Basic Information | |
---|---|
Family ID | F000344 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 1257 |
Average Sequence Length | 39 residues |
Representative Sequence | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAH |
Number of Associated Samples | 703 |
Number of Associated Scaffolds | 1257 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.12 % |
% of genes near scaffold ends (potentially truncated) | 98.65 % |
% of genes from short scaffolds (< 2000 bps) | 98.97 % |
Associated GOLD sequencing projects | 694 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.075 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (14.002 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.979 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (28.162 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 1257 Family Scaffolds |
---|---|---|
PF07859 | Abhydrolase_3 | 0.40 |
PF13414 | TPR_11 | 0.08 |
PF00270 | DEAD | 0.08 |
PF00884 | Sulfatase | 0.08 |
PF08447 | PAS_3 | 0.08 |
COG ID | Name | Functional Category | % Frequency in 1257 Family Scaffolds |
---|---|---|---|
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.07 % |
Unclassified | root | N/A | 41.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111013|DRAFT_Contig_40329 | Not Available | 533 | Open in IMG/M |
2222084002|DRAFT_c135472 | Not Available | 532 | Open in IMG/M |
2222084002|DRAFT_c44377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 546 | Open in IMG/M |
2228664014|PheDRAFT_GXW9OCQ03G4BSS.67174 | Not Available | 528 | Open in IMG/M |
2228664014|PheDRAFT_GXW9OCQ03GBLGT.25308 | Not Available | 515 | Open in IMG/M |
2228664014|PheDRAFT_GXW9OCQ03HE39N.62062 | Not Available | 523 | Open in IMG/M |
3300001808|JGI20218J20341_1003204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 825 | Open in IMG/M |
3300001810|JGI20221J20338_1012266 | Not Available | 804 | Open in IMG/M |
3300002341|JGI24213J29975_1001175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 822 | Open in IMG/M |
3300002343|JGI24214J29971_1001759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 829 | Open in IMG/M |
3300002346|JGI24216J29974_1003104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300002675|Ga0005473J37261_100253 | Not Available | 831 | Open in IMG/M |
3300002677|Ga0005475J37263_101507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300002678|Ga0005477J37265_100269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300002680|Ga0005483J37271_100800 | Not Available | 699 | Open in IMG/M |
3300002681|Ga0005471J37259_100510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 833 | Open in IMG/M |
3300002861|Ga0006842J43188_100758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 836 | Open in IMG/M |
3300002864|Ga0006764J43180_100054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300002865|Ga0006761J43178_100035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 826 | Open in IMG/M |
3300002868|Ga0006767J43181_100031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300003158|Ga0006760J45825_100079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 822 | Open in IMG/M |
3300003158|Ga0006760J45825_100323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 778 | Open in IMG/M |
3300003162|Ga0006778J45830_1000223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
3300003289|Ga0006776J48906_101333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300003308|Ga0006777J48905_1001552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10188597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 836 | Open in IMG/M |
3300003563|Ga0007430J51106_102244 | Not Available | 507 | Open in IMG/M |
3300003576|Ga0007413J51701_1000037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 723 | Open in IMG/M |
3300003611|Ga0007411J51799_100085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 822 | Open in IMG/M |
3300003672|Ga0001194_100273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 587 | Open in IMG/M |
3300003672|Ga0001194_100342 | Not Available | 513 | Open in IMG/M |
3300003754|Ga0005853_1012315 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300004102|Ga0058888_1024922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 831 | Open in IMG/M |
3300004120|Ga0058901_1032462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300004130|Ga0058895_1004745 | Not Available | 810 | Open in IMG/M |
3300004131|Ga0058898_1010608 | Not Available | 802 | Open in IMG/M |
3300004133|Ga0058892_1014231 | Not Available | 549 | Open in IMG/M |
3300004134|Ga0058906_1018895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 844 | Open in IMG/M |
3300004140|Ga0058894_1017365 | Not Available | 559 | Open in IMG/M |
3300004282|Ga0066599_100934454 | Not Available | 624 | Open in IMG/M |
3300004473|Ga0068919_1042149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Amel2xE9 | 619 | Open in IMG/M |
3300004530|Ga0066516_112556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 633 | Open in IMG/M |
3300004567|Ga0066495_112065 | Not Available | 584 | Open in IMG/M |
3300004622|Ga0058865_1089282 | Not Available | 570 | Open in IMG/M |
3300004798|Ga0058859_10069550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 823 | Open in IMG/M |
3300004800|Ga0058861_10114364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 832 | Open in IMG/M |
3300004801|Ga0058860_10137912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 520 | Open in IMG/M |
3300004801|Ga0058860_10166036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 553 | Open in IMG/M |
3300004801|Ga0058860_10187612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 623 | Open in IMG/M |
3300004801|Ga0058860_12198574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 825 | Open in IMG/M |
3300005506|Ga0068912_11262868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 739 | Open in IMG/M |
3300005544|Ga0070686_100957664 | Not Available | 700 | Open in IMG/M |
3300005577|Ga0068857_101414585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 677 | Open in IMG/M |
3300005646|Ga0075040_1066867 | Not Available | 682 | Open in IMG/M |
3300005662|Ga0078894_10009016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 7783 | Open in IMG/M |
3300005805|Ga0079957_1241070 | Not Available | 845 | Open in IMG/M |
3300005949|Ga0066791_10040477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 920 | Open in IMG/M |
3300006230|Ga0082390_128012 | Not Available | 533 | Open in IMG/M |
3300006235|Ga0082395_1023932 | Not Available | 705 | Open in IMG/M |
3300006355|Ga0075501_1022023 | Not Available | 778 | Open in IMG/M |
3300006366|Ga0075499_1045774 | Not Available | 596 | Open in IMG/M |
3300006366|Ga0075499_1066309 | Not Available | 639 | Open in IMG/M |
3300006373|Ga0075483_1005175 | Not Available | 807 | Open in IMG/M |
3300006378|Ga0075498_1079059 | Not Available | 645 | Open in IMG/M |
3300006378|Ga0075498_1089608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 724 | Open in IMG/M |
3300006378|Ga0075498_1102472 | Not Available | 759 | Open in IMG/M |
3300006401|Ga0075506_1008475 | Not Available | 811 | Open in IMG/M |
3300006402|Ga0075511_1735251 | Not Available | 806 | Open in IMG/M |
3300006426|Ga0075037_1029691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
3300006602|Ga0075484_1080712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Amel2xE9 | 664 | Open in IMG/M |
3300006602|Ga0075484_1548442 | Not Available | 779 | Open in IMG/M |
3300006641|Ga0075471_10431683 | Not Available | 658 | Open in IMG/M |
3300006647|Ga0099772_1048080 | Not Available | 673 | Open in IMG/M |
3300006727|Ga0031666_1104236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 801 | Open in IMG/M |
3300006731|Ga0079249_1359898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 801 | Open in IMG/M |
3300006917|Ga0075472_10709706 | Not Available | 507 | Open in IMG/M |
3300006937|Ga0081243_1035118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300007159|Ga0075020_112575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 666 | Open in IMG/M |
3300007219|Ga0075025_1008441 | Not Available | 520 | Open in IMG/M |
3300007219|Ga0075025_1057764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 775 | Open in IMG/M |
3300007232|Ga0075183_11491147 | Not Available | 766 | Open in IMG/M |
3300007235|Ga0075184_10085099 | Not Available | 517 | Open in IMG/M |
3300007237|Ga0075177_1022270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 695 | Open in IMG/M |
3300007237|Ga0075177_1051781 | Not Available | 656 | Open in IMG/M |
3300007253|Ga0075182_10006725 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300007321|Ga0102692_1066196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300007327|Ga0075016_1001757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300007327|Ga0075016_1027394 | Not Available | 596 | Open in IMG/M |
3300007327|Ga0075016_1043128 | Not Available | 809 | Open in IMG/M |
3300007526|Ga0075022_1001036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 575 | Open in IMG/M |
3300007526|Ga0075022_1005570 | Not Available | 553 | Open in IMG/M |
3300007526|Ga0075022_1009236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 562 | Open in IMG/M |
3300007526|Ga0075022_1029678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 794 | Open in IMG/M |
3300007602|Ga0099787_1020378 | Not Available | 798 | Open in IMG/M |
3300007642|Ga0102876_1119078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 712 | Open in IMG/M |
3300008055|Ga0108970_11364623 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
3300008648|Ga0103610_100273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
3300008702|Ga0103614_1005141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 791 | Open in IMG/M |
3300008785|Ga0103638_1000597 | Not Available | 836 | Open in IMG/M |
3300008785|Ga0103638_1003214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 575 | Open in IMG/M |
3300008787|Ga0103640_1000369 | Not Available | 871 | Open in IMG/M |
3300008884|Ga0103746_10018082 | Not Available | 834 | Open in IMG/M |
3300008884|Ga0103746_10018237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 831 | Open in IMG/M |
3300009196|Ga0103745_10024164 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 830 | Open in IMG/M |
3300009196|Ga0103745_10024178 | Not Available | 829 | Open in IMG/M |
3300009196|Ga0103745_10043580 | Not Available | 636 | Open in IMG/M |
3300009199|Ga0103748_10033934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300009199|Ga0103748_10050168 | Not Available | 706 | Open in IMG/M |
3300009223|Ga0103850_1014855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 867 | Open in IMG/M |
3300009223|Ga0103850_1016118 | Not Available | 837 | Open in IMG/M |
3300009223|Ga0103850_1016131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 836 | Open in IMG/M |
3300009223|Ga0103850_1016574 | Not Available | 827 | Open in IMG/M |
3300009223|Ga0103850_1018386 | Not Available | 791 | Open in IMG/M |
3300009225|Ga0103851_1031368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 845 | Open in IMG/M |
3300009225|Ga0103851_1031441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 844 | Open in IMG/M |
3300009230|Ga0103855_10039029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 846 | Open in IMG/M |
3300009230|Ga0103855_10039392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 843 | Open in IMG/M |
3300009230|Ga0103855_10040556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 833 | Open in IMG/M |
3300009233|Ga0103856_10040093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300009233|Ga0103856_10098241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 555 | Open in IMG/M |
3300009235|Ga0103857_10041782 | Not Available | 854 | Open in IMG/M |
3300009235|Ga0103857_10044888 | Not Available | 830 | Open in IMG/M |
3300009235|Ga0103857_10046169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 820 | Open in IMG/M |
3300009235|Ga0103857_10047967 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300009235|Ga0103857_10121787 | Not Available | 545 | Open in IMG/M |
3300009239|Ga0103858_10070573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 845 | Open in IMG/M |
3300009239|Ga0103858_10072321 | Not Available | 837 | Open in IMG/M |
3300009239|Ga0103858_10075718 | Not Available | 820 | Open in IMG/M |
3300009239|Ga0103858_10189463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 539 | Open in IMG/M |
3300009243|Ga0103860_10045694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 859 | Open in IMG/M |
3300009243|Ga0103860_10049753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 831 | Open in IMG/M |
3300009243|Ga0103860_10103133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 618 | Open in IMG/M |
3300009243|Ga0103860_10124152 | Not Available | 574 | Open in IMG/M |
3300009247|Ga0103861_10025046 | Not Available | 834 | Open in IMG/M |
3300009247|Ga0103861_10027774 | Not Available | 803 | Open in IMG/M |
3300009249|Ga0103862_1019401 | Not Available | 855 | Open in IMG/M |
3300009249|Ga0103862_1019729 | Not Available | 850 | Open in IMG/M |
3300009249|Ga0103862_1020055 | Not Available | 845 | Open in IMG/M |
3300009249|Ga0103862_1020736 | Not Available | 834 | Open in IMG/M |
3300009249|Ga0103862_1021217 | Not Available | 826 | Open in IMG/M |
3300009249|Ga0103862_1021631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300009249|Ga0103862_1022752 | Not Available | 805 | Open in IMG/M |
3300009252|Ga0103863_10017033 | Not Available | 846 | Open in IMG/M |
3300009252|Ga0103863_10018050 | Not Available | 831 | Open in IMG/M |
3300009257|Ga0103869_10066677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 845 | Open in IMG/M |
3300009257|Ga0103869_10068586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 836 | Open in IMG/M |
3300009257|Ga0103869_10072114 | Not Available | 820 | Open in IMG/M |
3300009257|Ga0103869_10172876 | Not Available | 582 | Open in IMG/M |
3300009261|Ga0103870_1016044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 857 | Open in IMG/M |
3300009261|Ga0103870_1016693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 844 | Open in IMG/M |
3300009295|Ga0103747_10211330 | Not Available | 531 | Open in IMG/M |
3300009337|Ga0103864_1002760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300009352|Ga0103865_1003212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 860 | Open in IMG/M |
3300009387|Ga0103871_1007133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 838 | Open in IMG/M |
3300009387|Ga0103871_1007770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300009404|Ga0103853_1011648 | Not Available | 833 | Open in IMG/M |
3300009579|Ga0115599_1012631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300009579|Ga0115599_1157363 | Not Available | 639 | Open in IMG/M |
3300009580|Ga0115596_1051331 | Not Available | 709 | Open in IMG/M |
3300009581|Ga0115600_1050543 | Not Available | 824 | Open in IMG/M |
3300009581|Ga0115600_1116105 | Not Available | 814 | Open in IMG/M |
3300009581|Ga0115600_1169221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 804 | Open in IMG/M |
3300009581|Ga0115600_1183066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300009582|Ga0115601_1116465 | Not Available | 827 | Open in IMG/M |
3300009582|Ga0115601_1204443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
3300009583|Ga0115598_1066446 | Not Available | 766 | Open in IMG/M |
3300009584|Ga0115597_1018823 | Not Available | 604 | Open in IMG/M |
3300009584|Ga0115597_1215032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 815 | Open in IMG/M |
3300009587|Ga0115602_1002101 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 598 | Open in IMG/M |
3300009587|Ga0115602_1046101 | Not Available | 506 | Open in IMG/M |
3300009587|Ga0115602_1251606 | Not Available | 814 | Open in IMG/M |
3300009649|Ga0105855_1309729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 504 | Open in IMG/M |
3300009660|Ga0105854_1079379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1011 | Open in IMG/M |
3300009834|Ga0131969_101647 | Not Available | 830 | Open in IMG/M |
3300010061|Ga0127462_129103 | Not Available | 787 | Open in IMG/M |
3300010066|Ga0127427_127449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 578 | Open in IMG/M |
3300010067|Ga0127432_150311 | Not Available | 580 | Open in IMG/M |
3300010071|Ga0127477_115606 | Not Available | 628 | Open in IMG/M |
3300010071|Ga0127477_136679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300010075|Ga0127434_157859 | Not Available | 798 | Open in IMG/M |
3300010077|Ga0127437_131421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300010077|Ga0127437_137618 | Not Available | 793 | Open in IMG/M |
3300010080|Ga0127448_141224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 799 | Open in IMG/M |
3300010084|Ga0127461_1013484 | Not Available | 601 | Open in IMG/M |
3300010090|Ga0127471_1027359 | Not Available | 774 | Open in IMG/M |
3300010091|Ga0127485_1027306 | Not Available | 798 | Open in IMG/M |
3300010094|Ga0127480_1029844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 784 | Open in IMG/M |
3300010096|Ga0127473_1120399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 573 | Open in IMG/M |
3300010096|Ga0127473_1122397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300010101|Ga0127481_1025173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 798 | Open in IMG/M |
3300010101|Ga0127481_1026276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 796 | Open in IMG/M |
3300010103|Ga0127500_1104901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 797 | Open in IMG/M |
3300010109|Ga0127497_1069918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 805 | Open in IMG/M |
3300010110|Ga0126316_1058829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
3300010110|Ga0126316_1076803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 612 | Open in IMG/M |
3300010117|Ga0127449_1082285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 797 | Open in IMG/M |
3300010118|Ga0127465_1090214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300010118|Ga0127465_1131980 | Not Available | 652 | Open in IMG/M |
3300010121|Ga0127438_1145009 | Not Available | 552 | Open in IMG/M |
3300010124|Ga0127498_1062326 | Not Available | 609 | Open in IMG/M |
3300010126|Ga0127482_1036106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 800 | Open in IMG/M |
3300010130|Ga0127493_1182172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 800 | Open in IMG/M |
3300010131|Ga0115594_1022662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 598 | Open in IMG/M |
3300010134|Ga0127484_1067263 | Not Available | 781 | Open in IMG/M |
3300010136|Ga0127447_1125015 | Not Available | 707 | Open in IMG/M |
3300010138|Ga0115595_1172145 | Not Available | 624 | Open in IMG/M |
3300010141|Ga0127499_1055468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 643 | Open in IMG/M |
3300010144|Ga0115593_1018048 | Not Available | 792 | Open in IMG/M |
3300010145|Ga0126321_1195896 | Not Available | 813 | Open in IMG/M |
3300010146|Ga0126320_1046145 | Not Available | 813 | Open in IMG/M |
3300010146|Ga0126320_1278010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300010147|Ga0126319_1035450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
3300010147|Ga0126319_1061811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 559 | Open in IMG/M |
3300010147|Ga0126319_1090112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 819 | Open in IMG/M |
3300010152|Ga0126318_10576338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 796 | Open in IMG/M |
3300010152|Ga0126318_10996916 | Not Available | 810 | Open in IMG/M |
3300010152|Ga0126318_11119365 | Not Available | 591 | Open in IMG/M |
3300010154|Ga0127503_10303488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300010305|Ga0129320_153689 | Not Available | 518 | Open in IMG/M |
3300010354|Ga0129333_10055950 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3685 | Open in IMG/M |
3300010854|Ga0126360_1002959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 567 | Open in IMG/M |
3300010856|Ga0126358_1122215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 774 | Open in IMG/M |
3300010857|Ga0126354_1148095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 824 | Open in IMG/M |
3300010857|Ga0126354_1182622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300010857|Ga0126354_1187978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300010857|Ga0126354_1188026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300010857|Ga0126354_1244711 | Not Available | 811 | Open in IMG/M |
3300010859|Ga0126352_1111775 | Not Available | 825 | Open in IMG/M |
3300010859|Ga0126352_1258316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300010861|Ga0126349_1034579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 867 | Open in IMG/M |
3300010861|Ga0126349_1064270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300010861|Ga0126349_1252631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300010862|Ga0126348_1075721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 877 | Open in IMG/M |
3300010862|Ga0126348_1134099 | Not Available | 634 | Open in IMG/M |
3300010862|Ga0126348_1284248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 729 | Open in IMG/M |
3300010866|Ga0126344_1069110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 549 | Open in IMG/M |
3300010869|Ga0126359_1267181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 629 | Open in IMG/M |
