613300009223River WaterMRPKHPHAAESGVGKHTARASERAQACATGKERVAQ
Ga0103851_103136813300009225River WaterMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLAPGPQGLGA
Ga0103851_103144113300009225River WaterMRPKHLHAAESGVGKHTARESESAQACAAGKERVANAHPHNLAPGPQGLGA
Ga0103854_101299113300009228River WaterMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAPG
Ga0103855_1003902913300009230River WaterMRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG
Ga0103855_1003939223300009230River WaterMSPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG
Ga0103855_1004055623300009230River WaterMRPKHLHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSG
Ga0103856_1004009313300009233River WaterMRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLQ
Ga0103856_1009824113300009233River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAP
Ga0103857_1004178213300009235River WaterMRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLQSFRGLQKK
Ga0103857_1004488813300009235River WaterMRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPQKL
Ga0103857_1004616913300009235River WaterMRPESPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKKK
Ga0103857_1004796713300009235River WaterMRPTAPHAAVSGVGEHTARESESAQCCVTGKERVASAHPRLWPANFGS
Ga0103857_1012178713300009235River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQGSGA
Ga0103858_1007057313300009239River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQGSGAK
Ga0103858_1007232113300009239River WaterMRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQG
Ga0103858_1007571813300009239River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQG
Ga0103858_1018946313300009239River WaterMSPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPHFLAPGPQGSGAK
Ga0103860_1004569423300009243River WaterMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLALEPQGSGAI
Ga0103860_1004679523300009243River WaterMRPESPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAPEAARLPG
Ga0103860_1004836813300009243River WaterMRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPEPQGSGAKL
Ga0103860_1004975313300009243River WaterMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLALEPQGSGAI
Ga0103860_1010313313300009243River WaterMSPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPHKLASEAARLP
Ga0103860_1012415213300009243River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPEPQGSGAKL
Ga0103861_1002504613300009247River WaterMRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAP
Ga0103861_1002777413300009247River WaterMSPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEPQGS
Ga0103862_101940113300009249River WaterMRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIWPRDRKVPG
Ga0103862_101972913300009249River WaterMRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAPG
Ga0103862_102005513300009249River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGA
Ga0103862_102073613300009249River WaterMRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGA
Ga0103862_102121723300009249River WaterMRPRHPHAAESGVGKYTARESECVQACAAGKERVTNAHPHK
Ga0103862_102163113300009249River WaterMRPIHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG
Ga0103862_102275213300009249River WaterMRPRHPHAAESGVGKHTARESERAEACATGKERVANAHSDR
Ga0103863_1001703313300009252River WaterMRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGAK
Ga0103863_1001805013300009252River WaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGAK
Ga0103869_1006667713300009257River WaterMSPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHFLAPGPEGPGAK
Ga0103869_1006858613300009257River WaterMRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRGLL
Ga0103869_1007211413300009257River WaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEPGTARS
Ga0103869_1017287613300009257River WaterMRPIAPHAAESGVGKHTARESERVQACAKGEERVTHAHT
Ga0103870_101604413300009261River WaterMRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFR
Ga0103870_101669313300009261River WaterMSPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFR
Ga0103747_1021133013300009295Wastewater SludgeMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPFRQSPA
Ga0103864_100276013300009337River WaterMRPRHPHAAESGVGKYTARESECVQACAAGKERVTNAHP
Ga0103865_100321213300009352River WaterMRPIHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFQIG
Ga0103871_100713313300009387River WaterMRPESPHAAESGVGKRTARESERVQACAAGKERVTNAHPHFLAPGPQGPGAKKF
Ga0103871_100777013300009387River WaterMRSKAALAALSGVGKHTARESESAQACAIGKERVANAHP
Ga0103853_101164813300009404River WaterMRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIWPRDRKVP
Ga0115599_101263113300009579WetlandMRPRHPHAAESGVGEHTARESESAQQCADGKERVANAHP
Ga0115599_115736313300009579WetlandMRPKHPRAAESGVGKHTARESESAQACAIGKERVANAHSH
Ga0115596_105133113300009580WetlandMRLKHPRAAESGVGKHTARESESAQACANGKERVANAHSH
Ga0115600_105054313300009581WetlandMRPKHPHAAESGVGKHAARESESAKACAAGKERVANAHSHKL
Ga0115600_111610513300009581WetlandMRPIHPHAAESGVGKHTTRESESAKTCAAGKERVANAHP
Ga0115600_116922113300009581WetlandMRPKHPPAAESGVGKHTARESERVQACATGKERVT
Ga0115600_118306613300009581WetlandMRPRHPHAAESGVGEHTARESESAQQCADGKERVANAH
Ga0115601_111646513300009582WetlandMRSKTLHAAVSGVGEHTARESESAKCCATGKERAANAHPQVW
Ga0115601_120444323300009582WetlandMRPIHPHAAESGVGKYTARESESAKACATGKERVANAH
Ga0115598_106644623300009583WetlandMRPKHPRAAESGVGKHTARESESAQACATGKERVANA
Ga0115597_101882313300009584WetlandMRPKHPHAAESGVGKYTARESESVQACAAGKERVTNAH
Ga0115597_121503213300009584WetlandMRPKHPHAAESGVGKHITRESERAQACVIGKERVANAHT
Ga0115602_100210113300009587WetlandMSPRHPHAAESGVGKHTARESESAQACAAGKERVANA
Ga0115602_104610113300009587WetlandMRPKHPRAAESGVGKHTARESESAQACAIGKERVANA
Ga0115602_125160613300009587WetlandMRSKTLHAAVSGVGEHTARESESAKCCATGKERAANAHP
Ga0105855_130972913300009649Permafrost SoilMRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPPFWPV
Ga0105854_107937923300009660Permafrost SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKERVA
Ga0131969_10164713300009834Meromictic PondMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANPNPNPNPNPN
Ga0127462_12910313300010061Grasslands SoilMRPKHPHAAESGVGKHTARESERAQSCANGKECVAN
Ga0127427_12744913300010066Grasslands SoilMRPKHLHAAESGVGKHTTRESESAQGCAAGKERVASAHSHKL
Ga0127432_15031113300010067Grasslands SoilMRPKHPPAAESGVGKHTARESERAQSCATGKECVANTQ
Ga0127477_11560613300010071Grasslands SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEKRK
Ga0127477_13667923300010071Grasslands SoilMRPRHPHAAESGVGKHIARESESVKACAAGKERVTN
Ga0127434_15785913300010075Grasslands SoilMRPRHPHAAERAVGKHNARESERAQACATGKERVAN
Ga0127437_13142113300010077Grasslands SoilMRPKHPHAAESGVGKCTARESERAQSYTTGKEHVAN
Ga0127437_13761813300010077Grasslands SoilMRPKHPHAAESGVGKHIARESESVQACAAGKERVAN
Ga0127448_14122413300010080Grasslands SoilMRPKPPPAAESGVGEHTARESERAQQCAIGKECVAYTQ
Ga0127461_101348413300010084Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSHK
Ga0127471_102735913300010090Grasslands SoilMRPKHPPAAESGVGKHTARESERAQSCATGKECVA
Ga0127485_102730613300010091Grasslands SoilMRPRHPHAAGSGVGKHIARESERVQACAAGKERVTN
Ga0127480_102984413300010094Grasslands SoilMRPKHPPAAESGVGKHTARESERAQSCAIGKECVANT
Ga0127473_112039913300010096Grasslands SoilMRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAHPKSECN
Ga0127473_112239713300010096Grasslands SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTHA
Ga0127481_102517313300010101Grasslands SoilMRPKHPHAAESGVGKHTARESESAQACAAGKERVA
Ga0127481_102627613300010101Grasslands SoilMRPKHPRAAESGVGKHTARESERAQACAAGKERVA
Ga0127500_110490113300010103Grasslands SoilMRPRAAPAALSGVGKHTARESERAQCCANGKECVAN
Ga0127497_106991813300010109Grasslands SoilMRPRAAPAALSGVGKHTARESERAQCCANGKECVANT
Ga0126316_105882913300010110SoilMRPRHPRAAESGVGKHTARESESAQACAAGKERVANAH
Ga0126316_107680313300010110SoilMRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAH
Ga0127449_108228513300010117Grasslands SoilMRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAHPHKL
Ga0127465_109021423300010118Grasslands SoilMRSKAALAALSGVGEHTARESESAQGCAIGKERVASAHP
Ga0127465_113198013300010118Grasslands SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQNLAP
Ga0127438_114500913300010121Grasslands SoilMRPKHPRAAESGVGKHTARESERAQACAAGKERVAN
Ga0127498_106232613300010124Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSQLQAC
Ga0127482_103610613300010126Grasslands SoilMRPRHPHAAESGVGKHIARESESAQACAAGKERVAN
Ga0127493_118217213300010130Grasslands SoilMRPRAAPAALSGVGKHTARESERAQCCANGKECVA
Ga0115594_102266213300010131WetlandMRPRHPHAAESGVGKHTARESESAKACATGKERVANAHSH
Ga0127484_106726323300010134Grasslands SoilMRPKLRFAAESGVGKHTARESERAQSCAIGKECVAN
Ga0127447_112501513300010136Grasslands SoilMRPKHPHAAESGVGEHMARESESAQQCAAGKERVA
Ga0115595_117214513300010138WetlandMRPRHPHAAESGVGEHTARESESAQQCADGKERVANAHPQ
Ga0127499_105546813300010141Grasslands SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL
Ga0115593_101804813300010144WetlandMRPIHPHAAESGVGKHTARYCESAKACAAGKERVANAHPHK
Ga0126321_119589613300010145SoilMRPKHPRAAESGVGKHNARESERAQVCAAGKERVANAH
Ga0126320_104614523300010146SoilMRPKHPHAAESGVGKHTARESERVQVCAAGKERVTNAHP
Ga0126320_127801013300010146SoilMRPKHPLAAESGVGEHTARESESAQQCAVGKECVAN
Ga0126319_103545023300010147SoilMRPKHPRAAESGVGKHTARESERAQACATGKERVANAH
Ga0126319_106181113300010147SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKECVANTHPQ
Ga0126319_109011213300010147SoilMRLKHPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0126318_1057633813300010152SoilMRPKHPHAAESGVGKHIARESESAQACAAGKERVA
Ga0126318_1099691613300010152SoilMRPRHPHAAESGVGKHITRESESAKVCAAGKERVANAH
Ga0126318_1111936513300010152SoilMRPRHPRAAESGVGKHTARESESAKACAAGKERVANAHP
Ga0127503_1030348813300010154SoilMRLIHPHAAESGVGKHIARESERVQACAAGKERVT
Ga0129320_15368913300010305AqueousMRPRHPHAAESGVGKHTARESERVQACATGKERVTHAH
Ga0129333_1005595023300010354Freshwater To Marine Saline GradientMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHN*
Ga0126360_100295913300010854Boreal Forest SoilMRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAHPQIWPR
Ga0126358_112221513300010856Boreal Forest SoilMRPKHPHAAESGVGKCTARESERAQSYTTGKERVANAHPH
Ga0126354_114809523300010857Boreal Forest SoilMRPKHPHAAESGVGKHIARESESVKACAAGKERVTNAHPQKL
Ga0126354_118262223300010857Boreal Forest SoilMRPRHPHAAESGVGKHIARESESVKACAAGKERVTNAHP
Ga0126354_118797823300010857Boreal Forest SoilMRPIHPHAAESGVGKHIARESESVKACAAGKERVTNAHPQKLAS
Ga0126354_118802613300010857Boreal Forest SoilMRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAHP
Ga0126354_124471123300010857Boreal Forest SoilMRPIHPHAADSGVGKHTARESERAQACATGKERVANAH
Ga0126352_111177513300010859Boreal Forest SoilMRPKHPHAAESGVGKHIARESERAQVCATGKERVANAHPH
Ga0126352_125831623300010859Boreal Forest SoilMRPKHPHAAESGVGEHTARESERAQQCADGKERVANA
Ga0126349_103457913300010861Boreal Forest SoilMRPRHPHAAESGVGKHTARESESAQACAVGKERVAN
Ga0126349_106427013300010861Boreal Forest SoilMRPRAAPAALSGVGKHTARESERAQSCAIGKECVANTHP
Ga0126349_125263113300010861Boreal Forest SoilMRLKHPHAAESGVGKHTARESESVQACAAGKERVTNAHS
Ga0126348_107572113300010862Boreal Forest SoilMRPRHPHAAESGVGKHTARESESAQACAVGKERVANAHP
Ga0126348_113409913300010862Boreal Forest SoilMRLKHPHAAESGVGKYTARESESVKACAAGKERVTNAHPQKLASEA
Ga0126348_128424813300010862Boreal Forest SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVTHAHPHNLAL
Ga0126344_106911013300010866Boreal Forest SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVT
Ga0126359_126718113300010869Boreal Forest SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLAL
Ga0126359_163366113300010869Boreal Forest SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKECVAYTH
Ga0138113_18231513300010895Grasslands SoilMRPKHPPAAESGVGKHTARESERAQSCATGKECVANTQPQIW
Ga0138111_115727713300010896Grasslands SoilMRPRHPHAAESGVGKHIARKSESAQACAAGKERVANAH
Ga0138577_13548113300011028Peatlands SoilMRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAH
Ga0138600_11000813300011046Peatlands SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTHAHP
Ga0138550_10599713300011055Peatlands SoilMRPKHPHAAESGVGEHTARKSEAPISVRWKERAANAH
Ga0138544_103903013300011057Peatlands SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIWPR
Ga0138534_105282613300011061Peatlands SoilMRPRSAHAALSGVGEHPARESESAKWCAERKERAAN
Ga0138582_109116513300011062Peatlands SoilMRPKHPHAAESGVGEHTARKSEAPNSVRWKERAANAH