3300010869|Ga0126359_1633661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 705 | Open in IMG/M |
3300010895|Ga0138113_182315 | Not Available | 794 | Open in IMG/M |
3300010896|Ga0138111_1157277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 775 | Open in IMG/M |
3300011028|Ga0138577_135481 | Not Available | 779 | Open in IMG/M |
3300011046|Ga0138600_110008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300011055|Ga0138550_105997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300011057|Ga0138544_1039030 | Not Available | 817 | Open in IMG/M |
3300011061|Ga0138534_1052826 | Not Available | 799 | Open in IMG/M |
3300011062|Ga0138582_1091165 | Not Available | 801 | Open in IMG/M |
3300011064|Ga0138525_1138328 | Not Available | 797 | Open in IMG/M |
3300011072|Ga0138563_1128508 | Not Available | 806 | Open in IMG/M |
3300011074|Ga0138559_1119427 | Not Available | 797 | Open in IMG/M |
3300011075|Ga0138555_1081927 | Not Available | 825 | Open in IMG/M |
3300011080|Ga0138568_1091467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 550 | Open in IMG/M |
3300011120|Ga0150983_14092091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 824 | Open in IMG/M |
3300011281|Ga0138295_121388 | Not Available | 528 | Open in IMG/M |
3300011282|Ga0138293_135249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 781 | Open in IMG/M |
3300011288|Ga0138391_108546 | Not Available | 849 | Open in IMG/M |
3300011299|Ga0138294_1021829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 831 | Open in IMG/M |
3300011332|Ga0126317_10569154 | Not Available | 571 | Open in IMG/M |
3300011332|Ga0126317_10570157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 703 | Open in IMG/M |
3300011333|Ga0127502_10363092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 591 | Open in IMG/M |
3300011333|Ga0127502_10587823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
3300011333|Ga0127502_10895450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 778 | Open in IMG/M |
3300011340|Ga0151652_10407272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 595 | Open in IMG/M |
3300011340|Ga0151652_10547622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 822 | Open in IMG/M |
3300011340|Ga0151652_10597707 | Not Available | 807 | Open in IMG/M |
3300011340|Ga0151652_10844208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 758 | Open in IMG/M |
3300011340|Ga0151652_11149189 | Not Available | 505 | Open in IMG/M |
3300011340|Ga0151652_12859999 | Not Available | 813 | Open in IMG/M |
3300011340|Ga0151652_14115620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 583 | Open in IMG/M |
3300012040|Ga0137461_1248896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 518 | Open in IMG/M |
3300012212|Ga0150985_100792461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 571 | Open in IMG/M |
3300012212|Ga0150985_110248360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 522 | Open in IMG/M |
3300012212|Ga0150985_110345187 | Not Available | 805 | Open in IMG/M |
3300012212|Ga0150985_120751669 | Not Available | 822 | Open in IMG/M |
3300012212|Ga0150985_122367311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 519 | Open in IMG/M |
3300012224|Ga0134028_1111718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 516 | Open in IMG/M |
3300012364|Ga0134027_1066500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 668 | Open in IMG/M |
3300012372|Ga0134037_1203624 | Not Available | 782 | Open in IMG/M |
3300012373|Ga0134042_1194693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300012377|Ga0134029_1016963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300012377|Ga0134029_1027194 | Not Available | 812 | Open in IMG/M |
3300012378|Ga0134025_1060547 | Not Available | 694 | Open in IMG/M |
3300012379|Ga0134058_1198032 | Not Available | 836 | Open in IMG/M |
3300012380|Ga0134047_1040513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 777 | Open in IMG/M |
3300012380|Ga0134047_1043829 | Not Available | 679 | Open in IMG/M |
3300012382|Ga0134038_1063076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 867 | Open in IMG/M |
3300012383|Ga0134033_1167677 | Not Available | 812 | Open in IMG/M |
3300012390|Ga0134054_1086144 | Not Available | 639 | Open in IMG/M |
3300012390|Ga0134054_1265256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 699 | Open in IMG/M |
3300012391|Ga0134035_1029501 | Not Available | 788 | Open in IMG/M |
3300012392|Ga0134043_1061746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
3300012393|Ga0134052_1136793 | Not Available | 569 | Open in IMG/M |
3300012393|Ga0134052_1287267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 691 | Open in IMG/M |
3300012393|Ga0134052_1301125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300012395|Ga0134044_1276969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 725 | Open in IMG/M |
3300012397|Ga0134056_1048513 | Not Available | 809 | Open in IMG/M |
3300012397|Ga0134056_1082128 | Not Available | 831 | Open in IMG/M |
3300012398|Ga0134051_1099543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300012398|Ga0134051_1323354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 592 | Open in IMG/M |
3300012399|Ga0134061_1026261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300012400|Ga0134048_1191137 | Not Available | 808 | Open in IMG/M |
3300012401|Ga0134055_1250411 | Not Available | 822 | Open in IMG/M |
3300012401|Ga0134055_1391399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300012402|Ga0134059_1053584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 618 | Open in IMG/M |
3300012403|Ga0134049_1176934 | Not Available | 749 | Open in IMG/M |
3300012403|Ga0134049_1339081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
3300012405|Ga0134041_1106610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 775 | Open in IMG/M |
3300012405|Ga0134041_1334769 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300012407|Ga0134050_1062020 | Not Available | 799 | Open in IMG/M |
3300012409|Ga0134045_1469085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 786 | Open in IMG/M |
3300012410|Ga0134060_1222351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 831 | Open in IMG/M |
3300012411|Ga0153880_1372731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 821 | Open in IMG/M |
3300012469|Ga0150984_105614918 | Not Available | 592 | Open in IMG/M |
3300012469|Ga0150984_106355751 | Not Available | 816 | Open in IMG/M |
3300012469|Ga0150984_109660854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300012471|Ga0129334_1006661 | Not Available | 809 | Open in IMG/M |
3300012686|Ga0157560_1059294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300012689|Ga0157565_1138443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300012690|Ga0157575_157387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 832 | Open in IMG/M |
3300012691|Ga0157569_1053320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 615 | Open in IMG/M |
3300012699|Ga0157593_1130223 | Not Available | 883 | Open in IMG/M |
3300012703|Ga0157572_1104904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 832 | Open in IMG/M |
3300012707|Ga0157623_1190754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300012724|Ga0157611_1036480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 806 | Open in IMG/M |
3300012747|Ga0157564_1089083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 839 | Open in IMG/M |
3300012754|Ga0138278_1069522 | Not Available | 609 | Open in IMG/M |
3300012755|Ga0138281_1131450 | Not Available | 799 | Open in IMG/M |
3300012757|Ga0157628_1002409 | Not Available | 813 | Open in IMG/M |
3300012761|Ga0138288_1085781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 820 | Open in IMG/M |
3300012761|Ga0138288_1136755 | Not Available | 873 | Open in IMG/M |
3300012764|Ga0157624_1102211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 565 | Open in IMG/M |
3300012768|Ga0138276_1256837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 776 | Open in IMG/M |
3300012769|Ga0138279_1167324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 819 | Open in IMG/M |
3300012772|Ga0138287_1093386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 819 | Open in IMG/M |
3300012775|Ga0138280_1052218 | Not Available | 512 | Open in IMG/M |
3300012776|Ga0138275_1358487 | Not Available | 673 | Open in IMG/M |
3300012777|Ga0138292_1117756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 704 | Open in IMG/M |
3300012778|Ga0138269_1318988 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300012781|Ga0138286_1066449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300012962|Ga0129335_1038064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300012962|Ga0129335_1061255 | Not Available | 746 | Open in IMG/M |
3300012963|Ga0129340_1258432 | Not Available | 809 | Open in IMG/M |
3300012967|Ga0129343_1051912 | Not Available | 813 | Open in IMG/M |
3300013043|Ga0154018_103206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 805 | Open in IMG/M |
3300013043|Ga0154018_107640 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300013043|Ga0154018_120495 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300013044|Ga0154019_104155 | Not Available | 781 | Open in IMG/M |
3300013045|Ga0154016_103219 | Not Available | 555 | Open in IMG/M |
3300013046|Ga0079038_111975 | Not Available | 621 | Open in IMG/M |
3300013052|Ga0154014_108711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 510 | Open in IMG/M |
3300013052|Ga0154014_145961 | Not Available | 555 | Open in IMG/M |
3300013052|Ga0154014_162060 | Not Available | 800 | Open in IMG/M |
3300013059|Ga0154012_173746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 828 | Open in IMG/M |
3300013059|Ga0154012_174473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300013068|Ga0157563_1091432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300013078|Ga0153914_1031402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 835 | Open in IMG/M |
3300013078|Ga0153914_1137802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300013080|Ga0153913_1367550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 802 | Open in IMG/M |
3300013232|Ga0170573_10668365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1007 | Open in IMG/M |
3300013295|Ga0170791_15339077 | Not Available | 889 | Open in IMG/M |
3300015197|Ga0167638_1054412 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300016678|Ga0180045_143081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 820 | Open in IMG/M |
3300016680|Ga0180046_108439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 707 | Open in IMG/M |
3300016682|Ga0180044_1051675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 632 | Open in IMG/M |
3300016688|Ga0180039_1067141 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 835 | Open in IMG/M |
3300016699|Ga0180058_1068864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 558 | Open in IMG/M |
3300016705|Ga0181507_1018262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 633 | Open in IMG/M |
3300016728|Ga0181500_1198936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 826 | Open in IMG/M |
3300016733|Ga0182042_1120420 | Not Available | 816 | Open in IMG/M |
3300016734|Ga0182092_1342324 | Not Available | 798 | Open in IMG/M |
3300016736|Ga0182049_1232857 | Not Available | 797 | Open in IMG/M |
3300016754|Ga0182072_1035575 | Not Available | 808 | Open in IMG/M |
3300016766|Ga0182091_1082964 | Not Available | 805 | Open in IMG/M |
3300018549|Ga0188832_100582 | Not Available | 811 | Open in IMG/M |
3300018610|Ga0188884_1006126 | Not Available | 817 | Open in IMG/M |
3300019158|Ga0184580_124020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300019191|Ga0180035_1049864 | Not Available | 717 | Open in IMG/M |
3300019198|Ga0180033_127252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300019199|Ga0187789_1113438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300019199|Ga0187789_1136771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 615 | Open in IMG/M |
3300019199|Ga0187789_1137891 | Not Available | 570 | Open in IMG/M |
3300019199|Ga0187789_1196027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 824 | Open in IMG/M |
3300019199|Ga0187789_1203214 | Not Available | 719 | Open in IMG/M |
3300019199|Ga0187789_1216354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300019200|Ga0180036_1056776 | Not Available | 823 | Open in IMG/M |
3300019201|Ga0180032_1038877 | Not Available | 810 | Open in IMG/M |
3300019201|Ga0180032_1059998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 703 | Open in IMG/M |
3300019201|Ga0180032_1105807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019201|Ga0180032_1140408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300019205|Ga0179940_1145367 | Not Available | 820 | Open in IMG/M |
3300019208|Ga0180110_1033754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 812 | Open in IMG/M |
3300019208|Ga0180110_1035077 | Not Available | 810 | Open in IMG/M |
3300019208|Ga0180110_1183874 | Not Available | 675 | Open in IMG/M |
3300019209|Ga0179951_1175207 | Not Available | 695 | Open in IMG/M |
3300019211|Ga0187799_1004179 | Not Available | 556 | Open in IMG/M |
3300019211|Ga0187799_1065824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 575 | Open in IMG/M |
3300019211|Ga0187799_1158596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 750 | Open in IMG/M |
3300019211|Ga0187799_1184107 | Not Available | 536 | Open in IMG/M |
3300019211|Ga0187799_1270429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
3300019212|Ga0180106_1011942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300019212|Ga0180106_1120522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 706 | Open in IMG/M |
3300019212|Ga0180106_1258650 | Not Available | 809 | Open in IMG/M |
3300019212|Ga0180106_1332329 | Not Available | 779 | Open in IMG/M |
3300019213|Ga0179950_1162529 | Not Available | 807 | Open in IMG/M |
3300019215|Ga0179945_1161842 | Not Available | 505 | Open in IMG/M |
3300019216|Ga0179939_1092704 | Not Available | 570 | Open in IMG/M |
3300019221|Ga0179941_1082789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 820 | Open in IMG/M |
3300019225|Ga0179949_1071399 | Not Available | 721 | Open in IMG/M |
3300019225|Ga0179949_1191352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019228|Ga0180119_1030740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 790 | Open in IMG/M |
3300019228|Ga0180119_1046778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 783 | Open in IMG/M |
3300019228|Ga0180119_1157792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 836 | Open in IMG/M |
3300019228|Ga0180119_1183839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 565 | Open in IMG/M |
3300019229|Ga0180116_1170829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 804 | Open in IMG/M |
3300019231|Ga0179935_1038689 | Not Available | 823 | Open in IMG/M |
3300019232|Ga0180114_1016710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300019233|Ga0184645_1093024 | Not Available | 666 | Open in IMG/M |
3300019233|Ga0184645_1176705 | Not Available | 546 | Open in IMG/M |
3300019234|Ga0172288_1207612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 537 | Open in IMG/M |
3300019238|Ga0180112_1083482 | Not Available | 693 | Open in IMG/M |
3300019238|Ga0180112_1187868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 735 | Open in IMG/M |
3300019241|Ga0187793_1026502 | Not Available | 607 | Open in IMG/M |
3300019241|Ga0187793_1098578 | Not Available | 778 | Open in IMG/M |
3300019241|Ga0187793_1098708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 604 | Open in IMG/M |
3300019241|Ga0187793_1104441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 683 | Open in IMG/M |
3300019241|Ga0187793_1132528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 619 | Open in IMG/M |
3300019241|Ga0187793_1145272 | Not Available | 740 | Open in IMG/M |
3300019241|Ga0187793_1148324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 815 | Open in IMG/M |
3300019241|Ga0187793_1153197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
3300019241|Ga0187793_1173016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 699 | Open in IMG/M |
3300019241|Ga0187793_1325110 | Not Available | 627 | Open in IMG/M |
3300019241|Ga0187793_1326533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 739 | Open in IMG/M |
3300019241|Ga0187793_1365655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 815 | Open in IMG/M |
3300019241|Ga0187793_1467017 | Not Available | 773 | Open in IMG/M |
3300019244|Ga0180111_1003401 | Not Available | 814 | Open in IMG/M |
3300019244|Ga0180111_1052705 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300019244|Ga0180111_1080154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300019244|Ga0180111_1111576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 722 | Open in IMG/M |
3300019244|Ga0180111_1201721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 695 | Open in IMG/M |
3300019245|Ga0187791_1061334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 715 | Open in IMG/M |
3300019245|Ga0187791_1109415 | Not Available | 686 | Open in IMG/M |
3300019245|Ga0187791_1112557 | Not Available | 568 | Open in IMG/M |
3300019245|Ga0187791_1130524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019245|Ga0187791_1207985 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 787 | Open in IMG/M |
3300019245|Ga0187791_1210298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300019245|Ga0187791_1239764 | Not Available | 569 | Open in IMG/M |
3300019245|Ga0187791_1254573 | Not Available | 808 | Open in IMG/M |
3300019245|Ga0187791_1255385 | Not Available | 571 | Open in IMG/M |
3300019245|Ga0187791_1268395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 509 | Open in IMG/M |
3300019245|Ga0187791_1293012 | Not Available | 564 | Open in IMG/M |
3300019245|Ga0187791_1306918 | Not Available | 693 | Open in IMG/M |
3300019245|Ga0187791_1406989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 681 | Open in IMG/M |
3300019245|Ga0187791_1490477 | Not Available | 802 | Open in IMG/M |
3300019245|Ga0187791_1491170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 756 | Open in IMG/M |
3300019247|Ga0179937_1273644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 585 | Open in IMG/M |
3300019247|Ga0179937_1352272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 574 | Open in IMG/M |
3300019248|Ga0180117_1277740 | Not Available | 1096 | Open in IMG/M |
3300019248|Ga0180117_1406836 | Not Available | 806 | Open in IMG/M |
3300019249|Ga0184648_1196753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019249|Ga0184648_1389811 | Not Available | 795 | Open in IMG/M |
3300019249|Ga0184648_1396464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 576 | Open in IMG/M |
3300019250|Ga0187790_1031091 | Not Available | 772 | Open in IMG/M |
3300019250|Ga0187790_1032053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300019250|Ga0187790_1070194 | Not Available | 569 | Open in IMG/M |
3300019250|Ga0187790_1130124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 721 | Open in IMG/M |
3300019250|Ga0187790_1278065 | Not Available | 608 | Open in IMG/M |
3300019250|Ga0187790_1515950 | Not Available | 602 | Open in IMG/M |
3300019250|Ga0187790_1516312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300019251|Ga0187795_1241290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 797 | Open in IMG/M |
3300019252|Ga0172286_1128282 | Not Available | 593 | Open in IMG/M |
3300019252|Ga0172286_1575701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 689 | Open in IMG/M |
3300019254|Ga0184641_1159135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300019254|Ga0184641_1284322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 685 | Open in IMG/M |
3300019255|Ga0184643_1016971 | Not Available | 540 | Open in IMG/M |
3300019255|Ga0184643_1102985 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 788 | Open in IMG/M |
3300019255|Ga0184643_1224327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300019255|Ga0184643_1450821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 559 | Open in IMG/M |
3300019255|Ga0184643_1483960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 539 | Open in IMG/M |
3300019257|Ga0180115_1065666 | Not Available | 626 | Open in IMG/M |
3300019257|Ga0180115_1232962 | Not Available | 695 | Open in IMG/M |
3300019257|Ga0180115_1275745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300019257|Ga0180115_1433649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 778 | Open in IMG/M |
3300019258|Ga0181504_1047795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300019259|Ga0184646_1115780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300019259|Ga0184646_1352276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 570 | Open in IMG/M |
3300019260|Ga0181506_1428572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 829 | Open in IMG/M |
3300019263|Ga0184647_1153131 | Not Available | 628 | Open in IMG/M |
3300019264|Ga0187796_1016823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 758 | Open in IMG/M |
3300019264|Ga0187796_1179213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019265|Ga0187792_1010282 | Not Available | 757 | Open in IMG/M |
3300019265|Ga0187792_1062911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300019265|Ga0187792_1108545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 821 | Open in IMG/M |
3300019265|Ga0187792_1111267 | Not Available | 619 | Open in IMG/M |
3300019265|Ga0187792_1466986 | Not Available | 816 | Open in IMG/M |
3300019265|Ga0187792_1467545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 581 | Open in IMG/M |
3300019265|Ga0187792_1518908 | Not Available | 784 | Open in IMG/M |
3300019265|Ga0187792_1670893 | Not Available | 702 | Open in IMG/M |
3300019267|Ga0182069_1550896 | Not Available | 799 | Open in IMG/M |
3300019268|Ga0181514_1302546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 509 | Open in IMG/M |
3300019269|Ga0184644_1018121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 511 | Open in IMG/M |
3300019269|Ga0184644_1140312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300019269|Ga0184644_1162112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300019269|Ga0184644_1561824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 569 | Open in IMG/M |
3300019270|Ga0181512_1733983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 820 | Open in IMG/M |
3300019273|Ga0187794_1191119 | Not Available | 552 | Open in IMG/M |
3300019273|Ga0187794_1729646 | Not Available | 731 | Open in IMG/M |
3300019277|Ga0182081_1414865 | Not Available | 808 | Open in IMG/M |
3300019278|Ga0187800_1232521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300019279|Ga0184642_1125711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 583 | Open in IMG/M |
3300019279|Ga0184642_1160229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 584 | Open in IMG/M |
3300019279|Ga0184642_1223338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300019281|Ga0182077_1638096 | Not Available | 798 | Open in IMG/M |
3300020014|Ga0182044_1308742 | Not Available | 798 | Open in IMG/M |
3300020063|Ga0180118_1240710 | Not Available | 541 | Open in IMG/M |
3300020063|Ga0180118_1249981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 727 | Open in IMG/M |
3300020064|Ga0180107_1048060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 604 | Open in IMG/M |
3300020065|Ga0180113_1142737 | Not Available | 532 | Open in IMG/M |
3300020067|Ga0180109_1207337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 646 | Open in IMG/M |
3300020067|Ga0180109_1294984 | Not Available | 703 | Open in IMG/M |
3300020067|Ga0180109_1346602 | Not Available | 791 | Open in IMG/M |
3300020068|Ga0184649_1466547 | Not Available | 699 | Open in IMG/M |
3300020069|Ga0197907_10868337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300020070|Ga0206356_10089135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300020070|Ga0206356_10324389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 622 | Open in IMG/M |
3300020070|Ga0206356_10624353 | Not Available | 808 | Open in IMG/M |
3300020070|Ga0206356_11586386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
3300020075|Ga0206349_1528926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 819 | Open in IMG/M |
3300020075|Ga0206349_1919198 | Not Available | 804 | Open in IMG/M |
3300020075|Ga0206349_1983355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300020076|Ga0206355_1014171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 824 | Open in IMG/M |
3300020076|Ga0206355_1223512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 789 | Open in IMG/M |
3300020076|Ga0206355_1432055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 651 | Open in IMG/M |
3300020078|Ga0206352_10675235 | Not Available | 836 | Open in IMG/M |
3300020078|Ga0206352_10847518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 825 | Open in IMG/M |
3300020080|Ga0206350_10723501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 815 | Open in IMG/M |
3300020080|Ga0206350_11199828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300020159|Ga0211734_10525328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6631 | Open in IMG/M |
3300020610|Ga0154015_1352082 | Not Available | 582 | Open in IMG/M |
3300020610|Ga0154015_1352812 | Not Available | 586 | Open in IMG/M |
3300020610|Ga0154015_1454081 | Not Available | 714 | Open in IMG/M |
3300021151|Ga0179584_1002334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300021151|Ga0179584_1195440 | Not Available | 783 | Open in IMG/M |
3300021257|Ga0210329_110538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300021258|Ga0210345_113787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300021258|Ga0210345_145963 | Not Available | 806 | Open in IMG/M |
3300021267|Ga0210353_108348 | Not Available | 808 | Open in IMG/M |
3300021268|Ga0210294_108936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300021269|Ga0210356_184170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 574 | Open in IMG/M |
3300021270|Ga0210360_104205 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300021270|Ga0210360_168898 | Not Available | 812 | Open in IMG/M |
3300021273|Ga0210340_1055452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 552 | Open in IMG/M |
3300021273|Ga0210340_1072860 | Not Available | 588 | Open in IMG/M |
3300021274|Ga0210327_144236 | Not Available | 815 | Open in IMG/M |
3300021282|Ga0210303_1040864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 577 | Open in IMG/M |
3300021283|Ga0210357_1025290 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300021283|Ga0210357_1033738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 919 | Open in IMG/M |
3300021283|Ga0210357_1046699 | Not Available | 827 | Open in IMG/M |
3300021283|Ga0210357_1066894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 591 | Open in IMG/M |
3300021283|Ga0210357_1082684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
3300021284|Ga0210299_138866 | Not Available | 780 | Open in IMG/M |
3300021286|Ga0179583_1026051 | Not Available | 575 | Open in IMG/M |
3300021286|Ga0179583_1029711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300021286|Ga0179583_1033041 | Not Available | 816 | Open in IMG/M |
3300021286|Ga0179583_1069692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 787 | Open in IMG/M |
3300021286|Ga0179583_1093290 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300021287|Ga0210338_187285 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300021292|Ga0210355_1001928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300021292|Ga0210355_1006454 | Not Available | 810 | Open in IMG/M |
3300021294|Ga0210325_1049988 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 685 | Open in IMG/M |
3300021294|Ga0210325_1089473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300021302|Ga0210328_1046169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 757 | Open in IMG/M |
3300021307|Ga0179585_1000491 | Not Available | 766 | Open in IMG/M |
3300021307|Ga0179585_1054032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 709 | Open in IMG/M |
3300021307|Ga0179585_1073473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300021314|Ga0210370_1098544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 619 | Open in IMG/M |
3300021315|Ga0179958_1006382 | Not Available | 807 | Open in IMG/M |
3300021315|Ga0179958_1168788 | Not Available | 710 | Open in IMG/M |
3300021316|Ga0210351_1346438 | Not Available | 732 | Open in IMG/M |
3300021317|Ga0210309_1165861 | Not Available | 814 | Open in IMG/M |
3300021323|Ga0210295_1176534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 543 | Open in IMG/M |
3300021325|Ga0210301_1233841 | Not Available | 808 | Open in IMG/M |
3300021329|Ga0210362_1189058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 721 | Open in IMG/M |
3300021331|Ga0210347_1084265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300021333|Ga0210324_1037381 | Not Available | 592 | Open in IMG/M |
3300021333|Ga0210324_1331515 | Not Available | 511 | Open in IMG/M |
3300021333|Ga0210324_1376167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
3300021336|Ga0210307_1118661 | Not Available | 881 | Open in IMG/M |
3300021336|Ga0210307_1391277 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300021602|Ga0194060_10304470 | Not Available | 786 | Open in IMG/M |
3300021849|Ga0210304_1091496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300021849|Ga0210304_1091733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 500 | Open in IMG/M |
3300021852|Ga0210317_1158564 | Not Available | 806 | Open in IMG/M |
3300021853|Ga0210323_1000051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300021853|Ga0210323_1013760 | Not Available | 824 | Open in IMG/M |
3300021853|Ga0210323_1091753 | Not Available | 565 | Open in IMG/M |
3300021853|Ga0210323_1110211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300021853|Ga0210323_1124078 | Not Available | 571 | Open in IMG/M |
3300021855|Ga0213854_1045478 | Not Available | 792 | Open in IMG/M |
3300021855|Ga0213854_1148403 | Not Available | 633 | Open in IMG/M |
3300021855|Ga0213854_1289087 | Not Available | 544 | Open in IMG/M |
3300021856|Ga0213850_1190645 | Not Available | 795 | Open in IMG/M |
3300021857|Ga0213849_1154416 | Not Available | 834 | Open in IMG/M |
3300021858|Ga0213852_1427172 | Not Available | 815 | Open in IMG/M |
3300021859|Ga0210334_11124455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 763 | Open in IMG/M |
3300021860|Ga0213851_1029242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 666 | Open in IMG/M |
3300021860|Ga0213851_1448690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 568 | Open in IMG/M |
3300021860|Ga0213851_1449686 | Not Available | 650 | Open in IMG/M |
3300021860|Ga0213851_1820740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300021861|Ga0213853_10730074 | Not Available | 807 | Open in IMG/M |
3300021929|Ga0213845_1006679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 819 | Open in IMG/M |
3300021929|Ga0213845_1071832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 800 | Open in IMG/M |
3300021929|Ga0213845_1175638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 806 | Open in IMG/M |
3300021929|Ga0213845_1176680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300021938|Ga0213847_1076007 | Not Available | 815 | Open in IMG/M |
3300021938|Ga0213847_1080382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 837 | Open in IMG/M |
3300021938|Ga0213847_1094289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 580 | Open in IMG/M |
3300021938|Ga0213847_1203589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300021947|Ga0213856_1046634 | Not Available | 800 | Open in IMG/M |
3300021947|Ga0213856_1138262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 827 | Open in IMG/M |
3300021947|Ga0213856_1217620 | Not Available | 599 | Open in IMG/M |
3300021967|Ga0213848_1054807 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 566 | Open in IMG/M |
3300021967|Ga0213848_1097035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300021969|Ga0232063_1150340 | Not Available | 811 | Open in IMG/M |
3300021970|Ga0232057_1146079 | Not Available | 819 | Open in IMG/M |
3300022141|Ga0213933_111487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300022141|Ga0213933_111659 | Not Available | 812 | Open in IMG/M |
3300022144|Ga0213855_1030310 | Not Available | 792 | Open in IMG/M |
3300022144|Ga0213855_1121591 | Not Available | 779 | Open in IMG/M |
3300022147|Ga0213930_106789 | Not Available | 807 | Open in IMG/M |
3300022147|Ga0213930_115518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 575 | Open in IMG/M |
3300022151|Ga0232064_116146 | Not Available | 804 | Open in IMG/M |
3300022154|Ga0213929_1010774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300022154|Ga0213929_1012323 | Not Available | 770 | Open in IMG/M |
3300022154|Ga0213929_1025151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 584 | Open in IMG/M |
3300022156|Ga0213934_1033450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 697 | Open in IMG/M |
3300022156|Ga0213934_1037801 | Not Available | 660 | Open in IMG/M |
3300022161|Ga0213931_1042297 | Not Available | 550 | Open in IMG/M |
3300022161|Ga0213931_1049746 | Not Available | 515 | Open in IMG/M |
3300022166|Ga0213932_1031102 | Not Available | 779 | Open in IMG/M |
3300022166|Ga0213932_1038936 | Not Available | 695 | Open in IMG/M |
3300022171|Ga0213857_1013308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 822 | Open in IMG/M |
3300022171|Ga0213857_1014015 | Not Available | 808 | Open in IMG/M |
3300022171|Ga0213857_1014288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 803 | Open in IMG/M |
3300022185|Ga0079039_1279275 | Not Available | 533 | Open in IMG/M |
3300022195|Ga0222625_1166924 | Not Available | 663 | Open in IMG/M |
3300022222|Ga0226658_10177212 | Not Available | 974 | Open in IMG/M |
3300022372|Ga0210293_113382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300022373|Ga0210319_1009974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300022385|Ga0210376_1024531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 856 | Open in IMG/M |
3300022467|Ga0224712_10244001 | Not Available | 828 | Open in IMG/M |
3300022498|Ga0242644_1011172 | Not Available | 808 | Open in IMG/M |
3300022498|Ga0242644_1011215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300022499|Ga0242641_1010772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300022499|Ga0242641_1010814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300022499|Ga0242641_1031200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 585 | Open in IMG/M |
3300022502|Ga0242646_1008778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300022503|Ga0242650_1006099 | Not Available | 811 | Open in IMG/M |
3300022504|Ga0242642_1024331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 844 | Open in IMG/M |
3300022504|Ga0242642_1034803 | Not Available | 741 | Open in IMG/M |
3300022504|Ga0242642_1051925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 641 | Open in IMG/M |
3300022504|Ga0242642_1064465 | Not Available | 592 | Open in IMG/M |
3300022505|Ga0242647_1011516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 799 | Open in IMG/M |
3300022506|Ga0242648_1022935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 814 | Open in IMG/M |
3300022506|Ga0242648_1024155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300022506|Ga0242648_1029495 | Not Available | 753 | Open in IMG/M |
3300022507|Ga0222729_1016858 | Not Available | 829 | Open in IMG/M |
3300022507|Ga0222729_1017804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 815 | Open in IMG/M |
3300022507|Ga0222729_1030445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 682 | Open in IMG/M |
3300022510|Ga0242652_1013905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300022510|Ga0242652_1035447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 589 | Open in IMG/M |
3300022511|Ga0242651_1011801 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 826 | Open in IMG/M |
3300022528|Ga0242669_1035922 | Not Available | 796 | Open in IMG/M |
3300022529|Ga0242668_1052500 | Not Available | 731 | Open in IMG/M |
3300022530|Ga0242658_1062238 | Not Available | 818 | Open in IMG/M |
3300022530|Ga0242658_1080057 | Not Available | 749 | Open in IMG/M |
3300022530|Ga0242658_1123191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 644 | Open in IMG/M |
3300022530|Ga0242658_1127813 | Not Available | 636 | Open in IMG/M |
3300022531|Ga0242660_1068560 | Not Available | 812 | Open in IMG/M |
3300022531|Ga0242660_1071090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 802 | Open in IMG/M |
3300022531|Ga0242660_1072622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
3300022531|Ga0242660_1090278 | Not Available | 735 | Open in IMG/M |
3300022645|Ga0232058_1428658 | Not Available | 811 | Open in IMG/M |
3300022652|Ga0232059_1042497 | Not Available | 817 | Open in IMG/M |
3300022708|Ga0242670_1019051 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300022708|Ga0242670_1019052 | Not Available | 805 | Open in IMG/M |
3300022708|Ga0242670_1056399 | Not Available | 571 | Open in IMG/M |
3300022709|Ga0222756_1024020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 800 | Open in IMG/M |
3300022712|Ga0242653_1013140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1064 | Open in IMG/M |
3300022712|Ga0242653_1029676 | Not Available | 812 | Open in IMG/M |
3300022713|Ga0242677_1005541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1227 | Open in IMG/M |
3300022713|Ga0242677_1019862 | Not Available | 821 | Open in IMG/M |
3300022714|Ga0242671_1030202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 814 | Open in IMG/M |
3300022718|Ga0242675_1095671 | Not Available | 565 | Open in IMG/M |
3300022720|Ga0242672_1029518 | Not Available | 821 | Open in IMG/M |
3300022720|Ga0242672_1030293 | Not Available | 815 | Open in IMG/M |
3300022720|Ga0242672_1031077 | Not Available | 809 | Open in IMG/M |
3300022720|Ga0242672_1031084 | Not Available | 809 | Open in IMG/M |
3300022720|Ga0242672_1058211 | Not Available | 669 | Open in IMG/M |
3300022721|Ga0242666_1057848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 830 | Open in IMG/M |
3300022721|Ga0242666_1060809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 815 | Open in IMG/M |
3300022721|Ga0242666_1074351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 753 | Open in IMG/M |
3300022721|Ga0242666_1079755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 732 | Open in IMG/M |
3300022721|Ga0242666_1144316 | Not Available | 579 | Open in IMG/M |
3300022722|Ga0242657_1069928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300022722|Ga0242657_1071586 | Not Available | 805 | Open in IMG/M |
3300022722|Ga0242657_1073391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300022724|Ga0242665_10114621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300022724|Ga0242665_10118816 | Not Available | 804 | Open in IMG/M |
3300022724|Ga0242665_10119267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300022724|Ga0242665_10189017 | Not Available | 672 | Open in IMG/M |
3300022726|Ga0242654_10137646 | Not Available | 804 | Open in IMG/M |
3300022726|Ga0242654_10138018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300022726|Ga0242654_10140649 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300022726|Ga0242654_10425745 | Not Available | 514 | Open in IMG/M |
3300023691|Ga0228704_108629 | Not Available | 794 | Open in IMG/M |
3300023691|Ga0228704_124127 | Not Available | 506 | Open in IMG/M |
3300023697|Ga0228706_1019808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 819 | Open in IMG/M |
3300023697|Ga0228706_1019865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
3300023697|Ga0228706_1020803 | Not Available | 800 | Open in IMG/M |
3300023697|Ga0228706_1027927 | Not Available | 696 | Open in IMG/M |
3300023700|Ga0228707_1069418 | Not Available | 514 | Open in IMG/M |
3300023703|Ga0228708_1030052 | Not Available | 811 | Open in IMG/M |
3300023703|Ga0228708_1030417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300023703|Ga0228708_1044729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 661 | Open in IMG/M |
3300023703|Ga0228708_1074573 | Not Available | 514 | Open in IMG/M |
3300023706|Ga0232123_1052718 | Not Available | 812 | Open in IMG/M |
3300023708|Ga0228709_1052377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 834 | Open in IMG/M |
3300023708|Ga0228709_1054241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300023708|Ga0228709_1054396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300023708|Ga0228709_1055176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300023708|Ga0228709_1064781 | Not Available | 741 | Open in IMG/M |
3300023708|Ga0228709_1071950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 701 | Open in IMG/M |
3300023708|Ga0228709_1083555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 646 | Open in IMG/M |
3300023708|Ga0228709_1110606 | Not Available | 558 | Open in IMG/M |
3300023709|Ga0232122_1075236 | Not Available | 809 | Open in IMG/M |
(restricted) 3300024054|Ga0233425_10017412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7116 | Open in IMG/M |
3300024346|Ga0244775_10246639 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1489 | Open in IMG/M |
3300024480|Ga0255223_1079597 | Not Available | 565 | Open in IMG/M |
3300024481|Ga0256330_1058344 | Not Available | 821 | Open in IMG/M |
3300024481|Ga0256330_1059862 | Not Available | 810 | Open in IMG/M |
3300024481|Ga0256330_1069789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 745 | Open in IMG/M |
3300024481|Ga0256330_1092809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 638 | Open in IMG/M |
3300024481|Ga0256330_1096000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 626 | Open in IMG/M |
3300024481|Ga0256330_1127038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 538 | Open in IMG/M |
3300024482|Ga0255265_1102034 | Not Available | 550 | Open in IMG/M |
3300024483|Ga0255224_1055390 | Not Available | 818 | Open in IMG/M |
3300024483|Ga0255224_1067494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 742 | Open in IMG/M |
3300024484|Ga0256332_1061453 | Not Available | 804 | Open in IMG/M |
3300024484|Ga0256332_1080449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 696 | Open in IMG/M |
3300024484|Ga0256332_1118979 | Not Available | 565 | Open in IMG/M |
3300024485|Ga0256318_1086764 | Not Available | 669 | Open in IMG/M |