Ga0138525_113832813300011064Peatlands SoilMRPRSAHAALSGVGEHPARESESAQWCAEGKERVANA
Ga0138563_112850813300011072Peatlands SoilMRPRSAHAALSGVGEHPARESESAQWCAEGKERVANAHP
Ga0138559_111942713300011074Peatlands SoilMRPRSAHAALSGVGEHPARESESAKWCAEGKERAANA
Ga0138555_108192713300011075Peatlands SoilMRPKHPHAAESGVGEHTARESEAPNNVQRKERAANAHHNLALG
Ga0138568_109146713300011080Peatlands SoilMRPKHPPAAESGVGKHTARESERAQSCAAGKECVANTH
Ga0150983_1409209123300011120Forest SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPH
Ga0138295_12138813300011281Activated SludgeMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHSHKLA
Ga0138293_13524923300011282WatershedsMRPIHPHAAESGVGKHTARESERVQACATGKERVT
Ga0138391_10854623300011288MarineMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPH
Ga0138294_102182913300011299Activated SludgeMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAP
Ga0126317_1056915413300011332SoilMRPKHPPAAESGVGKHTARESERVQACAAGKERVTN
Ga0126317_1057015713300011332SoilMRPKYPHAAESGVGKHTARESESAQACAAGKERVA
Ga0127502_1036309213300011333SoilMRPKHLRAAESGVGKHTARESERVQACAAGKEHVTNAH
Ga0127502_1058782313300011333SoilMRLKHPRAAESGVGKHTARESESAQACAAGKERVANAH
Ga0127502_1089545013300011333SoilMRPKHPRAAESGVGKHIARESERVQACAAGKERVTN
Ga0151652_1040727213300011340WetlandMRPISPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAPE
Ga0151652_1054762213300011340WetlandMRPIHPHAADSGVGKHTARESESAQACAIGKERVANAHSHIWP
Ga0151652_1059770713300011340WetlandMRPRPPPAAVSGVGEHTARESESAQCCAAGKERVANA
Ga0151652_1084420813300011340WetlandMRPMSPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAP
Ga0151652_1114918913300011340WetlandMRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPP
Ga0151652_1285999913300011340WetlandMRPKHPRAAESGVGKYTARESESAKVCAAGKERVANAHPH
Ga0151652_1411562013300011340WetlandMRPRHPHAAESGVGKHTARESERVQACATGKERVTN
Ga0137461_124889613300012040SoilMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPEP*
Ga0150985_10079246113300012212Avena Fatua RhizosphereMRPKHPRAAESGVGKHIARESESVQACAAGKERVTNAHP
Ga0150985_11024836013300012212Avena Fatua RhizosphereMRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAH
Ga0150985_11034518713300012212Avena Fatua RhizosphereMRPKSAHAALSGVGEHTTRESEGAKCCAAGKERVANAH
Ga0150985_12075166913300012212Avena Fatua RhizosphereMRPKHPPAVESGFGKHKARESESAQRCAAGKERVADAHQIGRA
Ga0150985_12236731113300012212Avena Fatua RhizosphereMRPKHPPAAESGVGKHTARESERAQACAIGKEQLAIAH
Ga0134028_111171813300012224Grasslands SoilMRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPR
Ga0134027_106650013300012364Grasslands SoilMRPKPPHAAESGVGEHTARESERAQSCATGKECVA
Ga0134037_120362413300012372Grasslands SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAH
Ga0134042_119469323300012373Grasslands SoilMRPRHPHAAESGVGKHIARESESAQACAAGKERVANAH
Ga0134029_101696313300012377Grasslands SoilMRLKHPHAAESGVGKHNARESERVQACAAGKERVTNA
Ga0134029_102719423300012377Grasslands SoilMRPKDPHAAESGVGKHTARESERVQVCAAGKEHVTNA
Ga0134025_106054713300012378Grasslands SoilMRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAHP
Ga0134058_119803213300012379Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSHKLAP
Ga0134047_104051313300012380Grasslands SoilMRPKHPPALESGFGKHKARESESAQRCAAGKERVANAHP
Ga0134047_104382913300012380Grasslands SoilMRPKHPHAAESGVGKHTARESERVQVCAAGKEHVT
Ga0134038_106307623300012382Grasslands SoilMRPRHPHAAESGVGKHIARESESVKACAAGKERVTNA
Ga0134033_116767713300012383Grasslands SoilMRPKHLHAAESGVGKHNARESERVQVCAAGKERVTNAHPH
Ga0134054_108614413300012390Grasslands SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLAP
Ga0134054_126525613300012390Grasslands SoilMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0134035_102950123300012391Grasslands SoilMRPKLRFAAESGVGKHTARESERAQSCATGKECVANTQ
Ga0134043_106174613300012392Grasslands SoilMRPKHPHAAESGVGKHIARESESAQACAAGKERVAN
Ga0134052_113679313300012393Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAH
Ga0134052_128726723300012393Grasslands SoilMRSKATLAALSGVGEHTARESESAQGCAIGKERVASAHP
Ga0134052_130112513300012393Grasslands SoilMSPRHPHAAESGVGKHTARESESAQACAAGKERVA
Ga0134044_127696913300012395Grasslands SoilMRPRHPHAAESGVGKHNARESERVQACAAGKERVTNA
Ga0134056_104851323300012397Grasslands SoilMRPIHPHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0134056_108212813300012397Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAHS
Ga0134051_109954313300012398Grasslands SoilMRLKHPRAAESGVGKHTARESESAQACAAGKERVANA
Ga0134051_132335423300012398Grasslands SoilMRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAHP
Ga0134061_102626113300012399Grasslands SoilMSPRHPHAAESGVGKHTARESESAQACAAGKERVAN
Ga0134048_119113723300012400Grasslands SoilMRPIHPHAADSGVGKHTARESERAQACATGKERVANA
Ga0134055_125041113300012401Grasslands SoilMRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSH
Ga0134055_139139913300012401Grasslands SoilMRPKSPHAAESGVGKHTARESERVQACATGKERVTHAH
Ga0134059_105358413300012402Grasslands SoilMRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAH
Ga0134049_117693413300012403Grasslands SoilMRPKHPHAAESGVGKHIARESESAQACAAGKERVANAHPQ
Ga0134049_133908113300012403Grasslands SoilMRLKHPHAAESGVGKHNARESERVQVCAAGKERVTNAHPH
Ga0134041_110661013300012405Grasslands SoilMRPKHPHASESGVGKHTARESESAQACAAGKERVAN
Ga0134041_133476923300012405Grasslands SoilMRPKHPRAAESGVGKHTARESERAQACAAGKERVANAH
Ga0134050_106202013300012407Grasslands SoilMRPKHPPAAESGVGKHTARESERAQACAAGKERVA
Ga0134045_146908513300012409Grasslands SoilMRPKHPHAAESGVGKHIARESESAQACAAGKERVANAHP
Ga0134060_122235113300012410Grasslands SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLA
Ga0153880_137273113300012411Freshwater SedimentMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHPH
Ga0150984_10561491813300012469Avena Fatua RhizosphereMRPKHPHAAESGVGKHTARESECAQECVAGKERVANAHPQDRKSVV
Ga0150984_10635575113300012469Avena Fatua RhizosphereMRPKHPPAVESGFGKHKARESESAQRCAAGKERVANAHP
Ga0150984_10966085413300012469Avena Fatua RhizosphereMRPKHPRAAESGVGKHTARESESAKACAAGKERVANAHSH
Ga0129334_100666123300012471AqueousMRPKSAHAALSGVGEHTARESESAKCCAAGKERVANAH
Ga0157560_105929413300012686FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQKRTQ
Ga0157565_113844323300012689FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHP
Ga0157575_15738713300012690FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPR
Ga0157569_105332023300012691FreshwaterMRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHP
Ga0157593_113022323300012699FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPH
Ga0157572_110490413300012703FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPRD
Ga0157623_119075413300012707FreshwaterMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQ
Ga0157611_103648023300012724FreshwaterMRPKHPHAAESGVGKHTARESESAQACATGKERVANA
Ga0157564_108908313300012747FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWP
Ga0138278_106952213300012754Freshwater LakeMRPKHPPAAESGVGKHTARESERVQACATGKERVTSAHP
Ga0138281_113145013300012755Freshwater LakeMRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHPH
Ga0157628_100240913300012757FreshwaterMRPKPPHAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0138288_108578113300012761Freshwater LakeMRPKHPPAAESGFGKHTARESERVQACATGKERVTSAHPH
Ga0138288_113675513300012761Freshwater LakeMRPKHPHAAESGVGKHTARESERAQACVTGKECVANTHP
Ga0157624_110221113300012764FreshwaterMRPIHPHAAESGVGKHTARESERVQACATGKERVTNAH
Ga0138276_125683713300012768Freshwater LakeMRPKHPRAAESGVGEHTARESERAQACATGKERVANAHSHKLAP
Ga0138279_116732413300012769Freshwater LakeMRPKHPRAAESGVGDHTARESERAQACATGKERVANAHSH
Ga0138287_109338613300012772Freshwater LakeMRPKHPPAAESGFGKHTARESERVQACATGKERVTSAHP
Ga0138280_105221813300012775Freshwater LakeMRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHPHIWPR
Ga0138275_135848713300012776Freshwater LakeMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPE
Ga0138292_111775613300012777Freshwater LakeMRPKHPHAAESGVGKYTARESESAKACAAGKERVANAHS
Ga0138269_131898813300012778Freshwater LakeMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQIWPR
Ga0138286_106644923300012781Freshwater LakeMRPKHPHAAESGVGKHTARESERVQACAAGKECVTN
Ga0129335_103806423300012962AqueousMRPKHPHAAESGVGKHTARESESAQACAIGKERVANA
Ga0129335_106125513300012962AqueousMRPRSAHAALSGVGEHTARESESAKCCAAGKERVANAH
Ga0129340_125843213300012963AqueousMRPKSAHAALSGVGEHPARESESAKWCAAGKERVANAH
Ga0129343_105191213300012967AqueousMRPKSAHAALSGVGEHPARESESAKWCAAGKERVANAHPH
Ga0154018_10320613300013043Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHITRESERAQACAAGKERVANA
Ga0154018_10764013300013043Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGEHKARESESAQRCAAGKERVANA
Ga0154018_12049513300013043Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHTARESERAEACAAGKERVANAH
Ga0154019_10415513300013044Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGEHKARESESAQRCAAGKERVANAH
Ga0154016_10321913300013045Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKL
Ga0079038_11197523300013046Freshwater WetlandsMRPKSAHAALSGVGEHTARESESAQCCAAGKERVANAH
Ga0154014_10871113300013052Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGEHKARESESAQRCAAGKERVANA
Ga0154014_14596113300013052Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHNARESERVQACAAGKERVTNAHPH
Ga0154014_16206013300013052Corn, Switchgrass And Miscanthus RhizosphereMRPIHPHAAESGVGKHTARESESAQACAAGKERVANA
Ga0154012_17374613300013059Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAP
Ga0154012_17447313300013059Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKYIARESERAQACITGKERVANA
Ga0157563_109143223300013068FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQ
Ga0153914_103140223300013078Freshwater WetlandsMRPKHPHAAESGVGKHTARESESAQACAIGKERVANAHSHKLAS
Ga0153914_113780223300013078Freshwater WetlandsMRPIHPHAAESGVGKHTARESESAKACAAGKERVANAH
Ga0153913_136755013300013080Freshwater WetlandsMRPLHPHAAESGVGKHTARESESAKACAAGKERVANA
Ga0170573_1066836513300013232SedimentMRPIHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEA*
Ga0170791_1533907713300013295FreshwaterMRPKHPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWPR
Ga0167638_105441213300015197Glacier Forefield SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRD
Ga0180045_14308113300016678FreshwaterMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLAL
Ga0180046_10843913300016680FreshwaterMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEPQGF
Ga0180044_105167523300016682FreshwaterMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAL
Ga0180039_106714113300016688FreshwaterMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPRDR
Ga0180058_106886413300016699FreshwaterMRPRHPHAAESGVGKYTARESESVKACATGKERVTN
Ga0181507_101826213300016705PeatlandMRPRHPHAAESGVGEHTARESERAQQCAIGKERVAN
Ga0181500_119893613300016728PeatlandMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPHTAK
Ga0182042_112042013300016733Salt MarshMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPHF
Ga0182092_134232423300016734Salt MarshMRPKSAHAALSGFGEHPARESESAKWCAAGKERVAN
Ga0182049_123285723300016736Salt MarshMRPKSAHAALSGVGEHPARESESAKWSAAGKERVAN
Ga0182072_103557513300016754Salt MarshMRPKSAHAALSGVGEHPARESESAKWCATGKERVANAHPH
Ga0182091_108296413300016766Salt MarshMRPKSAHAALSGVGEHPARESESAKWCAAGKERVANA
Ga0188832_10058213300018549Freshwater LakeMRPKSTHAALSGVGEHPARESESAKWSAAGKERVANA
Ga0188884_100612613300018610Freshwater LakeMRPKSTHAALSGVGEHPARESESAKWSAAGKERVANAHP
Ga0184580_12402023300019158SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANA
Ga0180035_104986413300019191EstuarineMRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHPQ
Ga0180033_12725213300019198EstuarineMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSR
Ga0187789_111343813300019199PeatlandMRPKHPHAAESGVGKHNARESESAKACAAGKERVANAHP
Ga0187789_113677113300019199PeatlandMSPRHPHAAESGVGKHTARESESAKACAAGKERVANAHP
Ga0187789_113789113300019199PeatlandMRPRHPHAAESGVGKHNARESESAKACAAGKERVANAH
Ga0187789_119602713300019199PeatlandMRPKHPHAAESGVGKHIARESESAKACAAGKERVANAHP
Ga0187789_120321413300019199PeatlandMRPRHPHAAENSVGKHTARESESAKACAAGKERVANAH
Ga0187789_121635423300019199PeatlandMRPRPPHAAESGVGKHNARESESAKACAAGKERVANAHP
Ga0180036_105677613300019200EstuarineMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIW
Ga0180032_103887713300019201EstuarineMRPKPPHAAESGVGKHTARESESAKACADGEERVANAHS
Ga0180032_105999813300019201EstuarineMRPKHPHAAESGVGKHTARESERVQACATGKERVTHAHP