3300024495|Ga0255164_1030495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 887 | Open in IMG/M |
3300024513|Ga0255144_1043406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 760 | Open in IMG/M |
3300024531|Ga0255228_1053867 | Not Available | 808 | Open in IMG/M |
3300024532|Ga0256352_1044095 | Not Available | 799 | Open in IMG/M |
3300024532|Ga0256352_1048645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 759 | Open in IMG/M |
3300024532|Ga0256352_1051121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 740 | Open in IMG/M |
3300024533|Ga0256299_1048120 | Not Available | 840 | Open in IMG/M |
3300024533|Ga0256299_1087347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 620 | Open in IMG/M |
3300024534|Ga0256357_1049199 | Not Available | 820 | Open in IMG/M |
3300024534|Ga0256357_1114774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 522 | Open in IMG/M |
3300024535|Ga0255303_1052697 | Not Available | 809 | Open in IMG/M |
3300024536|Ga0256338_1067946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300024537|Ga0255225_1037922 | Not Available | 808 | Open in IMG/M |
3300024537|Ga0255225_1038016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300024537|Ga0255225_1046126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 735 | Open in IMG/M |
3300024539|Ga0255231_1045460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 703 | Open in IMG/M |
3300024540|Ga0255300_1086999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 523 | Open in IMG/M |
3300024541|Ga0256343_1040319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 832 | Open in IMG/M |
3300024541|Ga0256343_1042982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300024541|Ga0256343_1052751 | Not Available | 718 | Open in IMG/M |
3300024542|Ga0256350_1043391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 800 | Open in IMG/M |
3300024542|Ga0256350_1046774 | Not Available | 769 | Open in IMG/M |
3300024542|Ga0256350_1047326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 765 | Open in IMG/M |
3300024542|Ga0256350_1069637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 626 | Open in IMG/M |
3300024542|Ga0256350_1084094 | Not Available | 568 | Open in IMG/M |
3300024542|Ga0256350_1100221 | Not Available | 519 | Open in IMG/M |
3300024543|Ga0256348_1038471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300024543|Ga0256348_1039167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 801 | Open in IMG/M |
3300024543|Ga0256348_1040732 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 785 | Open in IMG/M |
3300024543|Ga0256348_1073384 | Not Available | 578 | Open in IMG/M |
3300024543|Ga0256348_1085479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 535 | Open in IMG/M |
3300024544|Ga0255294_1042572 | Not Available | 812 | Open in IMG/M |
3300024544|Ga0255294_1043579 | Not Available | 802 | Open in IMG/M |
3300024544|Ga0255294_1059447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 681 | Open in IMG/M |
3300024544|Ga0255294_1083976 | Not Available | 568 | Open in IMG/M |
3300024545|Ga0256347_1057893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 867 | Open in IMG/M |
3300024546|Ga0256356_1100816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 533 | Open in IMG/M |
3300024546|Ga0256356_1104833 | Not Available | 523 | Open in IMG/M |
3300024547|Ga0255292_1052695 | Not Available | 800 | Open in IMG/M |
3300024548|Ga0256342_1067400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300024548|Ga0256342_1072377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 785 | Open in IMG/M |
3300024548|Ga0256342_1077584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 755 | Open in IMG/M |
3300024549|Ga0256308_1059060 | Not Available | 819 | Open in IMG/M |
3300024550|Ga0255266_1072269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 816 | Open in IMG/M |
3300024555|Ga0255280_1053399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300024555|Ga0255280_1061338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 761 | Open in IMG/M |
3300024555|Ga0255280_1099143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 579 | Open in IMG/M |
3300024557|Ga0255283_1059496 | Not Available | 832 | Open in IMG/M |
3300024559|Ga0255284_1058831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 824 | Open in IMG/M |
3300024559|Ga0255284_1060331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
3300024559|Ga0255284_1060977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300024559|Ga0255284_1077216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 706 | Open in IMG/M |
3300024560|Ga0256306_1075694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 800 | Open in IMG/M |
3300024561|Ga0255288_1065614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300024562|Ga0256336_1061287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300024562|Ga0256336_1062009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300024563|Ga0255236_1070757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300024565|Ga0255273_1070085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300024565|Ga0255273_1082598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 737 | Open in IMG/M |
3300024566|Ga0256309_1086456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 797 | Open in IMG/M |
3300024568|Ga0255238_1077142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 802 | Open in IMG/M |
3300024568|Ga0255238_1166793 | Not Available | 518 | Open in IMG/M |
3300024569|Ga0255243_1082221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300024570|Ga0255276_1092449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300024571|Ga0256302_1071342 | Not Available | 816 | Open in IMG/M |
3300024571|Ga0256302_1156591 | Not Available | 536 | Open in IMG/M |
3300024572|Ga0255268_1114997 | Not Available | 672 | Open in IMG/M |
3300024573|Ga0256337_1077883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 836 | Open in IMG/M |
3300024573|Ga0256337_1097026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 738 | Open in IMG/M |
3300024574|Ga0255275_1116848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 727 | Open in IMG/M |
3300024574|Ga0255275_1147304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 634 | Open in IMG/M |
3300024848|Ga0255229_1038077 | Not Available | 824 | Open in IMG/M |
3300024848|Ga0255229_1040761 | Not Available | 797 | Open in IMG/M |
3300024851|Ga0255293_1062751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 683 | Open in IMG/M |
3300024852|Ga0255295_1050729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300024852|Ga0255295_1050737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 803 | Open in IMG/M |
3300024854|Ga0255287_1065660 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300024858|Ga0255286_1058784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 787 | Open in IMG/M |
3300024859|Ga0255278_1051559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 814 | Open in IMG/M |
3300024862|Ga0256317_1065215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300024863|Ga0255246_1073100 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300024864|Ga0255271_1092462 | Not Available | 661 | Open in IMG/M |
3300024865|Ga0256340_1136600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 590 | Open in IMG/M |
3300024865|Ga0256340_1154924 | Not Available | 549 | Open in IMG/M |
3300024866|Ga0255272_1099712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 727 | Open in IMG/M |
3300024867|Ga0255267_1067981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 827 | Open in IMG/M |
3300024867|Ga0255267_1090077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 709 | Open in IMG/M |
3300024867|Ga0255267_1121628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 602 | Open in IMG/M |
3300025726|Ga0255258_103478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 840 | Open in IMG/M |
3300025746|Ga0255241_1027000 | Not Available | 836 | Open in IMG/M |
3300025753|Ga0255235_1032931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 762 | Open in IMG/M |
3300025757|Ga0256313_1029161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 811 | Open in IMG/M |
3300025757|Ga0256313_1072687 | Not Available | 512 | Open in IMG/M |
3300025760|Ga0255249_1039300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300025910|Ga0207684_11473206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 555 | Open in IMG/M |
3300025920|Ga0207649_11318281 | Not Available | 571 | Open in IMG/M |
3300025960|Ga0207651_11222390 | Not Available | 675 | Open in IMG/M |
3300026275|Ga0209901_1062530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300026276|Ga0209847_1110620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 505 | Open in IMG/M |
3300026386|Ga0213909_107533 | Not Available | 680 | Open in IMG/M |
3300026402|Ga0255304_1021214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300026402|Ga0255304_1021417 | Not Available | 811 | Open in IMG/M |
3300026405|Ga0256296_1019377 | Not Available | 807 | Open in IMG/M |
3300026405|Ga0256296_1020147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 793 | Open in IMG/M |
3300026405|Ga0256296_1030325 | Not Available | 653 | Open in IMG/M |
3300026412|Ga0256326_1031750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
3300026425|Ga0256300_1025784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300026425|Ga0256300_1029429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 770 | Open in IMG/M |
3300026428|Ga0255309_1039168 | Not Available | 825 | Open in IMG/M |
3300026428|Ga0255309_1059496 | Not Available | 654 | Open in IMG/M |
3300026435|Ga0256297_1032005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300026439|Ga0256361_1038493 | Not Available | 807 | Open in IMG/M |
3300026444|Ga0256364_1039288 | Not Available | 822 | Open in IMG/M |
3300026454|Ga0256319_1052517 | Not Available | 804 | Open in IMG/M |
3300026454|Ga0256319_1054275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 790 | Open in IMG/M |
3300026562|Ga0255285_1061317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 740 | Open in IMG/M |
3300026563|Ga0256355_1040856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300026563|Ga0256355_1063548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 647 | Open in IMG/M |
3300026563|Ga0256355_1079087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 579 | Open in IMG/M |
3300026564|Ga0256359_1028382 | Not Available | 1082 | Open in IMG/M |
3300026564|Ga0256359_1050692 | Not Available | 801 | Open in IMG/M |
3300026564|Ga0256359_1066465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 695 | Open in IMG/M |
3300026565|Ga0256311_1149018 | Not Available | 503 | Open in IMG/M |
3300026566|Ga0256334_1068898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300026566|Ga0256334_1069328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 805 | Open in IMG/M |
3300026571|Ga0255289_1068510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300026572|Ga0255270_1080656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300026572|Ga0255270_1083200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300026573|Ga0255269_1096565 | Not Available | 806 | Open in IMG/M |
3300026573|Ga0255269_1098040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 799 | Open in IMG/M |
3300027079|Ga0255188_1005495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae | 3140 | Open in IMG/M |
3300027155|Ga0255081_1038332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1032 | Open in IMG/M |
3300027541|Ga0255158_1034779 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300027835|Ga0209515_10568444 | Not Available | 574 | Open in IMG/M |
3300028074|Ga0256320_119287 | Not Available | 654 | Open in IMG/M |
3300028079|Ga0255305_1025236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300028080|Ga0256324_1028706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 855 | Open in IMG/M |
3300028081|Ga0255260_1037087 | Not Available | 756 | Open in IMG/M |
3300028089|Ga0255299_1046754 | Not Available | 808 | Open in IMG/M |
3300028097|Ga0255261_1035294 | Not Available | 813 | Open in IMG/M |
3300028100|Ga0256363_1038568 | Not Available | 810 | Open in IMG/M |
3300028100|Ga0256363_1039677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300028100|Ga0256363_1062840 | Not Available | 624 | Open in IMG/M |
3300028101|Ga0256349_1039482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300028101|Ga0256349_1039856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300028101|Ga0256349_1040043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300028101|Ga0256349_1044902 | Not Available | 755 | Open in IMG/M |
3300028101|Ga0256349_1047116 | Not Available | 736 | Open in IMG/M |
3300028108|Ga0256305_1075015 | Not Available | 827 | Open in IMG/M |
3300028108|Ga0256305_1094732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 723 | Open in IMG/M |
3300028108|Ga0256305_1130921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 600 | Open in IMG/M |
3300028112|Ga0256335_1087020 | Not Available | 824 | Open in IMG/M |
3300028112|Ga0256335_1087950 | Not Available | 819 | Open in IMG/M |
3300028112|Ga0256335_1165006 | Not Available | 576 | Open in IMG/M |
3300028113|Ga0255234_1196593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 528 | Open in IMG/M |
3300028247|Ga0256346_106187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300028266|Ga0255227_1031163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 813 | Open in IMG/M |
3300028266|Ga0255227_1031266 | Not Available | 811 | Open in IMG/M |
3300028266|Ga0255227_1063286 | Not Available | 574 | Open in IMG/M |
3300028267|Ga0256358_1052669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 802 | Open in IMG/M |
3300028267|Ga0256358_1089504 | Not Available | 606 | Open in IMG/M |
3300028267|Ga0256358_1103803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 560 | Open in IMG/M |
3300028286|Ga0256331_1069486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300028286|Ga0256331_1071471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 786 | Open in IMG/M |
3300028286|Ga0256331_1072262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 781 | Open in IMG/M |
3300028286|Ga0256331_1100917 | Not Available | 652 | Open in IMG/M |
3300028329|Ga0210315_1035321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 645 | Open in IMG/M |
3300028530|Ga0255279_1040257 | Not Available | 810 | Open in IMG/M |
3300028530|Ga0255279_1043480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 777 | Open in IMG/M |
3300028619|Ga0257136_1043068 | Not Available | 818 | Open in IMG/M |
3300028619|Ga0257136_1043267 | Not Available | 816 | Open in IMG/M |
3300028619|Ga0257136_1043341 | Not Available | 815 | Open in IMG/M |
3300028620|Ga0257139_1039399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300028621|Ga0257142_1043153 | Not Available | 821 | Open in IMG/M |
3300028621|Ga0257142_1062397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 664 | Open in IMG/M |
3300028621|Ga0257142_1063050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 660 | Open in IMG/M |
3300028623|Ga0257141_1044914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 834 | Open in IMG/M |
3300028623|Ga0257141_1045628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 827 | Open in IMG/M |
3300028623|Ga0257141_1046275 | Not Available | 820 | Open in IMG/M |
3300028623|Ga0257141_1049063 | Not Available | 793 | Open in IMG/M |
3300028647|Ga0272412_1199209 | Not Available | 829 | Open in IMG/M |
3300028670|Ga0257143_1029526 | Not Available | 825 | Open in IMG/M |
3300028670|Ga0257143_1030981 | Not Available | 801 | Open in IMG/M |
3300029288|Ga0265297_10976346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 505 | Open in IMG/M |
3300029636|Ga0222749_10316693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300029639|Ga0265597_101538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 839 | Open in IMG/M |
3300029639|Ga0265597_101652 | Not Available | 815 | Open in IMG/M |
3300029640|Ga0206093_102773 | Not Available | 814 | Open in IMG/M |
3300029640|Ga0206093_102827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 806 | Open in IMG/M |
3300029640|Ga0206093_102851 | Not Available | 804 | Open in IMG/M |
3300029640|Ga0206093_102886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 799 | Open in IMG/M |
3300029646|Ga0206092_106893 | Not Available | 770 | Open in IMG/M |
3300029649|Ga0206085_105960 | Not Available | 696 | Open in IMG/M |
3300029655|Ga0206091_107615 | Not Available | 814 | Open in IMG/M |
3300029659|Ga0206094_108832 | Not Available | 813 | Open in IMG/M |
3300029666|Ga0265600_114177 | Not Available | 812 | Open in IMG/M |
3300029666|Ga0265600_125034 | Not Available | 584 | Open in IMG/M |
3300029674|Ga0265604_114853 | Not Available | 803 | Open in IMG/M |
3300029674|Ga0265604_115169 | Not Available | 794 | Open in IMG/M |
3300029685|Ga0265603_1019653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 832 | Open in IMG/M |
3300029685|Ga0265603_1019998 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
3300029685|Ga0265603_1020505 | Not Available | 812 | Open in IMG/M |
3300029687|Ga0265602_1024623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 825 | Open in IMG/M |
3300029687|Ga0265602_1025012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300029691|Ga0265598_1030935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 849 | Open in IMG/M |
3300029691|Ga0265598_1031775 | Not Available | 835 | Open in IMG/M |
3300029691|Ga0265598_1033587 | Not Available | 808 | Open in IMG/M |
3300029691|Ga0265598_1034227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 799 | Open in IMG/M |
3300029693|Ga0257137_1036508 | Not Available | 830 | Open in IMG/M |
3300029699|Ga0255233_1040737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 917 | Open in IMG/M |
3300029701|Ga0222748_1111912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 542 | Open in IMG/M |
3300030533|Ga0247632_1008042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 664 | Open in IMG/M |
3300030543|Ga0210289_1601832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 680 | Open in IMG/M |
3300030550|Ga0247631_1012043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 880 | Open in IMG/M |
3300030552|Ga0247654_1157302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 554 | Open in IMG/M |
3300030552|Ga0247654_1172611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 539 | Open in IMG/M |
3300030565|Ga0247635_1070802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 805 | Open in IMG/M |
3300030571|Ga0247652_1108877 | Not Available | 616 | Open in IMG/M |
3300030576|Ga0247644_1051787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 774 | Open in IMG/M |
3300030579|Ga0247633_10253033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 553 | Open in IMG/M |
3300030592|Ga0247612_1089060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 691 | Open in IMG/M |
3300030600|Ga0247659_1223887 | Not Available | 509 | Open in IMG/M |
3300030609|Ga0247634_10243949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 682 | Open in IMG/M |
3300030610|Ga0247613_10121279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 820 | Open in IMG/M |
3300030610|Ga0247613_10186084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 716 | Open in IMG/M |
3300030621|Ga0247655_10262201 | Not Available | 547 | Open in IMG/M |
3300030623|Ga0265392_1182969 | Not Available | 567 | Open in IMG/M |
3300030628|Ga0247629_10366356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 542 | Open in IMG/M |
3300030634|Ga0247636_10101282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 800 | Open in IMG/M |
3300030683|Ga0247621_1180245 | Not Available | 533 | Open in IMG/M |
3300030730|Ga0307482_1077979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 867 | Open in IMG/M |
3300030730|Ga0307482_1094371 | Not Available | 809 | Open in IMG/M |
3300030730|Ga0307482_1094564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300030730|Ga0307482_1121260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 736 | Open in IMG/M |
3300030741|Ga0265459_13491397 | Not Available | 551 | Open in IMG/M |
3300030751|Ga0102764_1889346 | Not Available | 531 | Open in IMG/M |
3300030764|Ga0265720_1004023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300030783|Ga0102752_1651507 | Not Available | 539 | Open in IMG/M |
3300030790|Ga0138304_1339393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300030803|Ga0074037_1877790 | Not Available | 533 | Open in IMG/M |
3300030805|Ga0265756_103403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 862 | Open in IMG/M |
3300030811|Ga0265735_101861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300030812|Ga0265734_105876 | Not Available | 539 | Open in IMG/M |
3300030815|Ga0265746_1023535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 762 | Open in IMG/M |
3300030816|Ga0265729_101226 | Not Available | 794 | Open in IMG/M |
3300030816|Ga0265729_103685 | Not Available | 563 | Open in IMG/M |
3300030824|Ga0265726_101528 | Not Available | 819 | Open in IMG/M |
3300030829|Ga0308203_1024334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300030829|Ga0308203_1024459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 807 | Open in IMG/M |
3300030829|Ga0308203_1053745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 616 | Open in IMG/M |
3300030829|Ga0308203_1094107 | Not Available | 507 | Open in IMG/M |
3300030830|Ga0308205_1016829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300030831|Ga0308152_103510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 807 | Open in IMG/M |
3300030831|Ga0308152_115188 | Not Available | 514 | Open in IMG/M |
3300030833|Ga0265736_101328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300030833|Ga0265736_101565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 776 | Open in IMG/M |
3300030834|Ga0265738_101649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 814 | Open in IMG/M |
3300030834|Ga0265738_101701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300030855|Ga0075374_10060392 | Not Available | 809 | Open in IMG/M |
3300030872|Ga0265723_1007029 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 720 | Open in IMG/M |
3300030873|Ga0265751_103955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300030875|Ga0265727_100923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300030875|Ga0265727_101482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 711 | Open in IMG/M |
3300030876|Ga0265730_101105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300030880|Ga0265776_102992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300030887|Ga0265733_101997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 707 | Open in IMG/M |
3300030902|Ga0308202_1043753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300030902|Ga0308202_1043776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 801 | Open in IMG/M |
3300030902|Ga0308202_1079947 | Not Available | 648 | Open in IMG/M |
3300030902|Ga0308202_1113700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 572 | Open in IMG/M |
3300030903|Ga0308206_1054017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300030903|Ga0308206_1054221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300030903|Ga0308206_1076842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
3300030904|Ga0308198_1026127 | Not Available | 811 | Open in IMG/M |
3300030904|Ga0308198_1026825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300030905|Ga0308200_1042384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 825 | Open in IMG/M |
3300030905|Ga0308200_1044419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300030923|Ga0138296_1094899 | Not Available | 766 | Open in IMG/M |
3300030937|Ga0138302_1448429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 776 | Open in IMG/M |
3300030937|Ga0138302_1524914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 573 | Open in IMG/M |
3300030967|Ga0075399_10034821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 635 | Open in IMG/M |
3300030968|Ga0075376_10031380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 555 | Open in IMG/M |
3300030973|Ga0075395_10035760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 826 | Open in IMG/M |
3300030977|Ga0265721_1002177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300030977|Ga0265721_1010252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 582 | Open in IMG/M |
3300030982|Ga0265748_102591 | Not Available | 762 | Open in IMG/M |
3300030982|Ga0265748_106277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 588 | Open in IMG/M |
3300030986|Ga0308154_104398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300030987|Ga0308155_1008061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300030988|Ga0308183_1055217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300030988|Ga0308183_1056001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300030989|Ga0308196_1017593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300030989|Ga0308196_1027346 | Not Available | 701 | Open in IMG/M |
3300030989|Ga0308196_1062544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 537 | Open in IMG/M |
3300030990|Ga0308178_1043405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 816 | Open in IMG/M |
3300030993|Ga0308190_1057354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 768 | Open in IMG/M |
3300030993|Ga0308190_1130594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 580 | Open in IMG/M |
3300030993|Ga0308190_1138717 | Not Available | 568 | Open in IMG/M |
3300030997|Ga0073997_10092227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 613 | Open in IMG/M |
3300030998|Ga0073996_10085032 | Not Available | 686 | Open in IMG/M |
3300031016|Ga0265732_101193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300031016|Ga0265732_101200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300031023|Ga0073998_11642557 | Not Available | 546 | Open in IMG/M |
3300031036|Ga0073978_1628217 | Not Available | 811 | Open in IMG/M |
3300031042|Ga0265749_101105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300031043|Ga0265779_103959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 775 | Open in IMG/M |
3300031058|Ga0308189_10131572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 836 | Open in IMG/M |
3300031058|Ga0308189_10139809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 819 | Open in IMG/M |
3300031058|Ga0308189_10143489 | Not Available | 811 | Open in IMG/M |
3300031058|Ga0308189_10143705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300031058|Ga0308189_10170243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 765 | Open in IMG/M |
3300031058|Ga0308189_10276527 | Not Available | 646 | Open in IMG/M |
3300031058|Ga0308189_10423806 | Not Available | 556 | Open in IMG/M |
3300031058|Ga0308189_10495677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 525 | Open in IMG/M |
3300031081|Ga0308185_1029933 | Not Available | 655 | Open in IMG/M |
3300031082|Ga0308192_1026830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
3300031082|Ga0308192_1053102 | Not Available | 613 | Open in IMG/M |
3300031091|Ga0308201_10110588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300031091|Ga0308201_10113660 | Not Available | 801 | Open in IMG/M |
3300031091|Ga0308201_10340547 | Not Available | 547 | Open in IMG/M |
3300031092|Ga0308204_10092718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300031092|Ga0308204_10100727 | Not Available | 796 | Open in IMG/M |
3300031092|Ga0308204_10175506 | Not Available | 653 | Open in IMG/M |
3300031092|Ga0308204_10179790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 647 | Open in IMG/M |
3300031093|Ga0308197_10106814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 838 | Open in IMG/M |
3300031093|Ga0308197_10117898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300031094|Ga0308199_1051906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
3300031095|Ga0308184_1012828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300031095|Ga0308184_1022968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 683 | Open in IMG/M |
3300031095|Ga0308184_1030368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 627 | Open in IMG/M |
3300031096|Ga0308193_1023488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300031096|Ga0308193_1029797 | Not Available | 747 | Open in IMG/M |
3300031096|Ga0308193_1047177 | Not Available | 639 | Open in IMG/M |
3300031097|Ga0308188_1031849 | Not Available | 548 | Open in IMG/M |
3300031097|Ga0308188_1037871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 517 | Open in IMG/M |
3300031099|Ga0308181_1048539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300031099|Ga0308181_1108218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 609 | Open in IMG/M |
3300031100|Ga0308180_1010439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 806 | Open in IMG/M |
3300031100|Ga0308180_1010648 | Not Available | 801 | Open in IMG/M |
3300031100|Ga0308180_1011548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300031114|Ga0308187_10134214 | Not Available | 808 | Open in IMG/M |
3300031114|Ga0308187_10138856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300031114|Ga0308187_10334837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 579 | Open in IMG/M |
3300031123|Ga0308195_1021120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300031123|Ga0308195_1034873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 678 | Open in IMG/M |
3300031124|Ga0308151_1012552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300031125|Ga0308182_1006920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 815 | Open in IMG/M |
3300031125|Ga0308182_1012082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 674 | Open in IMG/M |
3300031125|Ga0308182_1019026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 577 | Open in IMG/M |
3300031231|Ga0170824_106755217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 535 | Open in IMG/M |
3300031231|Ga0170824_124056069 | Not Available | 589 | Open in IMG/M |
3300031239|Ga0265328_10464098 | Not Available | 502 | Open in IMG/M |
3300031251|Ga0265327_10455832 | Not Available | 552 | Open in IMG/M |
3300031421|Ga0308194_10206893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 638 | Open in IMG/M |
3300031421|Ga0308194_10259673 | Not Available | 586 | Open in IMG/M |
3300031422|Ga0308186_1009544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 825 | Open in IMG/M |
3300031422|Ga0308186_1009791 | Not Available | 818 | Open in IMG/M |
3300031422|Ga0308186_1023192 | Not Available | 610 | Open in IMG/M |
3300031423|Ga0308177_1020617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 580 | Open in IMG/M |
3300031424|Ga0308179_1014527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300031424|Ga0308179_1014719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300031424|Ga0308179_1016347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 778 | Open in IMG/M |
3300031424|Ga0308179_1025757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 673 | Open in IMG/M |
3300031446|Ga0170820_16813510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 792 | Open in IMG/M |
3300031469|Ga0170819_11991618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 830 | Open in IMG/M |
3300031469|Ga0170819_13232460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 713 | Open in IMG/M |
3300031469|Ga0170819_17740139 | Not Available | 651 | Open in IMG/M |
3300031476|Ga0314827_108448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 811 | Open in IMG/M |
3300031476|Ga0314827_108564 | Not Available | 806 | Open in IMG/M |
3300031481|Ga0314816_1020033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 825 | Open in IMG/M |
3300031484|Ga0314822_104619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300031487|Ga0314823_105224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 831 | Open in IMG/M |
3300031487|Ga0314823_105270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 827 | Open in IMG/M |
3300031490|Ga0314825_105166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300031491|Ga0314824_103270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300031493|Ga0314826_114137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300031493|Ga0314826_114191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 801 | Open in IMG/M |
3300031493|Ga0314826_116185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 752 | Open in IMG/M |
3300031495|Ga0314817_113892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 698 | Open in IMG/M |
3300031499|Ga0314818_106200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300031502|Ga0314819_105025 | Not Available | 808 | Open in IMG/M |
3300031503|Ga0314820_104806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 813 | Open in IMG/M |
3300031548|Ga0307408_100606272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 974 | Open in IMG/M |
3300031560|Ga0265605_1029644 | Not Available | 807 | Open in IMG/M |
3300031560|Ga0265605_1047370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 609 | Open in IMG/M |
3300031590|Ga0307483_1009736 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 827 | Open in IMG/M |
3300031595|Ga0265313_10120317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1146 | Open in IMG/M |
3300031661|Ga0307274_1022690 | Not Available | 819 | Open in IMG/M |
3300031677|Ga0307480_1005068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300031677|Ga0307480_1022182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 518 | Open in IMG/M |
3300031940|Ga0310901_10423827 | Not Available | 584 | Open in IMG/M |
3300031960|Ga0307272_1038116 | Not Available | 812 | Open in IMG/M |
3300032149|Ga0315302_1045495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 828 | Open in IMG/M |
3300032168|Ga0316593_10247567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 666 | Open in IMG/M |
3300032177|Ga0315276_11099557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 842 | Open in IMG/M |
3300032256|Ga0315271_10160808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1769 | Open in IMG/M |
3300032893|Ga0335069_11615716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 694 | Open in IMG/M |
3300032955|Ga0335076_11497692 | Not Available | 562 | Open in IMG/M |
3300033004|Ga0335084_10923998 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 882 | Open in IMG/M |
3300033524|Ga0316592_1066360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300033527|Ga0316586_1061206 | Not Available | 684 | Open in IMG/M |
3300033528|Ga0316588_1075994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300033528|Ga0316588_1082540 | Not Available | 797 | Open in IMG/M |
3300033529|Ga0316587_1044137 | Not Available | 809 | Open in IMG/M |
3300033529|Ga0316587_1092893 | Not Available | 577 | Open in IMG/M |
3300034106|Ga0335036_0398093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 886 | Open in IMG/M |
3300034160|Ga0370510_0131509 | Not Available | 765 | Open in IMG/M |
3300034357|Ga0335064_0754562 | Not Available | 598 | Open in IMG/M |
3300034448|Ga0370540_04018 | Not Available | 771 | Open in IMG/M |
3300034479|Ga0314785_005053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 856 | Open in IMG/M |
3300034479|Ga0314785_005895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300034479|Ga0314785_009479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 694 | Open in IMG/M |
3300034480|Ga0314789_007886 | Not Available | 830 | Open in IMG/M |
3300034480|Ga0314789_008281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300034480|Ga0314789_008772 | Not Available | 802 | Open in IMG/M |
3300034480|Ga0314789_012624 | Not Available | 708 | Open in IMG/M |
3300034481|Ga0315299_09137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300034482|Ga0326770_009772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 815 | Open in IMG/M |
3300034643|Ga0370545_153818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 531 | Open in IMG/M |
3300034644|Ga0370548_039891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300034652|Ga0316598_099494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300034653|Ga0316599_088225 | Not Available | 806 | Open in IMG/M |
3300034653|Ga0316599_088254 | Not Available | 806 | Open in IMG/M |
3300034653|Ga0316599_088355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300034653|Ga0316599_121671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 687 | Open in IMG/M |
3300034659|Ga0314780_052756 | Not Available | 819 | Open in IMG/M |
3300034659|Ga0314780_053333 | Not Available | 816 | Open in IMG/M |
3300034659|Ga0314780_054541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300034659|Ga0314780_055443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300034659|Ga0314780_067018 | Not Available | 756 | Open in IMG/M |
3300034659|Ga0314780_067083 | Not Available | 756 | Open in IMG/M |
3300034659|Ga0314780_154667 | Not Available | 568 | Open in IMG/M |
3300034660|Ga0314781_019554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 1042 | Open in IMG/M |
3300034660|Ga0314781_038859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
3300034660|Ga0314781_039131 | Not Available | 815 | Open in IMG/M |
3300034660|Ga0314781_052627 | Not Available | 734 | Open in IMG/M |
3300034660|Ga0314781_057532 | Not Available | 711 | Open in IMG/M |
3300034660|Ga0314781_099839 | Not Available | 583 | Open in IMG/M |
3300034661|Ga0314782_052062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
3300034661|Ga0314782_052063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300034661|Ga0314782_070939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 737 | Open in IMG/M |
3300034661|Ga0314782_147198 | Not Available | 574 | Open in IMG/M |
3300034661|Ga0314782_150529 | Not Available | 570 | Open in IMG/M |
3300034661|Ga0314782_188441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 528 | Open in IMG/M |
3300034661|Ga0314782_191929 | Not Available | 525 | Open in IMG/M |
3300034662|Ga0314783_042398 | Not Available | 829 | Open in IMG/M |
3300034662|Ga0314783_071859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 692 | Open in IMG/M |
3300034662|Ga0314783_163740 | Not Available | 522 | Open in IMG/M |
3300034663|Ga0314784_021821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1011 | Open in IMG/M |
3300034663|Ga0314784_041381 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300034663|Ga0314784_096301 | Not Available | 611 | Open in IMG/M |
3300034664|Ga0314786_032446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 907 | Open in IMG/M |
3300034664|Ga0314786_046243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300034664|Ga0314786_085439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 657 | Open in IMG/M |
3300034664|Ga0314786_093690 | Not Available | 636 | Open in IMG/M |
3300034664|Ga0314786_095145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 633 | Open in IMG/M |
3300034665|Ga0314787_030791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 814 | Open in IMG/M |
3300034665|Ga0314787_033334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300034665|Ga0314787_039039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 748 | Open in IMG/M |
3300034665|Ga0314787_055510 | Not Available | 661 | Open in IMG/M |
3300034665|Ga0314787_063316 | Not Available | 631 | Open in IMG/M |
3300034666|Ga0314788_048321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 830 | Open in IMG/M |
3300034666|Ga0314788_058514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 780 | Open in IMG/M |
3300034666|Ga0314788_152301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 565 | Open in IMG/M |
3300034667|Ga0314792_070292 | Not Available | 815 | Open in IMG/M |
3300034667|Ga0314792_078391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 785 | Open in IMG/M |
3300034667|Ga0314792_093712 | Not Available | 737 | Open in IMG/M |
3300034668|Ga0314793_041240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300034668|Ga0314793_042493 | Not Available | 807 | Open in IMG/M |
3300034668|Ga0314793_044274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
3300034668|Ga0314793_051199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 758 | Open in IMG/M |
3300034668|Ga0314793_089996 | Not Available | 625 | Open in IMG/M |
3300034669|Ga0314794_137383 | Not Available | 556 | Open in IMG/M |
3300034669|Ga0314794_160155 | Not Available | 527 | Open in IMG/M |
3300034670|Ga0314795_121086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 544 | Open in IMG/M |
3300034671|Ga0314796_036533 | Not Available | 884 | Open in IMG/M |
3300034672|Ga0314797_038384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 831 | Open in IMG/M |
3300034672|Ga0314797_042212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
3300034672|Ga0314797_046737 | Not Available | 776 | Open in IMG/M |
3300034672|Ga0314797_049016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 762 | Open in IMG/M |
3300034672|Ga0314797_073197 | Not Available | 663 | Open in IMG/M |
3300034672|Ga0314797_083407 | Not Available | 633 | Open in IMG/M |
3300034673|Ga0314798_045230 | Not Available | 809 | Open in IMG/M |
3300034673|Ga0314798_104064 | Not Available | 604 | Open in IMG/M |
3300034674|Ga0314799_013513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300034674|Ga0314799_035629 | Not Available | 574 | Open in IMG/M |
3300034675|Ga0314800_061120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 556 | Open in IMG/M |
3300034676|Ga0314801_051366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300034676|Ga0314801_053389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300034676|Ga0314801_053594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300034676|Ga0314801_059330 | Not Available | 777 | Open in IMG/M |
3300034677|Ga0314802_006656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 986 | Open in IMG/M |
3300034677|Ga0314802_020078 | Not Available | 671 | Open in IMG/M |
3300034678|Ga0314803_035191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300034678|Ga0314803_036322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
3300034678|Ga0314803_061697 | Not Available | 670 | Open in IMG/M |
3300034678|Ga0314803_143555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 502 | Open in IMG/M |
3300034680|Ga0370541_015725 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300034680|Ga0370541_055113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 528 | Open in IMG/M |