Ga0180032_110580723300019201EstuarineMRPKHPHAAESGVGKHITRESERAQACVIGKERVANAHTH
Ga0180032_114040823300019201EstuarineMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHS
Ga0179940_114536713300019205Anaerobic Digestor SludgeMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPH
Ga0180110_103375423300019208Groundwater SedimentMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0180110_103507723300019208Groundwater SedimentMRPRSALAALSGVGEHTARESESAQCCAVGKERVANAH
Ga0180110_118387413300019208Groundwater SedimentMRPRHPHAAESGVGKHTARESERAEACAAGKERVANA
Ga0179951_117520713300019209Anaerobic Digestor SludgeMRPRSAHAALSGVGEHTARESESAQCCATGEERVANAHPHF
Ga0187799_100417913300019211PeatlandMSPKHPHAAESGVGKHTARESERAQACAIGKERVANAH
Ga0187799_106582413300019211PeatlandMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAH
Ga0187799_115859613300019211PeatlandMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0187799_118410713300019211PeatlandMRPRHPHAAESGVGKHIARESESAKACAAGKERVANAHP
Ga0187799_127042913300019211PeatlandMRPKHPHAAESGVGKHIARESESAQACAAGKERVANAH
Ga0180106_101194213300019212Groundwater SedimentMRPIHPRAAESGVGKHTARESERAQACATGKERVANAH
Ga0180106_112052213300019212Groundwater SedimentMRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHPQ
Ga0180106_125865013300019212Groundwater SedimentMRPRHPHAAESGVGKYTARESESAQACAIGKERVANAH
Ga0180106_133232923300019212Groundwater SedimentMRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0179950_116252913300019213Anaerobic Digestor SludgeMRPRHPHAAESGVGKHTARESESAKACAAGKERVANA
Ga0179945_116184213300019215Anaerobic Digestor SludgeMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAH
Ga0179939_109270413300019216Anaerobic Digestor SludgeMRPIHPHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0179941_108278913300019221Anaerobic Digestor SludgeMRPKHPHAAESGVGKHTARESERAQACATGKERVANA
Ga0179949_107139913300019225Anaerobic Digestor SludgeMRPRSAHAALSGVGEHTARESESAQCCANGKERVANA
Ga0179949_119135213300019225Anaerobic Digestor SludgeMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKL
Ga0180119_103074013300019228Groundwater SedimentMRPKHPHAAESGVGEHTARESERAQQCADGKERVANAHPQIWP
Ga0180119_104677813300019228Groundwater SedimentMRPRPPHAAESGVGKHTARESERVQACATGKERVTHAHP
Ga0180119_115779213300019228Groundwater SedimentMRPKTLHAAESGVGEHTARESESAQACAIGKERVANAHSHKLAP
Ga0180119_118383913300019228Groundwater SedimentMRPRHPHAAESGVGKHTARESERVQACAAGKERVT
Ga0180116_117082923300019229Groundwater SedimentMRPIHPHAAESGVGKHTARESESAQACAAGKERVAN
Ga0179935_103868913300019231Anaerobic Digestor SludgeMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPHFE
Ga0180114_101671013300019232Groundwater SedimentMRPKHPHAAESGVGKHTARESERAQACAAGKERVAN
Ga0184645_109302413300019233Groundwater SedimentMRPRSLHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0184645_117670513300019233Groundwater SedimentMRPKTLHAAESGVGEHTARESESAQECAIGKERVANAH
Ga0172288_120761213300019234WetlandMRPIHPHAAESGVGKHTARESESAKACAAGKERVAN
Ga0180112_108348213300019238Groundwater SedimentMRPRHPRAAESGVGKHTARESERAQACATGKERVANAHPH
Ga0180112_118786813300019238Groundwater SedimentMRPKHPHAAESGVGKYTARESESAKECAAGKERVANAHPQNW
Ga0187793_102650213300019241PeatlandMRPIHPHAAESGVGKHTARESESAQACADGKERVANAHP
Ga0187793_109857823300019241PeatlandMRSKAALAALSGVGKHTARESEGAKACVIGKERVANAHP
Ga0187793_109870813300019241PeatlandMRPKHPHAAESGVGKHTARESESAKACAAGKERVAN
Ga0187793_110444113300019241PeatlandMRPKHPHAAESGVGKHTARESESAQACAAGKERVAN
Ga0187793_113252813300019241PeatlandMRPKHPHAAESGVGKYTARESESAQACAAGKERVANAH
Ga0187793_114527213300019241PeatlandMRPKHPHAAESGVGKHTARESERAEACATGKERVANAHP
Ga0187793_114832413300019241PeatlandMRPKHPHAAESGVGEHTARESESAQQCAIGKERVANAH
Ga0187793_115319723300019241PeatlandMRPKHPRAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0187793_117301613300019241PeatlandMRPRHPHAAESGVGKHIARESESAKACAAGKERVANAH
Ga0187793_132511013300019241PeatlandMRPRHPHAAESGVGKHIARESESAKACAAGKERVANAHPQ
Ga0187793_132653313300019241PeatlandMRPKYPHAAESGVGKHTARESESAQACAAGKERVANAHPH
Ga0187793_136565523300019241PeatlandMRPRHPHAAESGVGEHKARESESAQHCAAGKERVANA
Ga0187793_146701713300019241PeatlandMRPRSAHAALSGVGEHTARESEAPNVCAGKERVAHAH
Ga0180111_100340123300019244Groundwater SedimentMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHS
Ga0180111_105270513300019244Groundwater SedimentMRPRHPHAAESGVGKHTARESESAQACADGKERVASAHP
Ga0180111_108015413300019244Groundwater SedimentMRPIHPHAADSGVGKHTARESESAQACAIGKERVANAHSH
Ga0180111_111157613300019244Groundwater SedimentMRLKHPHAAESGVGKHIARESESAKACAAGKERVANAH
Ga0180111_120172113300019244Groundwater SedimentMRPIHPRAAESGVGKHTARESERAQACATGKERVANAHPH
Ga0187791_106133413300019245PeatlandMRPKHPHAAESGVGEHTARESESAQRCAIGKERVANAH
Ga0187791_110941513300019245PeatlandMRPKHPHAVESGVGKHTARESERVQACAAGKERVTN
Ga0187791_111255713300019245PeatlandMRPRHPHAAESGVGKHNARESESAKACAAGKERVANAHPQ
Ga0187791_113052413300019245PeatlandMRPKHPHAAESGVGKHNARESESAKACAAGKERVANAHPQ
Ga0187791_120798513300019245PeatlandMSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0187791_121029813300019245PeatlandMRPKHPHAAESGVGKHTARESERAEACAAGKERVANAHP
Ga0187791_123976423300019245PeatlandMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHP
Ga0187791_125457323300019245PeatlandMRPRHPHAAESGVGKHTARESESAQACAAGKERVAN
Ga0187791_125538513300019245PeatlandMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0187791_126839513300019245PeatlandMRPKHPHAAESGVGKHTARESESAQECAAGKERVANAHP
Ga0187791_129301213300019245PeatlandMRPRHPHAAENSVGKHTARESESAKACAAGKERVANAHP
Ga0187791_130691813300019245PeatlandMRPRHPHAAESGVGKHTARESERAEACAAGKERVANAHP
Ga0187791_140698913300019245PeatlandMRPIHPHAAESGVGEHTARESESAQRCAIGKERVAN
Ga0187791_149047713300019245PeatlandMRPRHPHAAESGVGEHTARESEAPNSVQWKERAANA
Ga0187791_149117013300019245PeatlandMRPKHPHAAESGVGKHIARESESAQACAAGKERVANA
Ga0179937_127364413300019247Anaerobic Digestor SludgeMRPIHPHAADSGVGKHTARESESAQACAAGKERVANAH
Ga0179937_135227213300019247Anaerobic Digestor SludgeMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0180117_127774013300019248Groundwater SedimentMRPKHPHAAESGVGKHIARESERVQACAAGKERVTN
Ga0180117_140683623300019248Groundwater SedimentMRPKSAHAALSGVGEHTARESESAQCCAVGKERVANA
Ga0184648_119675313300019249Groundwater SedimentMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHP
Ga0184648_138981113300019249Groundwater SedimentMRPKHPHAVESGVGKHTARESERVQACAAGKERVTNAH
Ga0184648_139646413300019249Groundwater SedimentMRPKHPHAAESGVGKYTARESESAKACADGKERVANAH
Ga0187790_103109113300019250PeatlandMRPRHPHAAESGVGKHTARESESAKACATGKERVANAHP
Ga0187790_103205323300019250PeatlandMRPRHPHAAESGVGEHKARESESAQHCAAGKERVA
Ga0187790_107019413300019250PeatlandMRPKHPHAAESGVGKYTARESESAKACAAGKERVANAH
Ga0187790_113012413300019250PeatlandMRPRHPRAAESGVGKHIARESESAKACAAGKERVANAHPH
Ga0187790_127806513300019250PeatlandMSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHPQ
Ga0187790_151595013300019250PeatlandMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHP
Ga0187790_151631223300019250PeatlandMRPIHPHAAESGVGEHKARESESAQRCAAGKERVANAHP
Ga0187795_124129013300019251PeatlandMRPRHPHAAESGVGKHTARESESAKACAAGKERVAN
Ga0172286_112828213300019252WetlandMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAH
Ga0172286_157570113300019252WetlandMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0184641_115913523300019254Groundwater SedimentMRPIHPHAAESGVGKHTARKCERVQACAAGKERVTNAHPHKLA
Ga0184641_128432213300019254Groundwater SedimentMRPRHPRAAESGVGKHTARDSEGVQACAAGKERVTNAH
Ga0184643_101697113300019255Groundwater SedimentMRPIHPHAADSGVGKHTARESERVQACAAGKERVTNA
Ga0184643_110298523300019255Groundwater SedimentMRPKHPHAAESGVGKHTARESERVQACAAGKERVTN
Ga0184643_122432713300019255Groundwater SedimentMRPRHPHAAESGVGKHTARESERAQLCADGKERVANAHP
Ga0184643_145082113300019255Groundwater SedimentMRPRHPHAAESGVGRHIARESESVQACAAGKERVTNAHP
Ga0184643_148396013300019255Groundwater SedimentMRPRASHAAVSGVGKHTARESERAQLCADGKERVANA
Ga0180115_106566613300019257Groundwater SedimentMRPKHPHAAESGVGKHNARESESVQACAAGKERVTNAHPQKLA
Ga0180115_123296213300019257Groundwater SedimentMRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAH
Ga0180115_127574523300019257Groundwater SedimentMRLKHPHAAESGVGKHTARESERAQACATGKERVAN
Ga0180115_143364913300019257Groundwater SedimentMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHS
Ga0181504_104779513300019258PeatlandMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0184646_111578013300019259Groundwater SedimentMRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQ
Ga0184646_135227613300019259Groundwater SedimentMRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAHPH
Ga0181506_142857213300019260PeatlandMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIW
Ga0184647_115313113300019263Groundwater SedimentMRPRHPHAAESVLEKYTGRESESANACAIGKERVANAHS
Ga0187796_101682323300019264PeatlandMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHP
Ga0187796_117921313300019264PeatlandMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPH
Ga0187792_101028223300019265PeatlandMRPRHPHAAESGVGKHTARESESAQACAAGKERVANA
Ga0187792_106291113300019265PeatlandMRPIHPHAAESGVGEHTARESESAQRCAIGKERVANAHP
Ga0187792_110854513300019265PeatlandMRPKHPHAAENSVGKHIARESESAKACAAGKERVANAHPH
Ga0187792_111126713300019265PeatlandMSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHPQNLAP
Ga0187792_146698623300019265PeatlandMRPRHPHAAESGVGEHKARESEGAQRCAAGKERVANAHP
Ga0187792_146754513300019265PeatlandMRPKHPHAAESGVGKHTARESESAQECAAGKERVAN
Ga0187792_151890813300019265PeatlandMRPRHPHAAESGVGEHTARESEAPNSVQWKERAANAH
Ga0187792_167089313300019265PeatlandMRPRHPHAAESGVGKHTARESERAEACAAGKERVANAHPQKL
Ga0182069_155089613300019267Salt MarshMRPKSAHAALSGVGEHPARESESAKWCATGKERVAN
Ga0181514_130254613300019268PeatlandMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIWP
Ga0184644_101812113300019269Groundwater SedimentMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPH
Ga0184644_114031213300019269Groundwater SedimentMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAH
Ga0184644_116211213300019269Groundwater SedimentMRPRHPHAAESGVGKHTARESERVQACAAGKEHVT
Ga0184644_156182413300019269Groundwater SedimentMRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAH
Ga0181512_173398313300019270PeatlandMRPRHPHAAESGVGEHTARESERAQQCAIGKERVANAHP
Ga0187794_119111913300019273PeatlandMRPKHPHAAESGVGKHTARESERAEACATGKERVANAHPQ
Ga0187794_172964613300019273PeatlandMRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0182081_141486523300019277Salt MarshMRPKSAHAALSGVGEHPARESESAKWCATGKERVANAHP
Ga0187800_123252123300019278PeatlandMRSKPSLAAVSGVGEHTARESESAQGCATGKECVA
Ga0184642_112571113300019279Groundwater SedimentMRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAHP
Ga0184642_116022913300019279Groundwater SedimentMRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAHPQ
Ga0184642_122333823300019279Groundwater SedimentMRPKHLHAAESGVGKHIARESERVQVCAAGKERVTNAHPH
Ga0182077_163809623300019281Salt MarshMRPKSAHAALSGVGEHPARESESAKWCATGKERVA
Ga0182044_130874213300020014Salt MarshMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANA
Ga0180118_124071013300020063Groundwater SedimentMRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAHPHFEP
Ga0180118_124998113300020063Groundwater SedimentMRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHPQNWGSTKM
Ga0180107_104806013300020064Groundwater SedimentMRPIHPHAAESGVVKHTARESERVQACAAGKEHVTNAHP
Ga0180113_114273723300020065Groundwater SedimentMRPRHPHAAESGVGEHTARKSESAQCVYREERAASAH
Ga0180109_120733713300020067Groundwater SedimentMRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHP
Ga0180109_129498413300020067Groundwater SedimentMRPRSAHAALSGVGEHTARESESAQCCAVGKERVANAHPHFEPG
Ga0180109_134660213300020067Groundwater SedimentMRPKLRYAAESGVGKHTAPHCESAKTCAIEERAASA
Ga0184649_146654713300020068Groundwater SedimentMRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAHP
Ga0197907_1086833713300020069Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHIARESESAKACAAGKERVANA
Ga0206356_1008913523300020070Corn, Switchgrass And Miscanthus RhizosphereMRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAHP
Ga0206356_1032438913300020070Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAQACAAGKERVA
Ga0206356_1062435313300020070Corn, Switchgrass And Miscanthus RhizosphereMRPKPPHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0206356_1158638623300020070Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKYIARESESAQACTAGKERVA
Ga0206349_152892623300020075Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHP
Ga0206349_191919813300020075Corn, Switchgrass And Miscanthus RhizosphereMRPKHPRAAESGVGKHIARESESAKACAAGKERVANA
Ga0206349_198335513300020075Corn, Switchgrass And Miscanthus RhizosphereMRLKHPHAAESGVGKHTARESESAKACAAGKERVANAHP
Ga0206355_101417113300020076Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAS
Ga0206355_122351213300020076Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAVESGVGEHKARESESAQRCAAGKERVAN
Ga0206355_143205513300020076Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHNARESERVQACAAGKEHVTNAHP
Ga0206352_1067523513300020078Corn, Switchgrass And Miscanthus RhizosphereMRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKLAPE
Ga0206352_1084751813300020078Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHPH
Ga0206350_1072350113300020080Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0206350_1119982823300020080Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKYIARESESAQACTAGKERVANA
Ga0211734_1052532823300020159FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRN
Ga0154015_135208213300020610Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKYIARESESAQACTAGKERVANAH
Ga0154015_135281213300020610Corn, Switchgrass And Miscanthus RhizosphereMRSRHPHAAESGVGKYIARESESAQACTAGKERVANAHP
Ga0154015_145408113300020610Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKHIARESESAKACAAGKERVANAHPHKLAP
Ga0179584_100233413300021151Vadose Zone SoilMRPKHPHAAESGVGEHTARESERAQQCADGKERVANAH
Ga0179584_119544013300021151Vadose Zone SoilMRPKLRLVAESGVGKHTARESEGAQACAMGERVANA
Ga0210329_11053813300021257EstuarineMRPKHPHAAESGVGKHTARESERAQACVTGKERVANAH
Ga0210345_11378713300021258EstuarineMRPKHPHAAESGVGKHTARESESAKACANGKERVANAHSHKLA
Ga0210345_14596323300021258EstuarineMRPKSAHAALSGVGEHPARESESAKWSADGKERVANAH
Ga0210353_10834823300021267EstuarineMRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAH
Ga0210294_10893613300021268EstuarineMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHS
Ga0210356_18417023300021269EstuarineMRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0210360_10420523300021270EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHSH
Ga0210360_16889823300021270EstuarineMRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAHP
Ga0210340_105545213300021273EstuarineMRPRHPHAAESGVGKHTARESERVQACATGKERVTHAHPH
Ga0210340_107286013300021273EstuarineMRPKAPPAAGSGVGKHTARESERVQACATGKERVTNAHSHKL
Ga0210327_14423623300021274EstuarineMRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAHPH
Ga0210303_104086413300021282EstuarineMRPKHPHAAESGVGKHTARESESAQACAIGKERVANAHSH
Ga0210357_102529013300021283EstuarineMRPIHPHAAESGVGKHTARESERAQACATGKERVANAHSH
Ga0210357_103373823300021283EstuarineMRPKHPHAAESGVGEHTARESESAKRCAVGKERVANAHP
Ga0210357_104669913300021283EstuarineMRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPHFDPG
Ga0210357_106689413300021283EstuarineMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAH
Ga0210357_108268413300021283EstuarineMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHH
Ga0210299_13886623300021284EstuarineMRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHP
Ga0179583_102605113300021286Vadose Zone SoilMRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAHPHNLAL
Ga0179583_102971113300021286Vadose Zone SoilMRPKHPHAAESGVGKHTARESERAQACATGKERVANAH
Ga0179583_103304113300021286Vadose Zone SoilMRPIHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0179583_106969223300021286Vadose Zone SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAH
Ga0179583_109329013300021286Vadose Zone SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKECVANTHP
Ga0210338_18728523300021287EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHS
Ga0210355_100192813300021292EstuarineMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHS
Ga0210355_100645423300021292EstuarineMRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHP
Ga0210325_104998823300021294EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANA
Ga0210325_108947313300021294EstuarineMRPRHPHAAESGVGKHTARESESAKACAIGKERVANAHS
Ga0210328_104616923300021302EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANAH
Ga0179585_100049113300021307Vadose Zone SoilMRPKHPHAAESGVGEHTARESERAQQCAVGKERVANAHP
Ga0179585_105403213300021307Vadose Zone SoilMRPKYPHAAESGVGQHTARESESAQPCAIGKERVAN
Ga0179585_107347323300021307Vadose Zone SoilMRPKTLHAAESGVGEHTARESESAQQCAVGKERVANAH
Ga0210370_109854423300021314EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHP
Ga0179958_100638223300021315Vadose Zone SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTN
Ga0179958_116878813300021315Vadose Zone SoilMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHP
Ga0210351_134643813300021316EstuarineMRPKSTHAALSGVGEHPARESESAKWCAEGKERVANA
Ga0210309_116586123300021317EstuarineMRPKHPPAAESGVGKHTARESERAQACVTGKECVANTHPQ
Ga0210295_117653413300021323EstuarineMRPKHPHAAESGVGKHTARESERAQACVTGKECVANTH
Ga0210301_123384123300021325EstuarineMRPNPPPAAESGVGKHTARESERAQACVTGKECVANTH
Ga0210362_118905813300021329EstuarineMRPRHPHAAESGVGKHTARESERVQACATGKERVTNAHPH
Ga0210347_108426513300021331EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHSHKL
Ga0210324_103738113300021333EstuarineMRPKHPPAAESGVGKHTARESERAQACATGKERVANAHSHKSWETRIA
Ga0210324_133151513300021333EstuarineMRPKHPHAAKSGVGKHTARESERAQACATGKERAAN
Ga0210324_137616713300021333EstuarineMRPRHPHAAESGVGKHTARESESAQACATGKERVA
Ga0210307_111866123300021336EstuarineMRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHPQIR
Ga0210307_139127713300021336EstuarineMRPKHPPAAESGVGKHTARESERAQACVTGKECVANTH
Ga0210392_1065893113300021475SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAPGPQGSGALLFLWLKHGTR
Ga0194060_1030447013300021602Anoxic Zone FreshwaterMRPKHPPAEESGVGKHTARESERAQSCATGKERVA
Ga0210304_109149613300021849EstuarineMRPKHPPAAESGVGKHTARESERAQACATGKERVANAH
Ga0210304_109173313300021849EstuarineMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0210317_115856423300021852EstuarineMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAH
Ga0210323_100005113300021853EstuarineMRPIHPHAAESGVGKHTARESERVQACATGKERVTNA
Ga0210323_101376013300021853EstuarineMRPIHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP
Ga0210323_109175313300021853EstuarineMRPRHPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLA
Ga0210323_111021123300021853EstuarineMRPKHPLAAESGVGEHTARESERAQACAAGKERVANAH
Ga0210323_112407813300021853EstuarineMRPIHPHAAESGVGEHTARESESAKCCAAGKERVANA
Ga0213854_104547823300021855WatershedsMRPRHPHAAESGVGKHTARESERAQACAAGKERVA
Ga0213854_114840313300021855WatershedsMRPRHPHAAESGVGEHKARESESAQRCAAGKERVANAHP
Ga0213854_128908713300021855WatershedsMRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPQNS
Ga0213850_119064513300021856WatershedsMRPKHPHAAESGVGKHTARESERAQACAIGKERVANAHP
Ga0213849_115441613300021857WatershedsMRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPQNSAPE
Ga0213852_142717213300021858WatershedsMRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHP
Ga0210334_1112445513300021859EstuarineMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSH
Ga0213851_102924213300021860WatershedsMRPNATLAALSGVGEHTARESESAQGCATGKECVASTH
Ga0213851_144869013300021860WatershedsMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHP
Ga0213851_144968623300021860WatershedsMRPKHPHAAESGVGEHTARESESAQRCAAGKERVANAHP
Ga0213851_182074013300021860WatershedsMRPKHPHAAESGVGKHTARESEGAKACAAGKERVANAHP
Ga0213853_1073007413300021861WatershedsMRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAHP
Ga0213845_100667913300021929WatershedsMRPKHPHAVESGVGKHTARESERVQVCAAGKERVTPAH
Ga0213845_107183213300021929WatershedsMRPRSAHAALSGVGEHTARESEAPNVCAGKERVANAH
Ga0213845_117563813300021929WatershedsMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPQ
Ga0213845_117668013300021929WatershedsMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQ
Ga0213847_107600723300021938WatershedsMRPKHPPAAESGVGKHTARESERAQACAIGKECVANTHP
Ga0213847_108038223300021938WatershedsMRPRHPHAAESGVGKYIARESERVQACTAGKERVTNAHPHNLALKP
Ga0213847_109428913300021938WatershedsMRPKHPPAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0213847_120358913300021938WatershedsMRPKHPHAAESGVGKHNARESESVKVCAAGKERVTNAHP
Ga0213856_104663413300021947WatershedsMRPELPHAAESGVGEHTARESERAQQCAIGKERVANAHP
Ga0213856_113826213300021947WatershedsMRPKHPHAAESGVGEHTARESESAKCCAAGKERVANAHPHFDPG
Ga0213856_121762013300021947WatershedsMRPKAPPAAGSGVGKHTARESERVQACAAGKERVTNAHP
Ga0213848_105480713300021967WatershedsMRPIAPLAAVSGVGKHTARESESAQQCAAGKERVANAHP
Ga0213848_109703513300021967WatershedsMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAH
Ga0232063_115034023300021969Anaerobic Bioreactor BiomassMRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAH
Ga0232057_114607913300021970Anaerobic Bioreactor BiomassMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPH
Ga0213933_11148713300022141FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSH
Ga0213933_11165913300022141FreshwaterMRPKHPHAAESGVGKHTARESERAQACSTGKERVANAHS
Ga0213855_103031013300022144WatershedsMRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQIWPR
Ga0213855_112159113300022144WatershedsMRPRHPHAAESGVGKHTARESERVQACAAGKEHVTNAH
Ga0213930_10678923300022147FreshwaterMRPRHPHAAESGVGEHTARESERAQQCAIGKERVANAHPH
Ga0213930_11551813300022147FreshwaterMRPRSAHAALSGVGEHTARESEAPNVCAGKECVASTH
Ga0232064_11614623300022151Anaerobic Bioreactor BiomassMRPRSAHAALSGVGEHPARESESAKWCATGEERVANAH
Ga0213929_101077423300022154FreshwaterMRPKHPLAAESGVGEHTARESERAQACAAGKERVANAHPH
Ga0213929_101232313300022154FreshwaterMRPIHPHAAESGVGEHTARESESAQQCASGKERVASAHP
Ga0213929_102515113300022154FreshwaterMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHP
Ga0213934_103345013300022156FreshwaterMRPKHPPAAESGVGEHTARESERAQACAAGKERVANAH
Ga0213934_103780113300022156FreshwaterMRPIHPHAAESGVGEHKARESESAQQCAAGKERVANAHP
Ga0213931_104229713300022161FreshwaterMRPKHPLAAESGVGEHTARESESAQACVIGKERVANAH
Ga0213931_104974613300022161FreshwaterMRPRHPHAAESGVGKYTARESESAKACAAGKERVANAH
Ga0213932_103110213300022166FreshwaterMRPIHPHAADSGVGKHTARESESAQACAIGKERVANAH
Ga0213932_103893613300022166FreshwaterMRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHSH
Ga0213857_101330813300022171WatershedsMRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAHPQIWP
Ga0213857_101401523300022171WatershedsMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPH
Ga0213857_101428813300022171WatershedsMRPRHPHAAESGVGKHTARESERAQACATGKERVANAHP
Ga0079039_127927513300022185Freshwater WetlandsMRPRHPRAAESGVGKHTARESESAKACAAGKERVANAHSHK
Ga0222625_116692413300022195Groundwater SedimentMRPRSLHAAESGVGKHTARESESAQACAAGKERVANAH
Ga0226658_1017721213300022222Freshwater Microbial MatMRPVSALAALSGVGEHTARESERAQCCANGKECVASTHTQIWP
Ga0210293_11338213300022372EstuarineMRPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPH
Ga0210319_100997423300022373EstuarineMRPIHPHAAESGVGKHTARESESAKACAIGKERVAN
Ga0210376_102453113300022385EstuarineMRPRHPHAAESGVGKHTARESERAQACATGKERVANAH
Ga0224712_1024400113300022467Corn, Switchgrass And Miscanthus RhizosphereMRPKHPHAAESGVGKYIARESERAQACITGKERVANAHPQNLAP
Ga0242644_101117213300022498SoilMRPRHPHAAESGVGKHTARESESAKACAVGKERVANAHP
Ga0242644_101121513300022498SoilMRPKHPHAAESGVGKYTARESERAQSCTTGKERVANA
Ga0242641_101077213300022499SoilMRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAHP
Ga0242641_101081413300022499SoilMRPKHPHAAESGVGKHTARESERAQACANGKERVANAHP
Ga0242641_103120013300022499SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQI
Ga0242646_100877823300022502SoilMRPKHPHAAESGVGKHIARESERAQACANGKEHVAHAH
Ga0242650_100609913300022503SoilMRPRHPHAAESRVGKHTARESERVQACAAGKERVTNA
Ga0242642_102433113300022504SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANA
Ga0242642_103480313300022504SoilMRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANA
Ga0242642_105192513300022504SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNL
Ga0242642_106446513300022504SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNL
Ga0242647_101151623300022505SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVAN
Ga0242648_102293513300022506SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAH
Ga0242648_102415513300022506SoilMRPRHPHAAESGVGKHTARESESAKACAVGKERVAN
Ga0242648_102949523300022506SoilMRPKHPHAAESGVGKHIARESERAQACATGKERVAN
Ga0222729_101685813300022507SoilMRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPHKLAS
Ga0222729_101780413300022507SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTHAH
Ga0222729_103044513300022507SoilMRPRHPHAAESGVGKHTARESERVHACAAGKERVTNA
Ga0242652_101390523300022510SoilMRPRHPRAAESGVGKHTARESERAQACAAGKERVANA
Ga0242652_103544713300022510SoilMRPKHPHAAESGVGKHTASESERVQACAAGKERVTN
Ga0242651_101180113300022511SoilMRPKHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP
Ga0242669_103592213300022528SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKERVA
Ga0242668_105250013300022529SoilMRPRHPHAAESGVGKHTARESESAKACAVGKERVANA
Ga0242658_106223813300022530SoilMRPKHPHAAESGVGEHTARESERAQRCAIGKERVANA
Ga0242658_108005713300022530SoilMRPKHPHAAESGVGKHTARESERAQACANGKERVANA
Ga0242658_112319113300022530SoilMRPKHPHAAESSVGEHTARESERAQQCAIGKECVAS
Ga0242658_112781313300022530SoilMRPIHPHAADSGVGKHTARESERAQACAAGKERVANA
Ga0242660_106856013300022531SoilMRPRHPPAAESGVGKHTARESERAQACANGKECVANT
Ga0242660_107109013300022531SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVAN
Ga0242660_107262213300022531SoilMRPRHPRAAESGVGKHTARESESAKACAAGKERVANA
Ga0242660_109027813300022531SoilMRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANAH
Ga0232058_142865823300022645Anaerobic Bioreactor BiomassMRPRSALAALSGVGEHAARESESAQCRAAGKERVANAH
Ga0232059_104249713300022652Anaerobic Bioreactor BiomassMRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAHPH
Ga0242670_101905123300022708SoilMRPKHPRAAESGVGKHTARESESAQACAAGKERVANA
Ga0242670_101905223300022708SoilMRPKHPHAAESGVGKHTTRESESAKVCAAWKERVANAH
Ga0242670_105639913300022708SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKERVAN
Ga0222756_102402013300022709SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAH
Ga0242653_101314013300022712SoilMRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPR
Ga0242653_102967613300022712SoilMRPKHPHAAESGVGKHTTRESESAKVCAAGKERVAN
Ga0242677_100554113300022713SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALE
Ga0242677_101986213300022713SoilMRPKHPHAAESGVGKYTARESERAQSCTTGKERVANAHPQNLAS
Ga0242671_103020223300022714SoilMRPRHPHAAESGVGKHIARESERAQACANGKEHVAH
Ga0242675_109567113300022718SoilMRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAHP
Ga0242672_102951813300022720SoilMRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAH
Ga0242672_103029313300022720SoilMRPRQPHAAESGVGKHTARESERAQACAAGKERVANA
Ga0242672_103107723300022720SoilMRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAN
Ga0242672_103108413300022720SoilMRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAH
Ga0242672_105821113300022720SoilMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAH
Ga0242666_105784813300022721SoilMRPKHPHAAESGVGKYIARESERAQVCITGKERVANAHPQNLAS
Ga0242666_106080913300022721SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHP
Ga0242666_107435113300022721SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAP
Ga0242666_107975513300022721SoilMRPKHPHAAESGVGKHVARESERVQACAAGKERVTNA
Ga0242666_114431613300022721SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERLTN
Ga0242657_106992813300022722SoilMRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNL
Ga0242657_107158613300022722SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAH
Ga0242657_107339113300022722SoilMRPRHPLGAESAVGKHAARESERAQACAAGKERVA
Ga0242665_1011462113300022724SoilMRPRHPRAAESGVGKHTARESESAKACAVGKERVANAHP
Ga0242665_1011881613300022724SoilMRPKHPHAAESGVGKYIARESERAQACITGKERVANAH
Ga0242665_1011926713300022724SoilMRPKHPHAAESGAGKHTARESESAQACAAGKERVAN
Ga0242665_1018901713300022724SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANA
Ga0242654_1013764623300022726SoilMRPKHPHAAESGVGKYTARESERAQSCTTGKERVANAH
Ga0242654_1013801813300022726SoilMRPKHPHAAESGVGKHIARESERVQACATGKERVTN
Ga0242654_1014064913300022726SoilMTPKHPQAAQSGVGKHTARESESTQACAAGKERVANAHP
Ga0242654_1042574513300022726SoilMRLKHPHAAESGVGKHIARESERAQACANGKECVAHTHP
Ga0228704_10862923300023691FreshwaterMRPKHPLAAESGVGEHTARESESAQACVIGKERVANA
Ga0228704_12412713300023691FreshwaterMRPKHPHAAESGGGKHTARESERAQSCAAGKERVANA
Ga0228706_101980823300023697FreshwaterMRPRHPHAAESGVGKHKARESESAKRCAAGKERVANAHPH
Ga0228706_101986513300023697FreshwaterMRPRATPAALSGVGEHTARESERAQCRATGKECVASTHP
Ga0228706_102080313300023697FreshwaterMRPIHPHAAESGVGEHTARESERAQQCAIGKERVANA
Ga0228706_102792713300023697FreshwaterMRPKSPHAVESGVGEHTARESERAQRCATGKERVANA
Ga0228707_106941813300023700FreshwaterMRLRHPHAAESGVGKHTARESERAQACATGKERVANAH
Ga0228708_103005213300023703FreshwaterMSPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0228708_103041713300023703FreshwaterMRPIHPHAADSGVGKHTARESESAQACAIGKERAANAH
Ga0228708_104472913300023703FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQ
Ga0228708_107457313300023703FreshwaterMSPKHPHAAESGVGKHTARESESAQACAAGKERVANAHSH
Ga0232123_105271823300023706Salt MarshMRPKSAHAALSGVGEHPARESESAQWCANGKERVANAHPH
Ga0228709_105237713300023708FreshwaterMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKSESN
Ga0228709_105424123300023708FreshwaterMRPIHPHAAESGVGKHTARESERVQACATGKQRVTNAHS
Ga0228709_105439613300023708FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHP
Ga0228709_105517613300023708FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSH
Ga0228709_106478113300023708FreshwaterMRPRHPRAAESGVGKHTARESERAQACATGKERVASAHPH
Ga0228709_107195013300023708FreshwaterMRPKHPHAAESGVGEHTARESESAKCCADGKERVANAHP
Ga0228709_108355513300023708FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVANA
Ga0228709_111060613300023708FreshwaterMRPRHPHAAESGVGEHKARESESAQHCAAGKERVANAHP
Ga0232122_107523623300023709Salt MarshMRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHP
(restricted) Ga0233425_1001741223300024054FreshwaterMRPKHPHAAESGVGKHTARESESVKACATGKERVTNAHPHKLASEV
Ga0244775_1024663923300024346EstuarineMRPRHPHAAESGVGKHTARESESAKACADAQERVANAHPRT
Ga0255223_107959723300024480FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVANAHS
Ga0256330_105834413300024481FreshwaterMRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANAHPHFEPG
Ga0256330_105986213300024481FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVA
Ga0256330_106978913300024481FreshwaterMRPKHPHAAESGVGKHITRESERAQACANGKERVANAHTHNW
Ga0256330_109280913300024481FreshwaterMRPKHPHAAESGVGKHTARESESAKACATGKERVAN
Ga0256330_109600013300024481FreshwaterMRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAHP
Ga0256330_112703813300024481FreshwaterMRPKHPPAAESGVGEHTARESESAQACAAGEERVAN
Ga0255265_110203413300024482FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAR
Ga0255224_105539013300024483FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQ
Ga0255224_106749423300024483FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHNW
Ga0256332_106145313300024484FreshwaterMRPRSALAALSGVGEHTARESESAQCCAAGKERVAN
Ga0256332_108044913300024484FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPH
Ga0256332_111897923300024484FreshwaterMRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANAH
Ga0256318_108676413300024485FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAVGKERVAN
Ga0255164_103049513300024495FreshwaterMRPKHPHAAESGVGKHTARESESAQACVSGKERVANAHSHISPGDRKV
Ga0255144_104340613300024513FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVANAHSRNWPRRLQN
Ga0255228_105386713300024531FreshwaterMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANA
Ga0256352_104409523300024532FreshwaterMRPRSAHAALSSVGEHPTRESESAKWCAEGKERVAN
Ga0256352_104864523300024532FreshwaterMRPRHPRAAESGVGKHTARESERVQACAAGKEHVTNA
Ga0256352_105112123300024532FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAH
Ga0256299_104812013300024533FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWP
Ga0256299_108734713300024533FreshwaterMRPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPHKL
Ga0256357_104919913300024534FreshwaterMRPRHPHAAESGVGKQTARESESAKACADGEERVANAHS
Ga0256357_111477413300024534FreshwaterMRPRSALAALSGVGEHTARESESAQCCAAGKERVANAHPHF
Ga0255303_105269723300024535FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANA
Ga0256338_106794613300024536FreshwaterMRPKHPHAAESGVGKHITRESERAQACANGKERVANAH
Ga0255225_103792213300024537FreshwaterMRPRSAHAALSGVGEHAARESESAQCCAAGKERVANA
Ga0255225_103801613300024537FreshwaterMRPKHPHAAESGVGKHTARESESAQACATGKERVAN
Ga0255225_104612623300024537FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSH
Ga0255231_104546013300024539FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVAN
Ga0255300_108699913300024540FreshwaterMRPRHPHAAESGVGEHTARESESAQCCATGKERAAN
Ga0256343_104031923300024541FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAHTH
Ga0256343_104298213300024541FreshwaterMRPKHPPAAESGVGEHTARESESAQACADGEERVANA
Ga0256343_105275113300024541FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAVGKERVANAHPHFL
Ga0256350_104339113300024542FreshwaterMRPKHPHAAESGVGKHTARESESAKASADGEERVANAH
Ga0256350_104677413300024542FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHP
Ga0256350_104732613300024542FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVANAH
Ga0256350_106963723300024542FreshwaterMRPKHSHAAESGVGKHITRESERAQACAKGEERVAN
Ga0256350_108409423300024542FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVAN
Ga0256350_110022113300024542FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVAN
Ga0256348_103847113300024543FreshwaterMRPRHPRAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0256348_103916713300024543FreshwaterMRPKHPHAAESGVGKHTTRESERAQACAHGEERVANAH
Ga0256348_104073223300024543FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVA
Ga0256348_107338413300024543FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVANA
Ga0256348_108547913300024543FreshwaterMRPKHPHAAESGVGEHTARESESAKCCAAGKERVANA
Ga0255294_104257213300024544FreshwaterMRPKHPHAAETGVGKHIARESERVQACATGKERVTSAH
Ga0255294_104357913300024544FreshwaterMRPRSALAALSGVGEHTARESESAQCCAAGKERVANA
Ga0255294_105944713300024544FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSH
Ga0255294_108397613300024544FreshwaterMRPRHPHAAESGVGKHPARESERVQACAAGKERVTNAH
Ga0256347_105789313300024545FreshwaterMRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAHPH
Ga0256356_110081623300024546FreshwaterMRPRHPQAAESGVGKHTARESERVQACATGKERVTHA
Ga0256356_110483313300024546FreshwaterMRPRSAHAALSSVGEHPTRESEIAKWCAEGKERVAN
Ga0255292_105269523300024547FreshwaterMRPKHLHAAESGVGKHTARESERAQACATGKERVAN
Ga0256342_106740013300024548FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNW
Ga0256342_107237723300024548FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAAGKERVANA
Ga0256342_107758413300024548FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVAN
Ga0256308_105906023300024549FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTH
Ga0255266_107226923300024550FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAH
Ga0255280_105339923300024555FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQL
Ga0255280_106133813300024555FreshwaterMRPKHPHAAESGVGKHITRESERAQACANGKERVANAHT
Ga0255280_109914313300024555FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANA
Ga0255283_105949613300024557FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHQTCP
Ga0255284_105883113300024559FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNWP
Ga0255284_106033123300024559FreshwaterMRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAH
Ga0255284_106097723300024559FreshwaterMRPRHQHAAESGVGEHTARESESAKACATGKERAANA
Ga0255284_107721613300024559FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVANAHSR
Ga0256306_107569413300024560FreshwaterMRPRHPPAAESGVGKHITRESERAQACAIGKERVANA
Ga0255288_106561423300024561FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAHPH
Ga0256336_106128723300024562FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAH
Ga0256336_106200913300024562FreshwaterMRPRHPPAAESGVGEHTARESESAQACAEGEERVANA
Ga0255236_107075713300024563FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANA
Ga0255273_107008513300024565FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHS
Ga0255273_108259813300024565FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTH
Ga0256309_108645613300024566FreshwaterMRPRHPPAAESGVGKHITRESERAQACANGKERVAN
Ga0255238_107714213300024568FreshwaterMRPKHPHAAESGVGKHITRESERAQACVIGKERVAN
Ga0255238_116679313300024568FreshwaterMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHP
Ga0255243_108222123300024569FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLAP
Ga0255276_109244913300024570FreshwaterMSPRHPHAAESGVGKHTTRESERAQACAAGKERVANA
Ga0256302_107134213300024571FreshwaterMRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHP
Ga0256302_115659113300024571FreshwaterMRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQIW
Ga0255268_111499713300024572FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAH
Ga0256337_107788313300024573FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSHN
Ga0256337_109702613300024573FreshwaterMRPKHPPAAESGIGEHTARESESAQACAEGEERVANAH
Ga0255275_111684813300024574FreshwaterMRPKHPHAAESGVGKHITRESERAQACANGKERVAN
Ga0255275_114730413300024574FreshwaterMRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKL
Ga0255229_103807713300024848FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPLRGQ
Ga0255229_104076113300024848FreshwaterMRPRSAHAALSGVGEHAARESESAQCRAAGKERVAIA
Ga0255293_106275113300024851FreshwaterMRPKHPHAAESGVGKHITRESERAQACAKGEERVAN
Ga0255295_105072923300024852FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKDRVAN
Ga0255295_105073723300024852FreshwaterMRPKHPHAAESGVGEHTARESESAQWCGTWKERAANA
Ga0255287_106566013300024854FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHK
Ga0255286_105878413300024858FreshwaterMRPKHPHAAESGVGKHIARESESAQACADGEERVANA
Ga0255278_105155913300024859FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHT
Ga0256317_106521513300024862FreshwaterMRPRHPHAAESGVGKHTARESESVKACATGKERVTN
Ga0255246_107310013300024863FreshwaterMRPRHPHAAESGVGKHTARESERVQACANGKERVTN
Ga0255271_109246213300024864FreshwaterMSPRHPHAAESGVGKLTTRESERAQACAAGKERVANA
Ga0256340_113660013300024865FreshwaterMRPRHPHAAESGVGKHTARESESAKACATGKERAANAHP
Ga0256340_115492413300024865FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVAN
Ga0255272_109971213300024866FreshwaterMRPRHPRAAESGVGKHTARESESAQACVSGKERVANA
Ga0255267_106798113300024867FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQLAP
Ga0255267_109007723300024867FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSRTRSTK
Ga0255267_112162813300024867FreshwaterMRQKHPHAAESGVGKHTARESERAQACADGEERVAN
Ga0255258_10347813300025726FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRPNWAK
Ga0255241_102700013300025746FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWPRD
Ga0255235_103293113300025753FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVA
Ga0256313_102916113300025757FreshwaterMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANA
Ga0256313_107268713300025757FreshwaterMRPKHPHAAESGVGKCTARESERAQSYTTGKEHVANAH
Ga0255249_103930013300025760FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAH
Ga0207684_1147320613300025910Corn, Switchgrass And Miscanthus RhizosphereMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLA
Ga0207649_1131828113300025920Corn RhizosphereMRPKHPHAAESGVGKHTARESERAQSCATGKECVANTQPQIWPRDRKV
Ga0207651_1122239013300025960Switchgrass RhizosphereMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLAPEASK
Ga0209901_106253013300026275Permafrost SoilMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEP
Ga0209847_111062013300026276Permafrost SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALEPQGSG
Ga0213909_10753313300026386Enriched Soil AggregateMRPRHPHAAESGVGKHTARESERVQACAAGKEHVTN
Ga0255304_102121413300026402FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHS
Ga0255304_102141713300026402FreshwaterMRPRSALAALSGVGEHTARESESAQCCAAGKERVANAHPH
Ga0256296_101937713300026405FreshwaterMRPKPPHAAERGVGKHTARESERAQACVTGKESVAN
Ga0256296_102014723300026405FreshwaterMRPRHPHAAESGVGKHTARESERAQACAAGKERVAN
Ga0256296_103032513300026405FreshwaterMRPKAPPAAGSGVGKHTARESERVQACAAGKECVTNT
Ga0256326_103175013300026412FreshwaterMRPKHPPAAESGVGKHTARESERVQACATGKERVTSA
Ga0256300_102578413300026425FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQI
Ga0256300_102942913300026425FreshwaterMRPKHPHAAESGVGKHTARESERAQACAAGKERVANAH
Ga0255309_103916813300026428FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSRNQ
Ga0255309_105949613300026428FreshwaterMRPRHPHAAESGVGKHTARESERAQACAAGKERVANA
Ga0256297_103200513300026435FreshwaterMRPRHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQL
Ga0256361_103849313300026439FreshwaterMRPRHPHAAESGVGKHTARESERLQACATGKERVTNAH
Ga0256364_103928813300026444FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEP
Ga0256319_105251713300026454FreshwaterMRPKHPHAAESGVGKHTARESERAQACVTGKECVAN
Ga0256319_105427523300026454FreshwaterMRPIHPHAAESGVGKHTARESERVQACATGKERVTNAHS
Ga0255285_106131713300026562FreshwaterMRPKHPHAAESGVGKQIVRESESVQACAAGKERVTSAH
Ga0256355_104085623300026563FreshwaterMRPKHPHAAESGVGKHTARESESDKACAAGKERVANA
Ga0256355_106354813300026563FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAVGKERVAN
Ga0256355_107908713300026563FreshwaterMRPKHLHAAESGVGKHTARESERAQACATGKERVANAH
Ga0256359_102838213300026564FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSR
Ga0256359_105069213300026564FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFE
Ga0256359_106646513300026564FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVA
Ga0256311_114901813300026565FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPLGAA
Ga0256334_106889813300026566FreshwaterMRPKHPHAAESGVGKHTTRESERAQACAAGKERVANA
Ga0256334_106932813300026566FreshwaterMRPKHPHAAESGVGKHIARESESVQACAAGKERVTSA
Ga0255289_106851023300026571FreshwaterMRPKHPHAAESGVGKHTARERESAKACAAGKERVANA
Ga0255270_108065613300026572FreshwaterMRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNWPR
Ga0255270_108320023300026572FreshwaterMRPKHPHAAESGVGKHTARESESAKACATGKERAANA
Ga0255269_109656513300026573FreshwaterMSPRHPHAAESGVGKHTARESESAKACATGKERVANA
Ga0255269_109804013300026573FreshwaterMRPKHPHAAESGVGKHITRESERAQACANGKERVANA
Ga0255188_100549523300027079FreshwaterMRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSRN
Ga0255081_103833213300027155FreshwaterMRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHN
Ga0255158_103477913300027541FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVANAHTRNWP
Ga0209515_1056844413300027835GroundwaterMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL
Ga0256320_11928713300028074FreshwaterMRPKHPPAAESGVGKHTARESERAQTCVNGKECVAHTH
Ga0255305_102523623300028079FreshwaterMRPIHPHAAESGVGKHTARESESVQACANGKERVTNAH
Ga0256324_102870613300028080FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRSMRMSRSRHETE
Ga0255260_103708713300028081FreshwaterMRPRHPPAAESGVGKHTTRESERAQACAVGKERVANAH
Ga0255299_104675413300028089FreshwaterMRPTSAHAALSSVGEHPTRESESAKWCAEGKERVANA
Ga0255261_103529413300028097FreshwaterMRPRHPHAAESGVGKHTARESERVQACATGKERVTNAH
Ga0256363_103856823300028100FreshwaterMRPRSALAALSGVGEHTARESESAQCCAAGKERVANAH
Ga0256363_103967723300028100FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVA
Ga0256363_106284013300028100FreshwaterMRPRHPHAAESGVGKHTARESESAQACAEGEERVANAHS
Ga0256349_103948223300028101FreshwaterMRPRHPRAAESGVGKHTARESERVQACATGKERVTNA
Ga0256349_103985613300028101FreshwaterMRPKHPPAAESGVGEHTARESESAQACAEGEEREANAHS
Ga0256349_104004323300028101FreshwaterMRPKHPHAAESGVGEHTARESESAKCCAAGKERVAN
Ga0256349_104490213300028101FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAAGKERVAN
Ga0256349_104711613300028101FreshwaterMRPRSAHAALSGVGEHTARESESAQCCAVGKERVANAHP
Ga0256305_107501523300028108FreshwaterMRPKPPHAAESGVGKHAARESERAQACVTGKECVANTQ
Ga0256305_109473213300028108FreshwaterMRPKHPHAAESGVGKHTARESESAQACADGEERVAN
Ga0256305_113092113300028108FreshwaterMRPKHPHAAESGVGKHTARESERVQACAAGEERVTNAHSHKLAS
Ga0256335_108702013300028112FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFL
Ga0256335_108795013300028112FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLA
Ga0256335_116500613300028112FreshwaterMRPKHPPAAESGVGEHTARESESAQACAAGEERVANAHS
Ga0255234_119659313300028113FreshwaterMRPRHPPAAESGVGEHTARESESAQACAEGEERVANAHSH
Ga0256346_10618713300028247FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERGANAHS
Ga0255227_103116323300028266FreshwaterMRPKHPPAAESGVGKHTARESERAQACVTGKECVANTHP
Ga0255227_103126613300028266FreshwaterMRPKHPHAAESGVGKHTARESERVQACATGKERVTNAH
Ga0255227_106328623300028266FreshwaterMRPKHPHAAESVVGKHTARESESAQACADGEERVANAHS
Ga0256358_105266913300028267FreshwaterMRPKHPHAAESGVGKHTARESESDKACADGEERVANAHS
Ga0256358_108950413300028267FreshwaterMRPKHPHAAESGVGKYTARESESVQACAAGKERVTNAHP
Ga0256358_110380313300028267FreshwaterMRPKHPHAAESGVGKHITRESERAQACAKGEERVANA
Ga0256331_106948613300028286FreshwaterMRPKHPHAAESGVGKHTARESESAKACAAGEERVAN
Ga0256331_107147113300028286FreshwaterMRPKHPHAAESGVGKHTARESERAQACATGKERVAHAH
Ga0256331_107226213300028286FreshwaterMRPKHPHAAQSGVGKHIARESERAQACAIGKERVANA
Ga0256331_110091713300028286FreshwaterMRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANA
Ga0210315_103532113300028329EstuarineMRPKHPHAAESGVGKHTARESERVQACAPGQERVT
Ga0255279_104025713300028530FreshwaterMRPRHPHAAESGVGKHTTRESERAQACAVGKERVANA
Ga0255279_104348013300028530FreshwaterMRPRHPHAAESGVGKHTARESESAKACADGEERVA
Ga0257136_104306823300028619MarineMRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPH
Ga0257136_104326713300028619MarineMRPKHPHAAESGVGKHTARESESAKRCAAGKERVANAHP
Ga0257136_104334123300028619MarineMRLKHPRAAESGVGKHTARESESAQACANGKERVANAHSHKLAP
Ga0257139_103939913300028620MarineMRPKHPPAAESGVGKHTARESERVQACATGKERVTSAH
Ga0257142_104315323300028621MarineMRLKHPRAAESGVGKHTARESESAQACAAGKERVANAHSHK
Ga0257142_106239723300028621MarineMRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHP
Ga0257142_106305013300028621MarineMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEALT
Ga0257141_104491413300028623MarineMRPKHPPAAESGVGKHTARESERAQSCATGKERVANAHP
Ga0257141_104562823300028623MarineMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLAS
Ga0257141_104627513300028623MarineMRPKHPHAAESGVGKHTARESESAKRCAAGKERVANAHPQ
Ga0257141_104906313300028623MarineMRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPHFEPG
Ga0272412_119920913300028647Activated SludgeMRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEPG
Ga0257143_102952613300028670MarineMRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPHKL
Ga0257143_103098123300028670MarineMRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHP
Ga0307294_1036888813300028810SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAHPHKLAPEASKLP
Ga0265297_1097634613300029288Landfill LeachateMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKLASEA
Ga0222749_1031669323300029636SoilMRPKHPPAAESGVGKHIARESERAQACANGKECVAHTH
Ga0265597_10153823300029639MarineMRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPHTLQCKAK
Ga0265597_10165223300029639MarineMRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPH
Ga0206093_10277313300029640SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0206093_10282713300029640SoilMRPKHPHAAESGVGKHNARESERVQACAAGKERVTN
Ga0206093_10285123300029640SoilMRPKHPHAAESGVGEHTARESEAPNVCVGKERVANAHP
Ga0206093_10288613300029640SoilMRPKHPHAAESGVGKHTARESESAQACAAGKERVANA
Ga0206092_10689323300029646SoilMRPKHPHAAESGVGEHTARESEAPNVCVGKERVAN
Ga0206085_10596013300029649SoilMRPKHPHAAESGVGKHTARESESVQACAAGKERVT
Ga0206091_10761513300029655SoilMRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKL
Ga0206094_10883213300029659SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVT
Ga0265600_11417723300029666MarineMRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHP
Ga0265600_12503413300029666MarineMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKL
Ga0265604_11485313300029674MarineMRPKHPHAAESGVGKHTARESESAKRCAAGKERVAN
Ga0265604_11516923300029674MarineMRPTSAHAALSGVGEHTARESESAKCCADGKERVAN
Ga0265603_101965313300029685MarineMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLASE
Ga0265603_101999813300029685MarineMRPKHPHVAESGVGKHTARESESVKVCAAGKERVVNAHSYKL
Ga0265603_102050523300029685MarineMRPKHPPAAESGVGKHTARESERAQSCATGKERVANA
Ga0265602_102462323300029687MarineMRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLA
Ga0265602_102501213300029687MarineMRPKHPHAAESGVGKHTARESERAQACANGKERVANAHSH
Ga0265598_103093513300029691MarineMRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEAL
Ga0265598_103177523300029691MarineMRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPHLTAKR
Ga0265598_103358713300029691MarineMRPKHPHAAESGVGKHTARESESAKRCAAGKERVANA
Ga0265598_103422713300029691MarineMRPIHPHAAESGVGKHTARESESVQACATGKERVTN
Ga0257137_103650823300029693MarineMRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPHKLAP
Ga0255233_104073713300029699FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTDH
Ga0222748_111191213300029701SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVA
Ga0247632_100804213300030533SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0210289_160183213300030543SoilMRPRHPHAAESGVGKHTARESERAQSCAAGKERVAN
Ga0247631_101204313300030550SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLRGKEWRRFE
Ga0247654_115730213300030552SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVAN
Ga0247654_117261113300030552SoilMRPIHPRAAESGVGKHTARESERAQACATGKERLANA
Ga0247635_107080213300030565SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVTN
Ga0247652_110887713300030571SoilMRPKHPHAAESGVGKHTARESESVQACAAGKEHVTN
Ga0247644_105178713300030576SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAHSHKL
Ga0247633_1025303313300030579SoilMRPKHLHAAESGVGKYTARESERVQACAAGKERVTSAHPHKFTRLKAKI
Ga0247612_108906013300030592SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0247659_122388713300030600SoilMRPKHPHAAESGVGKHITRESERAQACAAGKERVANAHSHK
Ga0247634_1024394913300030609SoilMRPKHLHAAESGVGKHIARESESAKACAAGKERVAN
Ga0247613_1012127913300030610SoilMRPKHPRAAESGVGKHTARESERVQACAAGKEHVTNAHCIAF
Ga0247613_1018608413300030610SoilMRLIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLGKRKK
Ga0247655_1026220113300030621SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANA
Ga0265392_118296913300030623SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRNRKVP
Ga0247629_1036635613300030628SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLASRKR
Ga0247636_1010128213300030634SoilMRPKHLHAAESGVGKYTARESERVQACAAGKERVTNAH
Ga0247621_118024513300030683SoilMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKKKK
Ga0307482_107797913300030730Hardwood Forest SoilMRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPE
Ga0307482_109437113300030730Hardwood Forest SoilMRPKHPRAAESGVGKHTARESESAQACAAGKERVANAH
Ga0307482_109456423300030730Hardwood Forest SoilMRPKHPHAAESGVGKHIARESERVQACAAGKERVTNA
Ga0307482_112126023300030730Hardwood Forest SoilMRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAH
Ga0265459_1103958623300030741SoilMRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTHPQIEKNKRKGEGQKK
Ga0265459_1349139713300030741SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQKKK
Ga0102764_188934623300030751SoilMRPKHPHAAESGVGKHKARESERAQRCAAGKERVANAHPQ
Ga0265720_100402313300030764SoilMRPRHPHAAESGVGEYTARESERAQQCADGKERVANAH
Ga0102752_165150713300030783SoilMRPKHLHAAESGVGKYTARESERVQACAAGKERVT
Ga0138304_133939313300030790SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIW
Ga0074037_187779013300030803SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPQK
Ga0265756_10340313300030805SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHP
Ga0265735_10186123300030811SoilMRPRHPHAAESGVGKHIARESERAQACANGKEHVAHAQ
Ga0265734_10587613300030812SoilMRPIHPHAAESGVGKHTARESERVQACAAGKERVTHAHP
Ga0265746_102353513300030815SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNA
Ga0265729_10122623300030816SoilMRSKTSHAAKSGVGEHTARESERAQQCAIGKECVAYTH
Ga0265729_10368513300030816SoilMRPIHPHAAESGVGKHTARESERVQACAAGKERVTHAH
Ga0265726_10152813300030824SoilMRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAHP
Ga0308203_102433423300030829SoilMRPKHPHAAESGVGKYTARESERAQSYITGKERVANA
Ga0308203_102445923300030829SoilMRPIHPHAAESGVGKHIARESERVQACAAGKERVTN
Ga0308203_105374513300030829SoilMRPIHPHAAESGVGKYTARESERVQACAAGKEHVTNA
Ga0308203_109410713300030829SoilMRPRHPHAAESGVGKHTARESERAQLCANGKERVANAH
Ga0308205_101682913300030830SoilMRPKHPHAAESGVGKCTARESERAQSYTTGKERVANA
Ga0308152_10351013300030831SoilMRPKHPHAAESGVWKHTARKCEGAKACAAGKERVAN
Ga0308152_11518813300030831SoilPRHPHAAESGVGKYTARESERVQACAAGKERAGALKQ
Ga0265736_10132813300030833SoilMRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAH
Ga0265736_10156513300030833SoilMRPKHPHAAESGVGKYIARESERAQACIIGKERVANAHP
Ga0265738_10164913300030834SoilMRPRHPHAAESGVGKHIARESERAQACANGKEHVAHAH
Ga0265738_10170113300030834SoilMRPRHPHAAESGVGKHTARESERVQACAAGKEQVTN
Ga0075374_1006039213300030855SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQ
Ga0265723_100702913300030872SoilMRPKHPHAAESGVGKYIARESERAQACTIGKERVANA
Ga0265751_10395513300030873SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHP
Ga0265727_10092313300030875SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQI
Ga0265727_10148213300030875SoilMRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAHPH
Ga0265730_10110513300030876SoilMRPKHPHAAESGVGKHTARESERAQSCANGKERVANA
Ga0265776_10299213300030880SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVT
Ga0265733_10199713300030887SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHP
Ga0308202_104375323300030902SoilMRLKHPHAAESGVGKHNARESERVQACAAGKERVTN
Ga0308202_104377613300030902SoilMRPKHPHAAESGVGKHTARKCEGAKACAAGKERVAN
Ga0308202_107994713300030902SoilMRPKHPPAAESGVGKHTARESERAQSCATGKERVAN
Ga0308202_111370013300030902SoilMRPIHPHAAESGVGKYTARESERVQACAAGKERVTN
Ga0308206_105401713300030903SoilMRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTQ
Ga0308206_105422123300030903SoilMRPKHLHAAESGVGKYTARESERVQACAAGKERVTN
Ga0308206_107684213300030903SoilMRPRHPHAAESGVGKHIARESESVQACAAGKERVTN
Ga0308198_102612713300030904SoilMRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAH
Ga0308198_102682513300030904SoilMRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAH
Ga0308200_104238423300030905SoilMRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL
Ga0308200_104441913300030905SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKECVANT
Ga0138296_109489913300030923SoilMRPKHPHAAESGVGKCTARESERAQSYTTGKESKMKR
Ga0138302_144842913300030937SoilMRPIHPRAAESGVGKHTARESERVQACAAGKERVTNAHIRPHQT
Ga0138302_152491413300030937SoilMRPKHPHAAESGVGEHTARESESAQRCAIGKERVAIA
Ga0311366_1123035713300030943FenMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQNLAPGPQGSGAIFFVNLRSWDT
Ga0075399_1003482113300030967SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQK
Ga0075376_1003138013300030968SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHPQ
Ga0075395_1003576013300030973SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLASEASK
Ga0265721_100217713300030977SoilMRPRHPHAAESGVGKHTARESERAQACANGEEHVAHAH
Ga0265721_101025213300030977SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANA
Ga0265748_10259113300030982SoilMRPRHPHAAESGVGKHTARESERAQSCAAGKERVANAH
Ga0265748_10627713300030982SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKECVANTH
Ga0308154_10439813300030986SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVAN
Ga0308155_100806113300030987SoilMRPKHPHAAESGVGKYTARESERAQSYITGKERVANAH
Ga0308183_105521723300030988SoilMRPIHPHAAESGVGKHTARKCERVQACAAGKERVTNA
Ga0308183_105600113300030988SoilMRPRHPLAAESGVGKLSARESESALACAAGKERVAN
Ga0308196_101759323300030989SoilMRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAH
Ga0308196_102734613300030989SoilMRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQIW
Ga0308196_106254413300030989SoilMRPQHPHAAESGVGKHTARESERVQACAAGKEHVTNAH
Ga0308178_104340513300030990SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQIW
Ga0308190_105735423300030993SoilMRPRHPHAAESGVGKYTARESERVQACAAGKERVTN
Ga0308190_113059413300030993SoilMRPRHPHAAECGVGKHTARESERAQACAAGKERVAN
Ga0308190_113871713300030993SoilMRPIHPHAAESGVGKHTARESERVQACAAGKEHVTN
Ga0073997_1009222713300030997SoilMRLKHPHAAESGVGKHTARESESVQACAAGKEHVTNAH
Ga0073996_1008503213300030998SoilMRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTHPQ
Ga0265732_10119323300031016SoilMRPKHPHAAESGVGKYIARESERAQACTIGKERVANAH
Ga0265732_10120023300031016SoilMRPKHPHAAESGVGEHTARESERAQQCADGKERVANAHP
Ga0073998_1164255713300031023SoilMRLKHPHAAESGVGKYTARESESVKACAAGKERVTNAH
Ga0073978_162821713300031036MarineMRPKHPHAAESGVGKHTARESESAQACADGEERVANAH
Ga0265749_10110513300031042SoilMRPRHPHAAESGVGKHIARESERVQACAAGKERVTN
Ga0265779_10395913300031043SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAH
Ga0308189_1013157213300031058SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQIWPRSR
Ga0308189_1013980913300031058SoilMRPKHLHAAESGVGKHITRESERAQECAAGKERVANAHSH
Ga0308189_1014348913300031058SoilMRPIHPHAAESGVGKHTARESERAQACAAGKERVANAH
Ga0308189_1014370523300031058SoilMRPKHPHAAESGVGKHTARESELVQACAAGIERVTNA
Ga0308189_1017024313300031058SoilMRPKHPHAAESGVGKHTARESESAQACADGKERVANAH
Ga0308189_1027652713300031058SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVANA
Ga0308189_1042380613300031058SoilMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANA
Ga0308189_1049567713300031058SoilMRPRHPHAAVSGVGKHTARESERVQACAAGKERVTN
Ga0308185_102993323300031081SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKECVANTH
Ga0308192_102683023300031082SoilMRPIHPPAGESGVGKHRARESERAKSCAIGKECVAN
Ga0308192_105310213300031082SoilMRPRHPHAAESGVGKHTARESERAQLCANGKERVAN
Ga0308201_1011058813300031091SoilMRPKHPHAAESGVGKHNARESERVQACAAGKERVTNA
Ga0308201_1011366013300031091SoilMRPKHPLAAESGVGEHTARESESAQQCAVGKECVA
Ga0308201_1034054713300031091SoilMRPKHPHAAESGVGKHTARESERAQSCAIGKECVAN
Ga0308204_1009271813300031092SoilMRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQIWPR
Ga0308204_1010072713300031092SoilMRPKHPHAAESGVGEHTARESESAQQCAVGKERVAN
Ga0308204_1017550613300031092SoilMRPRHPRAAESGVGKHTARESESAQACAAGKERVANA
Ga0308204_1017979013300031092SoilMRPIHLHAAESGVGKHIARESERVQACAAGKERVTNA
Ga0308197_1010681413300031093SoilMRPRHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP
Ga0308197_1011789823300031093SoilMRPIHPHAAESGVGKHIARESERVQACAAGKERVTNA
Ga0308199_105190613300031094SoilMRPKHPHAAESGVGKHTARKCEGAKACAAGKERVA
Ga0308184_101282823300031095SoilMRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAHPH
Ga0308184_102296813300031095SoilMRPKHPHAAESGVGKHTARESERAQACAAGKERVA
Ga0308184_103036813300031095SoilMRPKHPHAAESGVGKHTARESESAQECAAGKERVANA
Ga0308193_102348813300031096SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAH
Ga0308193_102979713300031096SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPHIW
Ga0308193_104717713300031096SoilMRPKHPHAAESGVGKHTARESERVQACATGKEHVTNAH
Ga0308188_103184913300031097SoilMRPRHPHAAESGVGKYTARESERVQACAAGKERVTNA
Ga0308188_103787113300031097SoilMRPKHPHAAESGVGKHTARESESAQECAAGKERVA
Ga0308181_104853923300031099SoilMRPITSHAAVSGVGKHTARESERVQAFAAGNERVTNA
Ga0308181_110821813300031099SoilMRTKHPHAAESGVGKHNARECERVQACAAGKERVTN
Ga0308180_101043913300031100SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVAN
Ga0308180_101064813300031100SoilMRPKHPHAAESGVGEHTARESERAQRCADGKERVAN
Ga0308180_101154813300031100SoilMRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL
Ga0308187_1013421423300031114SoilMRPRHPHAAESGVGKHTARESERVQACAAGKEHVTNA
Ga0308187_1013885613300031114SoilMRPKHPHAAESGVGKHNARESERVQACAAGKERVT
Ga0308187_1033483713300031114SoilMRPKHPHAAESGVGKHTARDSERVQACAAGKEHVTNA
Ga0308195_102112013300031123SoilMRPKTLHAAESGVGEHTARESESAQPCAIGKERVA
Ga0308195_103487313300031123SoilMRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQ
Ga0308151_101255213300031124SoilMRPKHPHAAESGVGKYTARESERVQACAAGKERVTNA
Ga0308182_100692013300031125SoilMRPKHPHAAESGVGKHTARESERAQLCADGKERVANAH
Ga0308182_101208213300031125SoilMRPRHPHAAESGVGKHTARESERAQACATGKERVANA
Ga0308182_101902613300031125SoilMRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANAH
Ga0170824_10675521723300031231Forest SoilMRSKAALAALSGVGEHTARESESAQGCATGKERVANAPP
Ga0170824_12405606913300031231Forest SoilMRPRHPHAAESGVGKYTARESERVQACAAGKERVTNAHPQ
Ga0265328_1046409813300031239RhizosphereMRPRHPHAAESGVGKHTARESERAQACAIGKERVANAHPQIWPRD
Ga0265327_1045583213300031251RhizosphereMRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQIW
Ga0308194_1020689313300031421SoilMRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANAHS
Ga0308194_1025967323300031421SoilMRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNA
Ga0308186_100954413300031422SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKL
Ga0308186_100979113300031422SoilMRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTHPQIW
Ga0308186_102319213300031422SoilMRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAHPR
Ga0308177_102061713300031423SoilMRPKHLHAAESGVGKYTARESERVQACAAGKEHVTNA
Ga0308179_101452713300031424SoilMRPKHLHAAESGDGKFSARESERVQACAAGKEHVTNA
Ga0308179_101471913300031424SoilMRPKHPHAAESGVGKHTARESERAQACATGKERVAN
Ga0308179_101634713300031424SoilMRPRHPHAAESGVGKHNARESESVKACAAGKERVTNAH
Ga0308179_102575713300031424SoilMRPIHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL
Ga0170820_1681351013300031446Forest SoilMRPKHPHAAESGVGKHNARESESAKACAAGKERVANAH
Ga0170819_1199161813300031469Forest SoilMRPKHPRAAESGVGKHTARESERVQACAAGKERVTNAHPQK
Ga0170819_1323246013300031469Forest SoilMRLKPPHAAESGVGKHTARESESAKACAAGKERVANAH
Ga0170819_1774013913300031469Forest SoilMRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQ
Ga0314827_10844813300031476SoilMRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAH
Ga0314827_10856413300031476SoilMRPKHPRAAESGVGKHTARESESAQACAAGKERVAN
Ga0314816_102003313300031481SoilMRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHPHQL
Ga0314822_10461913300031484SoilMRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAH
Ga0314823_10522423300031487SoilMRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLAP
Ga0314823_10527013300031487SoilMRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHPHQLAS
Ga0314825_10516613300031490SoilMRPKHPRDAESGVGKHTARESERVQACAAGKERVTNA
Ga0314824_10327013300031491SoilMRPKHLHAAESGVGKHTARESERVQACAAGKERVTN
Ga0314826_11413713300031493SoilMRPKHPHAAESGVGKHTARESERAQSCATGKERVA
Ga0314826_11419113300031493SoilMRPKHPHAVESGVGKHITRESERVQACAAGKERVTNA
Ga0314826_11618513300031493SoilMRPKHLHAAESGVGKHIARESERVQACAAGKERVTN
Ga0314817_11389213300031495SoilMRPKHPHAVESGVGKHNTRESERVQACAAGKERVTNA
Ga0314818_10620013300031499SoilMRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHP
Ga0314819_10502513300031502SoilMRPKHPHAAESGVGKHTARESEAPNSMRGKERAANAH
Ga0314820_10480623300031503SoilMRPKHPHAVESGVGKHIARESESVQVCAAGKERVTN
Ga0307408_10060627223300031548RhizosphereMRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEAARPP
Ga0265605_102964423300031560MarineMRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAH
Ga0265605_104737023300031560MarineMRPKHPHAAESGVGKYTARESERVQACATGKERVTN
Ga0307483_100973613300031590Hardwood Forest SoilMRPRHPRAAESGVGKHTARESESAQACAAGKERVANAHPQKL
Ga0265313_1012031723300031595RhizosphereMRPKHPHAAESGVGKHTARESERAQSCANGKERVANAHPQIWPRDRKVPG
Ga0307274_102269023300031661Subsurface WaterMRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPHFD
Ga0307480_100506813300031677Hardwood Forest SoilMRPRHPHAAESGVGKHIARESESVKECAAGKERVTNA
Ga0307480_102218223300031677Hardwood Forest SoilMRPKHPHAAESGVGKHNARESESAQACAAGKERVANA
Ga0310901_1042382723300031940SoilMRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAHPHKLAPEAAKL
Ga0307272_103811623300031960Subsurface WaterMRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPH
Ga0315302_104549523300032149MarineMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKLAP
Ga0316593_1024756713300032168RhizosphereMRPKSAHAALSGVGEHPARESESAKWCANGKERVANAHSQPRRRP
Ga0315276_1109955723300032177SedimentMRPKHPHAAESGVGKHTARESESVQACATGKERVTNAHSHK
Ga0315271_1016080823300032256SedimentMRPRHPHAAESGVGKHTARESESAQACAIGKERVANAHSHKLASEA
Ga0335069_1161571613300032893SoilMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPH
Ga0335076_1149769213300032955SoilMSPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHTLAPGPQGSGALLFS
Ga0335084_1092399813300033004SoilMSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHFLAPEPGGSGAKLFLRVENRSGD
Ga0316592_106636023300033524RhizosphereMRPRSAHAALSGVGEHPARESESAKWCANGKERVANAHPH
Ga0316586_106120623300033527RhizosphereMRPKSAHAALSGVGEHPARESESAKWCANGKERVANAHP
Ga0316588_107599413300033528RhizosphereMRPRSAHAALSGVGEHPARESESAKWCANGKERVANAHPHFEPG
Ga0316588_108254013300033528RhizosphereMRPKSAHAALSGVGEHPARESESAKWCANGKERVA
Ga0316587_104413723300033529RhizosphereMRPRSAHAALSGVGEHPARESESAKWCAEGEERVANAH
Ga0316587_109289323300033529RhizosphereMRPRSAHAALSGVGEHPARECESAKWSAEGEERVANAH
Ga0335036_0398093_1_1353300034106FreshwaterMRPIHPHAAESGVGKHTARESERVQACATGKERVTNAHSHKLASE
Ga0370510_0131509_618_7643300034160Untreated Peat SoilMRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRDRKVP
Ga0335064_0754562_2_1303300034357FreshwaterMRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIRP
Ga0370540_04018_639_7703300034448SoilMRPKHPHAAESGVGEHTARESESAQQCAIGKERVANAHSQIWPR
Ga0314785_005053_744_8543300034479SoilMRPKHPRAAESGVGKHNARESERAQVCAAGKERVANA
Ga0314785_005895_700_8133300034479SoilMRPRHPHAAESGVGKYTARESERVQACAAGKERVTNAH
Ga0314785_009479_583_6933300034479SoilMRPKHPHAAESGVGKHNTRESERVQACAAGKEHVTNA
Ga0314789_007886_2_1333300034480SoilMRPKHPHAAESGVGKHNARESERAQVCAAGKERVANAHPQKLAP
Ga0314789_008281_701_8173300034480SoilMRPTHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0314789_008772_1_1053300034480SoilMRPRHPLAAESGVGEHTARESERAQQCAIGKERVA
Ga0314789_012624_1_1353300034480SoilMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAPE
Ga0315299_09137_693_8213300034481MarineMRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKLA
Ga0326770_009772_3_1193300034482SoilMRPKHLHAAESGVGKHTTRESESAKGCAAGKERVASAHS
Ga0370545_153818_3_1193300034643SoilMRPRHPHAAESGVGKHIARESESVKECAAGKERVTNAHP
Ga0370548_039891_691_8013300034644SoilMRPRHPHAAESGVGKHTARESERAQLCANGKERVANA
Ga0316598_099494_695_8053300034652Untreated Peat SoilMRPKHPLAAESGVGEHTARESERAQACAAGKERVANA
Ga0316599_088225_696_8063300034653Untreated Peat SoilMRPIHPHAAESGVGEHTARESESAQQCAVGKERVANA
Ga0316599_088254_694_8043300034653Untreated Peat SoilMRPKSAHAALSGVGEHTARESESAQCCAAGKERVANA
Ga0316599_088355_692_8053300034653Untreated Peat SoilMRPRHPHAAESGVGKPNARASESAKPCAAGNERVANAH
Ga0316599_121671_574_6873300034653Untreated Peat SoilMRPKHPHAAESGVGEHTARESERVQQCAIGKECVTNTH
Ga0314780_052756_701_8173300034659SoilMRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHP
Ga0314780_053333_700_8163300034659SoilMRPKHPPAAESGVGTHTARESERVQACAAGTEHVTNAHP
Ga0314780_054541_2_1123300034659SoilMRPNPPHAAESGVGKHTARESERVQACAAGKEHVTNA
Ga0314780_055443_694_8043300034659SoilMRPTHPHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0314780_067018_637_7563300034659SoilMRPKSPHAVESGVGEHTARESERAQRCATGKERVANAHPH
Ga0314780_067083_644_7543300034659SoilMRPKHPHAAESGVGEHTARETERAQRCAIGKERVANA
Ga0314780_154667_2_1093300034659SoilMRPKHPHAAESGVGKYTARESERVQACAAGKERVTN
Ga0314781_019554_929_10423300034660SoilMRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0314781_038859_702_8153300034660SoilMRPKHPHAAESGVGKHTARESEGAKECAAGKERVANAH
Ga0314781_039131_3_1343300034660SoilMRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHPQIWPR
Ga0314781_052627_621_7343300034660SoilMRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAH
Ga0314781_057532_599_7093300034660SoilMRPKHPHAAESGVGKHTARESERAHSCAAGKERVANA
Ga0314781_099839_1_1143300034660SoilMRPKHLHAAESGVGKHITRERQRAQACAAGKERVAHAH
Ga0314782_052062_702_8183300034661SoilMRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAHP
Ga0314782_052063_699_8183300034661SoilMRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPP
Ga0314782_070939_621_7373300034661SoilMRPKHPLAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0314782_147198_455_5743300034661SoilMRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPH
Ga0314782_150529_454_5703300034661SoilMRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAHP
Ga0314782_188441_396_5273300034661SoilMRLKHPHAAESGVGKHNARESECVQACAAGKERVTNAHPHKLAP
Ga0314782_191929_388_5253300034661SoilMRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHSHKLAPED
Ga0314783_042398_699_8273300034662SoilMRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHSHKLA
Ga0314783_071859_575_6913300034662SoilMRSKATLAALSGVGEHTARESESAQGCATGKECVASTHP
Ga0314783_163740_3_1163300034662SoilMRPKHPHAAESGVGKHNARESERAQVCAAGKERVANAH
Ga0314784_021821_899_10093300034663SoilMRPRHPHAAESGVGKHNARESESAKACAAGKERVANA
Ga0314784_041381_697_8133300034663SoilMRSKAALAALSGVGEHTARESESAQGCATGKECVASTHP
Ga0314784_096301_495_6113300034663SoilMRPKQPHAAESGVGKPTARESERVQACAAGKEHVTNAHP
Ga0314786_032446_795_9053300034664SoilMRPTHPHAAESGVGKHITRESERAQACAAGKERVANA
Ga0314786_046243_700_8043300034664SoilMRPKHPHAAESGVGKHTARDSERVQACAAGKEHVT
Ga0314786_085439_544_6573300034664SoilMRPKHPHVAESGVGKHIARESESAKACAAGKERVANAH
Ga0314786_093690_506_6343300034664SoilMRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLA
Ga0314786_095145_520_6333300034664SoilMRPRHPHAAESGVGKHNARESERVQACAAGKERVTNAH
Ga0314787_030791_695_8143300034665SoilMRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAQPH
Ga0314787_033334_678_7913300034665SoilMRLKHPHAAESGVGKHTARESERAQSCATGKERVANAH
Ga0314787_039039_632_7483300034665SoilMRPIHPHAAESGVGEHTARESERVQACAAGKERVTNAHP
Ga0314787_055510_554_6613300034665SoilMRPKHPPAAESGVGMHTARDSERALSCAIGKECVAN
Ga0314787_063316_515_6313300034665SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHP
Ga0314788_048321_3_1283300034666SoilMRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAHPHNL
Ga0314788_058514_664_7803300034666SoilMRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAHP
Ga0314788_152301_2_1333300034666SoilMRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLAP
Ga0314792_070292_703_8133300034667SoilMRPKHPHAAESGVGKYPARESERVLACAAGKERVTNA
Ga0314792_078391_671_7843300034667SoilMRPRHPRAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0314792_093712_618_7373300034667SoilMRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAHPH
Ga0314793_041240_699_8153300034668SoilMRPIHPHAADSGVGKHTARESERAQACAAGKERVANAHP
Ga0314793_042493_696_8063300034668SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTHA
Ga0314793_044274_682_7953300034668SoilMRSKATLAALSGVGEHTARESESAQGCATGKECVASTH
Ga0314793_051199_645_7583300034668SoilMRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAH
Ga0314793_089996_507_6233300034668SoilMRPKHPRAAESGVGKHNARESERAQVCAAGKERVANAHP
Ga0314794_137383_1_1293300034669SoilMRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHSQKLA
Ga0314794_160155_2_1123300034669SoilMRPRHPHAAESGVGKHTARESERVQACAAGKERVTSA
Ga0314795_121086_1_1203300034670SoilMRSKATLAALSGVGEHTARESESAQGCATGKECVASTHPR
Ga0314796_036533_768_8843300034671SoilMRPRHPLAADSGVGKHTARESEAPNSVAAGKERVANAHP
Ga0314797_038384_701_8293300034672SoilMRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAQPHRGC
Ga0314797_042212_685_8043300034672SoilMRPKHPHAAESGVGKHITRESERAQACAAGKERVANAHSH
Ga0314797_046737_660_7763300034672SoilMRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHP
Ga0314797_049016_646_7623300034672SoilMRPKHLHAEESGVGKHNSRESERVLACAAGKERVTNAHP
Ga0314797_073197_547_6633300034672SoilMRPRSPHAAESGVGKHTARESESAQACAAGKERVANAHP
Ga0314797_083407_506_6313300034672SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKL
Ga0314798_045230_696_8093300034673SoilMRPKHPPAAESGVGKHTARESERVQACAAGKERVTNAH
Ga0314798_104064_486_6023300034673SoilMRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHP
Ga0314799_013513_698_8113300034674SoilMRPKHPHAAESGVGKHNARESESAQACAAGKERVANAH
Ga0314799_035629_455_5743300034674SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHSH
Ga0314800_061120_437_5563300034675SoilMRPKHPHAAESGVGKLTARESERVQACAAGKERVTSAHPH
Ga0314801_051366_688_8163300034676SoilMRPKHPRAAESGVGKHTARESESAQACAAGKERVANAHPQKLA
Ga0314801_053389_1_1143300034676SoilMRPIHPHAAESGVGEHTARESERAQRCAIGKERVANAH
Ga0314801_053594_692_8053300034676SoilMRPIHPHAADSGVGKHTARESERAQACAAGKERVANAH
Ga0314801_059330_658_7773300034676SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPH
Ga0314802_006656_867_9863300034677SoilMRPKHPPAAESGVGKHTARESERVQACAAGKERVTNAHPH
Ga0314802_020078_555_6713300034677SoilMRPIHPHAAESGVGEHTARESERAQRCATGKERVANAHP
Ga0314803_035191_2_1123300034678SoilMRPIHPHAAESGVGKHTARESERAQACAAGKERVATA
Ga0314803_036322_697_8043300034678SoilMRPTHPHAAESGVGKHTARESERVQACAAGKERVTN
Ga0314803_061697_2_1333300034678SoilMRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLAP
Ga0314803_143555_390_5003300034678SoilMRPTHLHAAESGVGKHTARESERVQACAAGKERVTNA
Ga0370541_015725_696_8123300034680SoilMRPIHPHAAESGVGKHTARESERAQACAAGKERVANAHP
Ga0370541_055113_412_5283300034680SoilMRPQHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP
Ga0370546_025527_699_8093300034681SoilMRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.