3300034681|Ga0370546_025527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 811 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.33% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 4.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.69% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.53% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 3.98% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.18% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.55% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.86% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.59% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.51% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.11% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.43% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.03% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.95% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.95% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.88% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.88% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.64% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.64% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.48% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.48% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.48% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.48% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.40% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.40% |
Anaerobic Bioreactor Biomass | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass | 0.40% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.32% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.32% |
Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 0.32% |
Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil | 0.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.24% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.24% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.24% |
Subtropical Soil | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil | 0.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.16% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.16% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.16% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.16% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.16% |
Subsurface Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water | 0.16% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.08% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.08% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.08% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.08% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.08% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.08% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.08% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.08% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.08% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.08% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.08% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.08% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.08% |
Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.08% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.08% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.08% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.08% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.08% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.08% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.08% |
Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.08% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.08% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111013 | Subtropical soil microbial communities from Bundaberg Australia-rainforest | Environmental | Open in IMG/M |
2222084002 | Subtropical soil microbial communities from Bundaberg Australia-sugarcane farm | Environmental | Open in IMG/M |
2228664014 | Contaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31 | Environmental | Open in IMG/M |
3300001808 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300001810 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300002341 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - D_52min_Anaerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300002343 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300002346 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - J_51min_Aerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300002675 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF122 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002678 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF126 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002680 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF132 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003289 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_19 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300003563 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Bulk_46 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003576 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003672 | Estuarine microbial mat communities from Elkhorn Slough, Moss Landing, CA, USA - CR2A Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004130 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF226 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004131 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF232 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004134 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004530 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 40_LOW7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004567 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 9_HOW4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004622 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005506 | Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
3300006230 | Marine sediment microbial communities, 15.1 km from oil contamination, ambient, Gulf of Mexico ? BC155 | Environmental | Open in IMG/M |
3300006235 | Marine sediment microbial communities, 33.9 km from oil contamination, ambient, Gulf of Mexico ? BC463 | Environmental | Open in IMG/M |
3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006366 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006373 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006602 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006647 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_4R (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006727 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0619 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006731 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 AAIW_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007159 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007219 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007232 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007235 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 D RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007237 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 A RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007253 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007526 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007602 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_B6L_H (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008648 | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-60 | Environmental | Open in IMG/M |
3300008702 | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-46 | Environmental | Open in IMG/M |
3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
3300008787 | Microbial communities from wetland soil in Czech Republic - R3_cDNA | Environmental | Open in IMG/M |
3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
3300009196 | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February | Environmental | Open in IMG/M |
3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
3300009228 | Microbial communities of water from Amazon river, Brazil - RCM7 | Environmental | Open in IMG/M |
3300009230 | Microbial communities of water from Amazon river, Brazil - RCM8 | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
3300009261 | Microbial communities of water from Amazon river, Brazil - RCM23 | Environmental | Open in IMG/M |
3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
3300009337 | Microbial communities of water from Amazon river, Brazil - RCM17 | Environmental | Open in IMG/M |
3300009352 | Microbial communities of water from Amazon river, Brazil - RCM18 | Environmental | Open in IMG/M |
3300009387 | Microbial communities of water from Amazon river, Brazil - RCM24 | Environmental | Open in IMG/M |
3300009404 | Microbial communities of water from Amazon river, Brazil - RCM6 | Environmental | Open in IMG/M |
3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009834 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 2, 6m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010066 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010067 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010077 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010094 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010305 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010895 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011028 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011046 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011055 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011281 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_6R (Metagenome Metatranscriptome) (version 2) | Engineered | Open in IMG/M |
3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011288 | Marine microbial communities from the Southern Atlantic ocean - KN S17 NADW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011299 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_D5L_HD (Metagenome Metatranscriptome) (version 2) | Engineered | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012686 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012689 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012690 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES078 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012699 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012703 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA- GEODES074 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012747 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013046 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013068 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES062 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300016678 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES102 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016680 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES103 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016682 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES101 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016736 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016754 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016766 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300018549 | Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p8 | Environmental | Open in IMG/M |
3300018610 | Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2 | Environmental | Open in IMG/M |
3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019191 | Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019198 | Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019205 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC045_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019209 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW3_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019213 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019215 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC12_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019216 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019221 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019225 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019247 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC028_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019267 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021257 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.272 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021258 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021267 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021268 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63.3A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021269 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021270 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.593 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021274 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.268 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021283 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021284 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021287 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.380 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021292 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.493 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021294 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.264 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021302 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.270 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021314 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021331 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021852 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021853 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021967 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021969 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_7 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300021970 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300022141 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022144 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_31 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022147 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022151 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_8 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022161 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
3300022372 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022373 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022645 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300022652 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_3 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023697 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023703 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024532 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024535 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024540 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024542 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024544 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024545 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024851 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024852 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024854 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024858 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025726 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025746 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025753 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
3300026276 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes) | Environmental | Open in IMG/M |
3300026386 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0907-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026402 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026405 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026412 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026428 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026439 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026444 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026563 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026564 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300028074 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028079 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028080 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028081 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028097 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028100 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028101 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028247 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028267 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028619 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028620 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028621 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028670 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029639 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029640 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029646 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029649 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029655 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029659 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029666 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029674 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029685 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029687 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029691 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029693 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030533 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030543 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030550 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030565 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030576 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030579 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030609 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030610 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030683 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030751 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030790 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030803 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030811 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030824 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030833 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030875 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030876 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030887 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030968 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030977 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031016 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031036 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031042 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031476 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031484 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031487 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031490 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031491 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031493 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031495 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031499 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031502 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031503 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031560 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_60m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031661 | Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031960 | Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG08 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032149 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_1000m_931 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034480 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034481 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_Tmax_1102 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034482 | Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S02 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DRAFT_00287700 | 2209111013 | Subtropical Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKKKK |
DRAFT_00321170 | 2222084002 | Subtropical Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHS |
DRAFT_00498320 | 2222084002 | Subtropical Soil | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVAN |
PheDRAFT_00034030 | 2228664014 | Contaminated Soil | MRPRHPHAAESGVGKYTARESESAKACAIGKERVANA |
PheDRAFT_00063120 | 2228664014 | Contaminated Soil | MRPRHPHAAESGVGKYTARESESAKACAIGKERVANAHY |
PheDRAFT_00045720 | 2228664014 | Contaminated Soil | MRPRHPHAAESGVGKYTARESESAKACAIGKERVANAHS |
JGI20218J20341_10032042 | 3300001808 | Wetland | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHNW |
JGI20221J20338_10122662 | 3300001810 | Wetland | MRPRSAHAALSSVGEHTTRESEGAKCCAEGKERVANAHP |
JGI24213J29975_10011753 | 3300002341 | Wastewater Treatment | MRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPHKL |
JGI24214J29971_10017592 | 3300002343 | Wastewater Treatment | MRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPHKLAP |
JGI24216J29974_10031042 | 3300002346 | Wastewater Treatment | MRPKHPHAAESGVGKHTARESERVQACATGKEHVTPAHPH |
Ga0005473J37261_1002532 | 3300002675 | Forest Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPH |
Ga0005475J37263_1015071 | 3300002677 | Forest Soil | MRPRHPRAAESGVGKHTARESESAKACAVGKERVANAHPHKLAP |
Ga0005477J37265_1002692 | 3300002678 | Forest Soil | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHKL |
Ga0005483J37271_1008001 | 3300002680 | Forest Soil | MRPRHPHAAESGVGKHTARESESAKACAVGKERVANAHPH |
Ga0005471J37259_1005101 | 3300002681 | Forest Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLA |
Ga0006842J43188_1007582 | 3300002861 | Peatlands Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKEHVTNAHPH |
Ga0006764J43180_1000542 | 3300002864 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNWPR |
Ga0006761J43178_1000353 | 3300002865 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHK |
Ga0006767J43181_1000312 | 3300002868 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNW |
Ga0006760J45825_1000793 | 3300003158 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHIARESESVQACAAGKERVTNAHPH |
Ga0006760J45825_1003231 | 3300003158 | Avena Fatua Rhizosphere | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSH |
Ga0006778J45830_10002231 | 3300003162 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESESVQACAAGKERVTNAHPHKLA |
Ga0006776J48906_1013332 | 3300003289 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIW |
Ga0006777J48905_10015522 | 3300003308 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPR |
JGIcombinedJ51221_101885971 | 3300003505 | Forest Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLAP |
Ga0007430J51106_1022441 | 3300003563 | Avena Fatua Rhizosphere | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPH |
Ga0007413J51701_10000371 | 3300003576 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKQKQ |
Ga0007411J51799_1000852 | 3300003611 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKAK |
Ga0001194_1002732 | 3300003672 | Estuarine | MRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAHPH |
Ga0001194_1003422 | 3300003672 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPH |
Ga0005853_10123152 | 3300003754 | Freshwater And Sediment | MRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQ |
Ga0058888_10249221 | 3300004102 | Forest Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQ |
Ga0058901_10324621 | 3300004120 | Forest Soil | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQ |
Ga0058895_10047451 | 3300004130 | Forest Soil | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPQ |
Ga0058898_10106081 | 3300004131 | Forest Soil | MRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANAHPH |
Ga0058892_10142311 | 3300004133 | Forest Soil | MRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPP |
Ga0058906_10188951 | 3300004134 | Forest Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPRYIRVPRR |
Ga0058894_10173651 | 3300004140 | Forest Soil | MRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPHKLA |
Ga0066599_1009344542 | 3300004282 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCADGKERVANAHPHFEPGTARSRV |
Ga0068919_10421491 | 3300004473 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAHPH |
Ga0066516_1125561 | 3300004530 | Freshwater Sediment | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLAP |
Ga0066495_1120652 | 3300004567 | Freshwater Sediment | MRPKHPPAAESGVGKHTARESERAQSCATGKERVANAHPQIW |
Ga0058865_10892821 | 3300004622 | Wastewater Treatment | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPH |
Ga0058859_100695502 | 3300004798 | Host-Associated | MRPKHPRAAESGVGKHIARESESAKACAAGKERVANAHPQ |
Ga0058861_101143641 | 3300004800 | Host-Associated | MRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLAP |
Ga0058860_101379121 | 3300004801 | Host-Associated | MRLKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPE |
Ga0058860_101660361 | 3300004801 | Host-Associated | MRPRHPHAAESGVGKHTARESESAQECVAGKERVANAHPQ |
Ga0058860_101876121 | 3300004801 | Host-Associated | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL |
Ga0058860_121985741 | 3300004801 | Host-Associated | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQI |
Ga0068912_112628681 | 3300005506 | Soil | MRPKHPHAAESGVGKHNARESERVQACATGKERVTNAHP |
Ga0070686_1009576642 | 3300005544 | Switchgrass Rhizosphere | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLAPEAS |
Ga0068857_1014145851 | 3300005577 | Corn Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEAS |
Ga0075040_10668671 | 3300005646 | Permafrost Soil | MRPRHPHAAVSGVGKHIARESERVQACAAGKERVT |
Ga0078894_100090162 | 3300005662 | Freshwater Lake | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRN* |
Ga0079957_12410702 | 3300005805 | Lake | MRPRHPHAAESGVGKHTARESESAQACVSGKERVANAHSHISP |
Ga0066791_100404772 | 3300005949 | Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALEPQGSGAILFLA |
Ga0082390_1280121 | 3300006230 | Marine | MRPRSTHAALSGVGEHPARKCESAKWCAIGKERVA |
Ga0082395_10239321 | 3300006235 | Marine | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAPEP |
Ga0075501_10220232 | 3300006355 | Aqueous | MRPRSAHAALSGVGEHTARESESAKCCAAGKERVANAHS |
Ga0075499_10457742 | 3300006366 | Aqueous | MRPKHPHAAESGVGKHTARESERAQACADGEERVANAHSH |
Ga0075499_10663091 | 3300006366 | Aqueous | MRPRHPHAAESGVGKYTARESESAQACATGKERVANAH |
Ga0075483_10051751 | 3300006373 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWCATGKERVANAH |
Ga0075498_10790591 | 3300006378 | Aqueous | MRPRHPHAAESGVGKYTARESESAQACATGKERVANAHSH |
Ga0075498_10896082 | 3300006378 | Aqueous | MRPRHPHAAESGVGKHTARESESAQACATGKERVAN |
Ga0075498_11024722 | 3300006378 | Aqueous | MRPKHPHAAESGVGKHITRESERAQACAIGKERVA |
Ga0075506_10084753 | 3300006401 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPH |
Ga0075511_17352511 | 3300006402 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHS |
Ga0075037_10296911 | 3300006426 | Permafrost Soil | MRPKHPHAAESGVGKCTARESERAQSYTTGKEHVANAHPQIW |
Ga0075484_10807121 | 3300006602 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPHFEP |
Ga0075484_15484421 | 3300006602 | Aqueous | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAH |
Ga0075471_104316832 | 3300006641 | Aqueous | HAAESGVGKHTARESESAQACADGEERVANAHSRN* |
Ga0099772_10480802 | 3300006647 | Activated Sludge | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAS |
Ga0031666_11042361 | 3300006727 | Deep Ocean | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHP |
Ga0079249_13598981 | 3300006731 | Marine | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANA |
Ga0075472_107097061 | 3300006917 | Aqueous | PHAAESGVGKHTARESESAQACADGEERVANAHSRN* |
Ga0081243_10351181 | 3300006937 | Tropical Rainforest Soil | MRPKHLHAAESGVGKHTTRESERAQACAAGKERVANAH |
Ga0075020_1125751 | 3300007159 | Watersheds | MRPRHPHAAESGVGKHTARESERAQACATGKERVAN |
Ga0075025_10084411 | 3300007219 | Watersheds | MRPRHPPAAESGVGKHTARESERAQACATGKERVANA |
Ga0075025_10577641 | 3300007219 | Watersheds | MRPRHPHAAESGVGKHTARESERVQACATGKERVT |
Ga0075183_114911471 | 3300007232 | Wastewater Effluent | MRPRHPLAAESGVGKHTARESERAQSCANGKERVANAH |
Ga0075184_100850991 | 3300007235 | Wastewater Effluent | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLASEAQ |
Ga0075177_10222701 | 3300007237 | Wastewater Effluent | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPHK |
Ga0075177_10517811 | 3300007237 | Wastewater Effluent | MRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHPHK |
Ga0075182_100067251 | 3300007253 | Wastewater Effluent | MRPRHPLAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0102692_10661961 | 3300007321 | Freshwater Lake | MRPKHPHAAESGVGKHTARESESAQACATGKERVANAHS |
Ga0075016_10017572 | 3300007327 | Watersheds | MRPRHPHAAESGVGEHKARESESAQHCAAGKERVANAH |
Ga0075016_10273941 | 3300007327 | Watersheds | MRPKHPHAAESGVGKHIARESERAQACATGKERVANAHP |
Ga0075016_10431281 | 3300007327 | Watersheds | MRPKHPPAAESGVGKHIARESERVQACAAGKERVTNA |
Ga0075022_10010361 | 3300007526 | Watersheds | MRPRNPHAAESGVGKHTARESERVQACAAGKERVTN |
Ga0075022_10055701 | 3300007526 | Watersheds | MRPKHPHDAESGVGKHTARESERAQACAAGKERVANAH |
Ga0075022_10092361 | 3300007526 | Watersheds | MRPRHPHAAESGVGKHIARESERAQACATGKERVAN |
Ga0075022_10296781 | 3300007526 | Watersheds | MRPKHPHAVESGVGKHTARESERVQACAAGKERVTNA |
Ga0099787_10203781 | 3300007602 | Activated Sludge | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL |
Ga0102876_11190782 | 3300007642 | Estuarine | MRPRHPHAAESGVGKHTARESESAQACVNGKERVANAHSHISPGDRK |
Ga0108970_113646232 | 3300008055 | Estuary | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSRN* |
Ga0103610_1002731 | 3300008648 | Hydrothermal Vents | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKT |
Ga0103614_10051411 | 3300008702 | Hydrothermal Vents | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKKTP |
Ga0103638_10005971 | 3300008785 | Wetland Soil | MRPKHPHAAESGVGEHKARESESAQRCAAGKERVANAHPQKEKKK |
Ga0103638_10032141 | 3300008785 | Wetland Soil | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPEASKTS |
Ga0103640_10003691 | 3300008787 | Wetland Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKL |
Ga0103746_100180821 | 3300008884 | Wastewater Sludge | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAPE |
Ga0103746_100182371 | 3300008884 | Wastewater Sludge | MRPRHPHAAESGVGKHTARESERAQSCANGKERVANAHPQIWPR |
Ga0103745_100241642 | 3300009196 | Wastewater Sludge | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAP |
Ga0103745_100241781 | 3300009196 | Wastewater Sludge | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPHFEPG |
Ga0103745_100435801 | 3300009196 | Wastewater Sludge | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAP |
Ga0103748_100339341 | 3300009199 | Wastewater Sludge | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPHFLAPGP |
Ga0103748_100501681 | 3300009199 | Wastewater Sludge | MRPRSAHAALSGVGEHTARESESAQCCANGKERVANPHPHFEP |
Ga0103850_10148552 | 3300009223 | River Water | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSGAK |
Ga0103850_10161181 | 3300009223 | River Water | MRPKHPHAAESGVGKHTARESERAQACATGKERVAHAHPQIWPRDRKAPG |
Ga0103850_10161311 | 3300009223 | River Water | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSGAK |
Ga0103850_10165741 | 3300009223 | River Water | MRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIW |
Ga0103850_10183861 | 3300009223 | River Water | MRPKHPHAAESGVGKHTARASERAQACATGKERVAQ |
Ga0103851_10313681 | 3300009225 | River Water | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLAPGPQGLGA |
Ga0103851_10314411 | 3300009225 | River Water | MRPKHLHAAESGVGKHTARESESAQACAAGKERVANAHPHNLAPGPQGLGA |
Ga0103854_10129911 | 3300009228 | River Water | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAPG |
Ga0103855_100390291 | 3300009230 | River Water | MRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG |
Ga0103855_100393922 | 3300009230 | River Water | MSPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG |
Ga0103855_100405562 | 3300009230 | River Water | MRPKHLHAAESGVGKHTARESESAQACAAGKERVANAHSHFLAPGPQGSG |
Ga0103856_100400931 | 3300009233 | River Water | MRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLQ |
Ga0103856_100982411 | 3300009233 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAP |
Ga0103857_100417821 | 3300009235 | River Water | MRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLQSFRGLQKK |
Ga0103857_100448881 | 3300009235 | River Water | MRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPQKL |
Ga0103857_100461691 | 3300009235 | River Water | MRPESPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKKK |
Ga0103857_100479671 | 3300009235 | River Water | MRPTAPHAAVSGVGEHTARESESAQCCVTGKERVASAHPRLWPANFGS |
Ga0103857_101217871 | 3300009235 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQGSGA |
Ga0103858_100705731 | 3300009239 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQGSGAK |
Ga0103858_100723211 | 3300009239 | River Water | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQG |
Ga0103858_100757181 | 3300009239 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQG |
Ga0103858_101894631 | 3300009239 | River Water | MSPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPHFLAPGPQGSGAK |
Ga0103860_100456942 | 3300009243 | River Water | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLALEPQGSGAI |
Ga0103860_100467952 | 3300009243 | River Water | MRPESPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAPEAARLPG |
Ga0103860_100483681 | 3300009243 | River Water | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPEPQGSGAKL |
Ga0103860_100497531 | 3300009243 | River Water | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHNLALEPQGSGAI |
Ga0103860_101031331 | 3300009243 | River Water | MSPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPHKLASEAARLP |
Ga0103860_101241521 | 3300009243 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPEPQGSGAKL |
Ga0103861_100250461 | 3300009247 | River Water | MRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAP |
Ga0103861_100277741 | 3300009247 | River Water | MSPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEPQGS |
Ga0103862_10194011 | 3300009249 | River Water | MRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIWPRDRKVPG |
Ga0103862_10197291 | 3300009249 | River Water | MRPKHLHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPEPLKAPG |
Ga0103862_10200551 | 3300009249 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGA |
Ga0103862_10207361 | 3300009249 | River Water | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGA |
Ga0103862_10212172 | 3300009249 | River Water | MRPRHPHAAESGVGKYTARESECVQACAAGKERVTNAHPHK |
Ga0103862_10216311 | 3300009249 | River Water | MRPIHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRG |
Ga0103862_10227521 | 3300009249 | River Water | MRPRHPHAAESGVGKHTARESERAEACATGKERVANAHSDR |
Ga0103863_100170331 | 3300009252 | River Water | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGAK |
Ga0103863_100180501 | 3300009252 | River Water | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFLAPGPQSLGAK |
Ga0103869_100666771 | 3300009257 | River Water | MSPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHFLAPGPEGPGAK |
Ga0103869_100685861 | 3300009257 | River Water | MRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFRGLL |
Ga0103869_100721141 | 3300009257 | River Water | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEPGTARS |
Ga0103869_101728761 | 3300009257 | River Water | MRPIAPHAAESGVGKHTARESERVQACAKGEERVTHAHT |
Ga0103870_10160441 | 3300009261 | River Water | MRPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFR |
Ga0103870_10166931 | 3300009261 | River Water | MSPRHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFR |
Ga0103747_102113301 | 3300009295 | Wastewater Sludge | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHPFRQSPA |
Ga0103864_10027601 | 3300009337 | River Water | MRPRHPHAAESGVGKYTARESECVQACAAGKERVTNAHP |
Ga0103865_10032121 | 3300009352 | River Water | MRPIHPHAAESGVGKHTARESESAQACAIGEERVANAHSHHWPRKLPSFQIG |
Ga0103871_10071331 | 3300009387 | River Water | MRPESPHAAESGVGKRTARESERVQACAAGKERVTNAHPHFLAPGPQGPGAKKF |
Ga0103871_10077701 | 3300009387 | River Water | MRSKAALAALSGVGKHTARESESAQACAIGKERVANAHP |
Ga0103853_10116481 | 3300009404 | River Water | MRPRHPHAAESGVGEHTARESERAQQCATGKERVANAHPQIWPRDRKVP |
Ga0115599_10126311 | 3300009579 | Wetland | MRPRHPHAAESGVGEHTARESESAQQCADGKERVANAHP |
Ga0115599_11573631 | 3300009579 | Wetland | MRPKHPRAAESGVGKHTARESESAQACAIGKERVANAHSH |
Ga0115596_10513311 | 3300009580 | Wetland | MRLKHPRAAESGVGKHTARESESAQACANGKERVANAHSH |
Ga0115600_10505431 | 3300009581 | Wetland | MRPKHPHAAESGVGKHAARESESAKACAAGKERVANAHSHKL |
Ga0115600_11161051 | 3300009581 | Wetland | MRPIHPHAAESGVGKHTTRESESAKTCAAGKERVANAHP |
Ga0115600_11692211 | 3300009581 | Wetland | MRPKHPPAAESGVGKHTARESERVQACATGKERVT |
Ga0115600_11830661 | 3300009581 | Wetland | MRPRHPHAAESGVGEHTARESESAQQCADGKERVANAH |
Ga0115601_11164651 | 3300009582 | Wetland | MRSKTLHAAVSGVGEHTARESESAKCCATGKERAANAHPQVW |
Ga0115601_12044432 | 3300009582 | Wetland | MRPIHPHAAESGVGKYTARESESAKACATGKERVANAH |
Ga0115598_10664462 | 3300009583 | Wetland | MRPKHPRAAESGVGKHTARESESAQACATGKERVANA |
Ga0115597_10188231 | 3300009584 | Wetland | MRPKHPHAAESGVGKYTARESESVQACAAGKERVTNAH |
Ga0115597_12150321 | 3300009584 | Wetland | MRPKHPHAAESGVGKHITRESERAQACVIGKERVANAHT |
Ga0115602_10021011 | 3300009587 | Wetland | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANA |
Ga0115602_10461011 | 3300009587 | Wetland | MRPKHPRAAESGVGKHTARESESAQACAIGKERVANA |
Ga0115602_12516061 | 3300009587 | Wetland | MRSKTLHAAVSGVGEHTARESESAKCCATGKERAANAHP |
Ga0105855_13097291 | 3300009649 | Permafrost Soil | MRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPPFWPV |
Ga0105854_10793792 | 3300009660 | Permafrost Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVA |
Ga0131969_1016471 | 3300009834 | Meromictic Pond | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANPNPNPNPNPN |
Ga0127462_1291031 | 3300010061 | Grasslands Soil | MRPKHPHAAESGVGKHTARESERAQSCANGKECVAN |
Ga0127427_1274491 | 3300010066 | Grasslands Soil | MRPKHLHAAESGVGKHTTRESESAQGCAAGKERVASAHSHKL |
Ga0127432_1503111 | 3300010067 | Grasslands Soil | MRPKHPPAAESGVGKHTARESERAQSCATGKECVANTQ |
Ga0127477_1156061 | 3300010071 | Grasslands Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEKRK |
Ga0127477_1366792 | 3300010071 | Grasslands Soil | MRPRHPHAAESGVGKHIARESESVKACAAGKERVTN |
Ga0127434_1578591 | 3300010075 | Grasslands Soil | MRPRHPHAAERAVGKHNARESERAQACATGKERVAN |
Ga0127437_1314211 | 3300010077 | Grasslands Soil | MRPKHPHAAESGVGKCTARESERAQSYTTGKEHVAN |
Ga0127437_1376181 | 3300010077 | Grasslands Soil | MRPKHPHAAESGVGKHIARESESVQACAAGKERVAN |
Ga0127448_1412241 | 3300010080 | Grasslands Soil | MRPKPPPAAESGVGEHTARESERAQQCAIGKECVAYTQ |
Ga0127461_10134841 | 3300010084 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSHK |
Ga0127471_10273591 | 3300010090 | Grasslands Soil | MRPKHPPAAESGVGKHTARESERAQSCATGKECVA |
Ga0127485_10273061 | 3300010091 | Grasslands Soil | MRPRHPHAAGSGVGKHIARESERVQACAAGKERVTN |
Ga0127480_10298441 | 3300010094 | Grasslands Soil | MRPKHPPAAESGVGKHTARESERAQSCAIGKECVANT |
Ga0127473_11203991 | 3300010096 | Grasslands Soil | MRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAHPKSECN |
Ga0127473_11223971 | 3300010096 | Grasslands Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTHA |
Ga0127481_10251731 | 3300010101 | Grasslands Soil | MRPKHPHAAESGVGKHTARESESAQACAAGKERVA |
Ga0127481_10262761 | 3300010101 | Grasslands Soil | MRPKHPRAAESGVGKHTARESERAQACAAGKERVA |
Ga0127500_11049011 | 3300010103 | Grasslands Soil | MRPRAAPAALSGVGKHTARESERAQCCANGKECVAN |
Ga0127497_10699181 | 3300010109 | Grasslands Soil | MRPRAAPAALSGVGKHTARESERAQCCANGKECVANT |
Ga0126316_10588291 | 3300010110 | Soil | MRPRHPRAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0126316_10768031 | 3300010110 | Soil | MRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAH |
Ga0127449_10822851 | 3300010117 | Grasslands Soil | MRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAHPHKL |
Ga0127465_10902142 | 3300010118 | Grasslands Soil | MRSKAALAALSGVGEHTARESESAQGCAIGKERVASAHP |
Ga0127465_11319801 | 3300010118 | Grasslands Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQNLAP |
Ga0127438_11450091 | 3300010121 | Grasslands Soil | MRPKHPRAAESGVGKHTARESERAQACAAGKERVAN |
Ga0127498_10623261 | 3300010124 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSQLQAC |
Ga0127482_10361061 | 3300010126 | Grasslands Soil | MRPRHPHAAESGVGKHIARESESAQACAAGKERVAN |
Ga0127493_11821721 | 3300010130 | Grasslands Soil | MRPRAAPAALSGVGKHTARESERAQCCANGKECVA |
Ga0115594_10226621 | 3300010131 | Wetland | MRPRHPHAAESGVGKHTARESESAKACATGKERVANAHSH |
Ga0127484_10672632 | 3300010134 | Grasslands Soil | MRPKLRFAAESGVGKHTARESERAQSCAIGKECVAN |
Ga0127447_11250151 | 3300010136 | Grasslands Soil | MRPKHPHAAESGVGEHMARESESAQQCAAGKERVA |
Ga0115595_11721451 | 3300010138 | Wetland | MRPRHPHAAESGVGEHTARESESAQQCADGKERVANAHPQ |
Ga0127499_10554681 | 3300010141 | Grasslands Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL |
Ga0115593_10180481 | 3300010144 | Wetland | MRPIHPHAAESGVGKHTARYCESAKACAAGKERVANAHPHK |
Ga0126321_11958961 | 3300010145 | Soil | MRPKHPRAAESGVGKHNARESERAQVCAAGKERVANAH |
Ga0126320_10461452 | 3300010146 | Soil | MRPKHPHAAESGVGKHTARESERVQVCAAGKERVTNAHP |
Ga0126320_12780101 | 3300010146 | Soil | MRPKHPLAAESGVGEHTARESESAQQCAVGKECVAN |
Ga0126319_10354502 | 3300010147 | Soil | MRPKHPRAAESGVGKHTARESERAQACATGKERVANAH |
Ga0126319_10618111 | 3300010147 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKECVANTHPQ |
Ga0126319_10901121 | 3300010147 | Soil | MRLKHPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0126318_105763381 | 3300010152 | Soil | MRPKHPHAAESGVGKHIARESESAQACAAGKERVA |
Ga0126318_109969161 | 3300010152 | Soil | MRPRHPHAAESGVGKHITRESESAKVCAAGKERVANAH |
Ga0126318_111193651 | 3300010152 | Soil | MRPRHPRAAESGVGKHTARESESAKACAAGKERVANAHP |
Ga0127503_103034881 | 3300010154 | Soil | MRLIHPHAAESGVGKHIARESERVQACAAGKERVT |
Ga0129320_1536891 | 3300010305 | Aqueous | MRPRHPHAAESGVGKHTARESERVQACATGKERVTHAH |
Ga0129333_100559502 | 3300010354 | Freshwater To Marine Saline Gradient | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHN* |
Ga0126360_10029591 | 3300010854 | Boreal Forest Soil | MRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAHPQIWPR |
Ga0126358_11222151 | 3300010856 | Boreal Forest Soil | MRPKHPHAAESGVGKCTARESERAQSYTTGKERVANAHPH |
Ga0126354_11480952 | 3300010857 | Boreal Forest Soil | MRPKHPHAAESGVGKHIARESESVKACAAGKERVTNAHPQKL |
Ga0126354_11826222 | 3300010857 | Boreal Forest Soil | MRPRHPHAAESGVGKHIARESESVKACAAGKERVTNAHP |
Ga0126354_11879782 | 3300010857 | Boreal Forest Soil | MRPIHPHAAESGVGKHIARESESVKACAAGKERVTNAHPQKLAS |
Ga0126354_11880261 | 3300010857 | Boreal Forest Soil | MRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAHP |
Ga0126354_12447112 | 3300010857 | Boreal Forest Soil | MRPIHPHAADSGVGKHTARESERAQACATGKERVANAH |
Ga0126352_11117751 | 3300010859 | Boreal Forest Soil | MRPKHPHAAESGVGKHIARESERAQVCATGKERVANAHPH |
Ga0126352_12583162 | 3300010859 | Boreal Forest Soil | MRPKHPHAAESGVGEHTARESERAQQCADGKERVANA |
Ga0126349_10345791 | 3300010861 | Boreal Forest Soil | MRPRHPHAAESGVGKHTARESESAQACAVGKERVAN |
Ga0126349_10642701 | 3300010861 | Boreal Forest Soil | MRPRAAPAALSGVGKHTARESERAQSCAIGKECVANTHP |
Ga0126349_12526311 | 3300010861 | Boreal Forest Soil | MRLKHPHAAESGVGKHTARESESVQACAAGKERVTNAHS |
Ga0126348_10757211 | 3300010862 | Boreal Forest Soil | MRPRHPHAAESGVGKHTARESESAQACAVGKERVANAHP |
Ga0126348_11340991 | 3300010862 | Boreal Forest Soil | MRLKHPHAAESGVGKYTARESESVKACAAGKERVTNAHPQKLASEA |
Ga0126348_12842481 | 3300010862 | Boreal Forest Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTHAHPHNLAL |
Ga0126344_10691101 | 3300010866 | Boreal Forest Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVT |
Ga0126359_12671811 | 3300010869 | Boreal Forest Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLAL |
Ga0126359_16336611 | 3300010869 | Boreal Forest Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKECVAYTH |
Ga0138113_1823151 | 3300010895 | Grasslands Soil | MRPKHPPAAESGVGKHTARESERAQSCATGKECVANTQPQIW |
Ga0138111_11572771 | 3300010896 | Grasslands Soil | MRPRHPHAAESGVGKHIARKSESAQACAAGKERVANAH |
Ga0138577_1354811 | 3300011028 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAH |
Ga0138600_1100081 | 3300011046 | Peatlands Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTHAHP |
Ga0138550_1059971 | 3300011055 | Peatlands Soil | MRPKHPHAAESGVGEHTARKSEAPISVRWKERAANAH |
Ga0138544_10390301 | 3300011057 | Peatlands Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIWPR |
Ga0138534_10528261 | 3300011061 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAKWCAERKERAAN |
Ga0138582_10911651 | 3300011062 | Peatlands Soil | MRPKHPHAAESGVGEHTARKSEAPNSVRWKERAANAH |
Ga0138525_11383281 | 3300011064 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAQWCAEGKERVANA |
Ga0138563_11285081 | 3300011072 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAQWCAEGKERVANAHP |
Ga0138559_11194271 | 3300011074 | Peatlands Soil | MRPRSAHAALSGVGEHPARESESAKWCAEGKERAANA |
Ga0138555_10819271 | 3300011075 | Peatlands Soil | MRPKHPHAAESGVGEHTARESEAPNNVQRKERAANAHHNLALG |
Ga0138568_10914671 | 3300011080 | Peatlands Soil | MRPKHPPAAESGVGKHTARESERAQSCAAGKECVANTH |
Ga0150983_140920912 | 3300011120 | Forest Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPH |
Ga0138295_1213881 | 3300011281 | Activated Sludge | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHSHKLA |
Ga0138293_1352492 | 3300011282 | Watersheds | MRPIHPHAAESGVGKHTARESERVQACATGKERVT |
Ga0138391_1085462 | 3300011288 | Marine | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPH |
Ga0138294_10218291 | 3300011299 | Activated Sludge | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAP |
Ga0126317_105691541 | 3300011332 | Soil | MRPKHPPAAESGVGKHTARESERVQACAAGKERVTN |
Ga0126317_105701571 | 3300011332 | Soil | MRPKYPHAAESGVGKHTARESESAQACAAGKERVA |
Ga0127502_103630921 | 3300011333 | Soil | MRPKHLRAAESGVGKHTARESERVQACAAGKEHVTNAH |
Ga0127502_105878231 | 3300011333 | Soil | MRLKHPRAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0127502_108954501 | 3300011333 | Soil | MRPKHPRAAESGVGKHIARESERVQACAAGKERVTN |
Ga0151652_104072721 | 3300011340 | Wetland | MRPISPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAPE |
Ga0151652_105476221 | 3300011340 | Wetland | MRPIHPHAADSGVGKHTARESESAQACAIGKERVANAHSHIWP |
Ga0151652_105977071 | 3300011340 | Wetland | MRPRPPPAAVSGVGEHTARESESAQCCAAGKERVANA |
Ga0151652_108442081 | 3300011340 | Wetland | MRPMSPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLAP |
Ga0151652_111491891 | 3300011340 | Wetland | MRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPP |
Ga0151652_128599991 | 3300011340 | Wetland | MRPKHPRAAESGVGKYTARESESAKVCAAGKERVANAHPH |
Ga0151652_141156201 | 3300011340 | Wetland | MRPRHPHAAESGVGKHTARESERVQACATGKERVTN |
Ga0137461_12488961 | 3300012040 | Soil | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPEP* |
Ga0150985_1007924611 | 3300012212 | Avena Fatua Rhizosphere | MRPKHPRAAESGVGKHIARESESVQACAAGKERVTNAHP |
Ga0150985_1102483601 | 3300012212 | Avena Fatua Rhizosphere | MRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAH |
Ga0150985_1103451871 | 3300012212 | Avena Fatua Rhizosphere | MRPKSAHAALSGVGEHTTRESEGAKCCAAGKERVANAH |
Ga0150985_1207516691 | 3300012212 | Avena Fatua Rhizosphere | MRPKHPPAVESGFGKHKARESESAQRCAAGKERVADAHQIGRA |
Ga0150985_1223673111 | 3300012212 | Avena Fatua Rhizosphere | MRPKHPPAAESGVGKHTARESERAQACAIGKEQLAIAH |
Ga0134028_11117181 | 3300012224 | Grasslands Soil | MRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPR |
Ga0134027_10665001 | 3300012364 | Grasslands Soil | MRPKPPHAAESGVGEHTARESERAQSCATGKECVA |
Ga0134037_12036241 | 3300012372 | Grasslands Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAH |
Ga0134042_11946932 | 3300012373 | Grasslands Soil | MRPRHPHAAESGVGKHIARESESAQACAAGKERVANAH |
Ga0134029_10169631 | 3300012377 | Grasslands Soil | MRLKHPHAAESGVGKHNARESERVQACAAGKERVTNA |
Ga0134029_10271942 | 3300012377 | Grasslands Soil | MRPKDPHAAESGVGKHTARESERVQVCAAGKEHVTNA |
Ga0134025_10605471 | 3300012378 | Grasslands Soil | MRPKHLHAAESGVGKHNARESESVQACAAGKERVTNAHP |
Ga0134058_11980321 | 3300012379 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSHKLAP |
Ga0134047_10405131 | 3300012380 | Grasslands Soil | MRPKHPPALESGFGKHKARESESAQRCAAGKERVANAHP |
Ga0134047_10438291 | 3300012380 | Grasslands Soil | MRPKHPHAAESGVGKHTARESERVQVCAAGKEHVT |
Ga0134038_10630762 | 3300012382 | Grasslands Soil | MRPRHPHAAESGVGKHIARESESVKACAAGKERVTNA |
Ga0134033_11676771 | 3300012383 | Grasslands Soil | MRPKHLHAAESGVGKHNARESERVQVCAAGKERVTNAHPH |
Ga0134054_10861441 | 3300012390 | Grasslands Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLAP |
Ga0134054_12652561 | 3300012390 | Grasslands Soil | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0134035_10295012 | 3300012391 | Grasslands Soil | MRPKLRFAAESGVGKHTARESERAQSCATGKECVANTQ |
Ga0134043_10617461 | 3300012392 | Grasslands Soil | MRPKHPHAAESGVGKHIARESESAQACAAGKERVAN |
Ga0134052_11367931 | 3300012393 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAH |
Ga0134052_12872672 | 3300012393 | Grasslands Soil | MRSKATLAALSGVGEHTARESESAQGCAIGKERVASAHP |
Ga0134052_13011251 | 3300012393 | Grasslands Soil | MSPRHPHAAESGVGKHTARESESAQACAAGKERVA |
Ga0134044_12769691 | 3300012395 | Grasslands Soil | MRPRHPHAAESGVGKHNARESERVQACAAGKERVTNA |
Ga0134056_10485132 | 3300012397 | Grasslands Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0134056_10821281 | 3300012397 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAHS |
Ga0134051_10995431 | 3300012398 | Grasslands Soil | MRLKHPRAAESGVGKHTARESESAQACAAGKERVANA |
Ga0134051_13233542 | 3300012398 | Grasslands Soil | MRLKHPHAAESGVGKHNARESERVQACAAGKERVTNAHP |
Ga0134061_10262611 | 3300012399 | Grasslands Soil | MSPRHPHAAESGVGKHTARESESAQACAAGKERVAN |
Ga0134048_11911372 | 3300012400 | Grasslands Soil | MRPIHPHAADSGVGKHTARESERAQACATGKERVANA |
Ga0134055_12504111 | 3300012401 | Grasslands Soil | MRPRHPHAAESGVGKHTARESESAQACATGKERVANAHSH |
Ga0134055_13913991 | 3300012401 | Grasslands Soil | MRPKSPHAAESGVGKHTARESERVQACATGKERVTHAH |
Ga0134059_10535841 | 3300012402 | Grasslands Soil | MRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAH |
Ga0134049_11769341 | 3300012403 | Grasslands Soil | MRPKHPHAAESGVGKHIARESESAQACAAGKERVANAHPQ |
Ga0134049_13390811 | 3300012403 | Grasslands Soil | MRLKHPHAAESGVGKHNARESERVQVCAAGKERVTNAHPH |
Ga0134041_11066101 | 3300012405 | Grasslands Soil | MRPKHPHASESGVGKHTARESESAQACAAGKERVAN |
Ga0134041_13347692 | 3300012405 | Grasslands Soil | MRPKHPRAAESGVGKHTARESERAQACAAGKERVANAH |
Ga0134050_10620201 | 3300012407 | Grasslands Soil | MRPKHPPAAESGVGKHTARESERAQACAAGKERVA |
Ga0134045_14690851 | 3300012409 | Grasslands Soil | MRPKHPHAAESGVGKHIARESESAQACAAGKERVANAHP |
Ga0134060_12223511 | 3300012410 | Grasslands Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLA |
Ga0153880_13727311 | 3300012411 | Freshwater Sediment | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHPH |
Ga0150984_1056149181 | 3300012469 | Avena Fatua Rhizosphere | MRPKHPHAAESGVGKHTARESECAQECVAGKERVANAHPQDRKSVV |
Ga0150984_1063557511 | 3300012469 | Avena Fatua Rhizosphere | MRPKHPPAVESGFGKHKARESESAQRCAAGKERVANAHP |
Ga0150984_1096608541 | 3300012469 | Avena Fatua Rhizosphere | MRPKHPRAAESGVGKHTARESESAKACAAGKERVANAHSH |
Ga0129334_10066612 | 3300012471 | Aqueous | MRPKSAHAALSGVGEHTARESESAKCCAAGKERVANAH |
Ga0157560_10592941 | 3300012686 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQKRTQ |
Ga0157565_11384432 | 3300012689 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHP |
Ga0157575_1573871 | 3300012690 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPR |
Ga0157569_10533202 | 3300012691 | Freshwater | MRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHP |
Ga0157593_11302232 | 3300012699 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPH |
Ga0157572_11049041 | 3300012703 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPRD |
Ga0157623_11907541 | 3300012707 | Freshwater | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQ |
Ga0157611_10364802 | 3300012724 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACATGKERVANA |
Ga0157564_10890831 | 3300012747 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWP |
Ga0138278_10695221 | 3300012754 | Freshwater Lake | MRPKHPPAAESGVGKHTARESERVQACATGKERVTSAHP |
Ga0138281_11314501 | 3300012755 | Freshwater Lake | MRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHPH |
Ga0157628_10024091 | 3300012757 | Freshwater | MRPKPPHAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0138288_10857811 | 3300012761 | Freshwater Lake | MRPKHPPAAESGFGKHTARESERVQACATGKERVTSAHPH |
Ga0138288_11367551 | 3300012761 | Freshwater Lake | MRPKHPHAAESGVGKHTARESERAQACVTGKECVANTHP |
Ga0157624_11022111 | 3300012764 | Freshwater | MRPIHPHAAESGVGKHTARESERVQACATGKERVTNAH |
Ga0138276_12568371 | 3300012768 | Freshwater Lake | MRPKHPRAAESGVGEHTARESERAQACATGKERVANAHSHKLAP |
Ga0138279_11673241 | 3300012769 | Freshwater Lake | MRPKHPRAAESGVGDHTARESERAQACATGKERVANAHSH |
Ga0138287_10933861 | 3300012772 | Freshwater Lake | MRPKHPPAAESGFGKHTARESERVQACATGKERVTSAHP |
Ga0138280_10522181 | 3300012775 | Freshwater Lake | MRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHPHIWPR |
Ga0138275_13584871 | 3300012776 | Freshwater Lake | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAPE |
Ga0138292_11177561 | 3300012777 | Freshwater Lake | MRPKHPHAAESGVGKYTARESESAKACAAGKERVANAHS |
Ga0138269_13189881 | 3300012778 | Freshwater Lake | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQIWPR |
Ga0138286_10664492 | 3300012781 | Freshwater Lake | MRPKHPHAAESGVGKHTARESERVQACAAGKECVTN |
Ga0129335_10380642 | 3300012962 | Aqueous | MRPKHPHAAESGVGKHTARESESAQACAIGKERVANA |
Ga0129335_10612551 | 3300012962 | Aqueous | MRPRSAHAALSGVGEHTARESESAKCCAAGKERVANAH |
Ga0129340_12584321 | 3300012963 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWCAAGKERVANAH |
Ga0129343_10519121 | 3300012967 | Aqueous | MRPKSAHAALSGVGEHPARESESAKWCAAGKERVANAHPH |
Ga0154018_1032061 | 3300013043 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHITRESERAQACAAGKERVANA |
Ga0154018_1076401 | 3300013043 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGEHKARESESAQRCAAGKERVANA |
Ga0154018_1204951 | 3300013043 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHTARESERAEACAAGKERVANAH |
Ga0154019_1041551 | 3300013044 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGEHKARESESAQRCAAGKERVANAH |
Ga0154016_1032191 | 3300013045 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKL |
Ga0079038_1119752 | 3300013046 | Freshwater Wetlands | MRPKSAHAALSGVGEHTARESESAQCCAAGKERVANAH |
Ga0154014_1087111 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGEHKARESESAQRCAAGKERVANA |
Ga0154014_1459611 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHNARESERVQACAAGKERVTNAHPH |
Ga0154014_1620601 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIHPHAAESGVGKHTARESESAQACAAGKERVANA |
Ga0154012_1737461 | 3300013059 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAP |
Ga0154012_1744731 | 3300013059 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKYIARESERAQACITGKERVANA |
Ga0157563_10914322 | 3300013068 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQ |
Ga0153914_10314022 | 3300013078 | Freshwater Wetlands | MRPKHPHAAESGVGKHTARESESAQACAIGKERVANAHSHKLAS |
Ga0153914_11378022 | 3300013078 | Freshwater Wetlands | MRPIHPHAAESGVGKHTARESESAKACAAGKERVANAH |
Ga0153913_13675501 | 3300013080 | Freshwater Wetlands | MRPLHPHAAESGVGKHTARESESAKACAAGKERVANA |
Ga0170573_106683651 | 3300013232 | Sediment | MRPIHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEA* |
Ga0170791_153390771 | 3300013295 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWPR |
Ga0167638_10544121 | 3300015197 | Glacier Forefield Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRD |
Ga0180045_1430811 | 3300016678 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLAL |
Ga0180046_1084391 | 3300016680 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEPQGF |
Ga0180044_10516752 | 3300016682 | Freshwater | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAL |
Ga0180039_10671411 | 3300016688 | Freshwater | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIWPRDR |
Ga0180058_10688641 | 3300016699 | Freshwater | MRPRHPHAAESGVGKYTARESESVKACATGKERVTN |
Ga0181507_10182621 | 3300016705 | Peatland | MRPRHPHAAESGVGEHTARESERAQQCAIGKERVAN |
Ga0181500_11989361 | 3300016728 | Peatland | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPHTAK |
Ga0182042_11204201 | 3300016733 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHPHF |
Ga0182092_13423242 | 3300016734 | Salt Marsh | MRPKSAHAALSGFGEHPARESESAKWCAAGKERVAN |
Ga0182049_12328572 | 3300016736 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVAN |
Ga0182072_10355751 | 3300016754 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWCATGKERVANAHPH |
Ga0182091_10829641 | 3300016766 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWCAAGKERVANA |
Ga0188832_1005821 | 3300018549 | Freshwater Lake | MRPKSTHAALSGVGEHPARESESAKWSAAGKERVANA |
Ga0188884_10061261 | 3300018610 | Freshwater Lake | MRPKSTHAALSGVGEHPARESESAKWSAAGKERVANAHP |
Ga0184580_1240202 | 3300019158 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANA |
Ga0180035_10498641 | 3300019191 | Estuarine | MRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHPQ |
Ga0180033_1272521 | 3300019198 | Estuarine | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSR |
Ga0187789_11134381 | 3300019199 | Peatland | MRPKHPHAAESGVGKHNARESESAKACAAGKERVANAHP |
Ga0187789_11367711 | 3300019199 | Peatland | MSPRHPHAAESGVGKHTARESESAKACAAGKERVANAHP |
Ga0187789_11378911 | 3300019199 | Peatland | MRPRHPHAAESGVGKHNARESESAKACAAGKERVANAH |
Ga0187789_11960271 | 3300019199 | Peatland | MRPKHPHAAESGVGKHIARESESAKACAAGKERVANAHP |
Ga0187789_12032141 | 3300019199 | Peatland | MRPRHPHAAENSVGKHTARESESAKACAAGKERVANAH |
Ga0187789_12163542 | 3300019199 | Peatland | MRPRPPHAAESGVGKHNARESESAKACAAGKERVANAHP |
Ga0180036_10567761 | 3300019200 | Estuarine | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIW |
Ga0180032_10388771 | 3300019201 | Estuarine | MRPKPPHAAESGVGKHTARESESAKACADGEERVANAHS |
Ga0180032_10599981 | 3300019201 | Estuarine | MRPKHPHAAESGVGKHTARESERVQACATGKERVTHAHP |
Ga0180032_11058072 | 3300019201 | Estuarine | MRPKHPHAAESGVGKHITRESERAQACVIGKERVANAHTH |
Ga0180032_11404082 | 3300019201 | Estuarine | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHS |
Ga0179940_11453671 | 3300019205 | Anaerobic Digestor Sludge | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPH |
Ga0180110_10337542 | 3300019208 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0180110_10350772 | 3300019208 | Groundwater Sediment | MRPRSALAALSGVGEHTARESESAQCCAVGKERVANAH |
Ga0180110_11838741 | 3300019208 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESERAEACAAGKERVANA |
Ga0179951_11752071 | 3300019209 | Anaerobic Digestor Sludge | MRPRSAHAALSGVGEHTARESESAQCCATGEERVANAHPHF |
Ga0187799_10041791 | 3300019211 | Peatland | MSPKHPHAAESGVGKHTARESERAQACAIGKERVANAH |
Ga0187799_10658241 | 3300019211 | Peatland | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAH |
Ga0187799_11585961 | 3300019211 | Peatland | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0187799_11841071 | 3300019211 | Peatland | MRPRHPHAAESGVGKHIARESESAKACAAGKERVANAHP |
Ga0187799_12704291 | 3300019211 | Peatland | MRPKHPHAAESGVGKHIARESESAQACAAGKERVANAH |
Ga0180106_10119421 | 3300019212 | Groundwater Sediment | MRPIHPRAAESGVGKHTARESERAQACATGKERVANAH |
Ga0180106_11205221 | 3300019212 | Groundwater Sediment | MRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHPQ |
Ga0180106_12586501 | 3300019212 | Groundwater Sediment | MRPRHPHAAESGVGKYTARESESAQACAIGKERVANAH |
Ga0180106_13323292 | 3300019212 | Groundwater Sediment | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0179950_11625291 | 3300019213 | Anaerobic Digestor Sludge | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANA |
Ga0179945_11618421 | 3300019215 | Anaerobic Digestor Sludge | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAH |
Ga0179939_10927041 | 3300019216 | Anaerobic Digestor Sludge | MRPIHPHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0179941_10827891 | 3300019221 | Anaerobic Digestor Sludge | MRPKHPHAAESGVGKHTARESERAQACATGKERVANA |
Ga0179949_10713991 | 3300019225 | Anaerobic Digestor Sludge | MRPRSAHAALSGVGEHTARESESAQCCANGKERVANA |
Ga0179949_11913521 | 3300019225 | Anaerobic Digestor Sludge | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKL |
Ga0180119_10307401 | 3300019228 | Groundwater Sediment | MRPKHPHAAESGVGEHTARESERAQQCADGKERVANAHPQIWP |
Ga0180119_10467781 | 3300019228 | Groundwater Sediment | MRPRPPHAAESGVGKHTARESERVQACATGKERVTHAHP |
Ga0180119_11577921 | 3300019228 | Groundwater Sediment | MRPKTLHAAESGVGEHTARESESAQACAIGKERVANAHSHKLAP |
Ga0180119_11838391 | 3300019228 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESERVQACAAGKERVT |
Ga0180116_11708292 | 3300019229 | Groundwater Sediment | MRPIHPHAAESGVGKHTARESESAQACAAGKERVAN |
Ga0179935_10386891 | 3300019231 | Anaerobic Digestor Sludge | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPHFE |
Ga0180114_10167101 | 3300019232 | Groundwater Sediment | MRPKHPHAAESGVGKHTARESERAQACAAGKERVAN |
Ga0184645_10930241 | 3300019233 | Groundwater Sediment | MRPRSLHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0184645_11767051 | 3300019233 | Groundwater Sediment | MRPKTLHAAESGVGEHTARESESAQECAIGKERVANAH |
Ga0172288_12076121 | 3300019234 | Wetland | MRPIHPHAAESGVGKHTARESESAKACAAGKERVAN |
Ga0180112_10834821 | 3300019238 | Groundwater Sediment | MRPRHPRAAESGVGKHTARESERAQACATGKERVANAHPH |
Ga0180112_11878681 | 3300019238 | Groundwater Sediment | MRPKHPHAAESGVGKYTARESESAKECAAGKERVANAHPQNW |
Ga0187793_10265021 | 3300019241 | Peatland | MRPIHPHAAESGVGKHTARESESAQACADGKERVANAHP |
Ga0187793_10985782 | 3300019241 | Peatland | MRSKAALAALSGVGKHTARESEGAKACVIGKERVANAHP |
Ga0187793_10987081 | 3300019241 | Peatland | MRPKHPHAAESGVGKHTARESESAKACAAGKERVAN |
Ga0187793_11044411 | 3300019241 | Peatland | MRPKHPHAAESGVGKHTARESESAQACAAGKERVAN |
Ga0187793_11325281 | 3300019241 | Peatland | MRPKHPHAAESGVGKYTARESESAQACAAGKERVANAH |
Ga0187793_11452721 | 3300019241 | Peatland | MRPKHPHAAESGVGKHTARESERAEACATGKERVANAHP |
Ga0187793_11483241 | 3300019241 | Peatland | MRPKHPHAAESGVGEHTARESESAQQCAIGKERVANAH |
Ga0187793_11531972 | 3300019241 | Peatland | MRPKHPRAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0187793_11730161 | 3300019241 | Peatland | MRPRHPHAAESGVGKHIARESESAKACAAGKERVANAH |
Ga0187793_13251101 | 3300019241 | Peatland | MRPRHPHAAESGVGKHIARESESAKACAAGKERVANAHPQ |
Ga0187793_13265331 | 3300019241 | Peatland | MRPKYPHAAESGVGKHTARESESAQACAAGKERVANAHPH |
Ga0187793_13656552 | 3300019241 | Peatland | MRPRHPHAAESGVGEHKARESESAQHCAAGKERVANA |
Ga0187793_14670171 | 3300019241 | Peatland | MRPRSAHAALSGVGEHTARESEAPNVCAGKERVAHAH |
Ga0180111_10034012 | 3300019244 | Groundwater Sediment | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHS |
Ga0180111_10527051 | 3300019244 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESESAQACADGKERVASAHP |
Ga0180111_10801541 | 3300019244 | Groundwater Sediment | MRPIHPHAADSGVGKHTARESESAQACAIGKERVANAHSH |
Ga0180111_11115761 | 3300019244 | Groundwater Sediment | MRLKHPHAAESGVGKHIARESESAKACAAGKERVANAH |
Ga0180111_12017211 | 3300019244 | Groundwater Sediment | MRPIHPRAAESGVGKHTARESERAQACATGKERVANAHPH |
Ga0187791_10613341 | 3300019245 | Peatland | MRPKHPHAAESGVGEHTARESESAQRCAIGKERVANAH |
Ga0187791_11094151 | 3300019245 | Peatland | MRPKHPHAVESGVGKHTARESERVQACAAGKERVTN |
Ga0187791_11125571 | 3300019245 | Peatland | MRPRHPHAAESGVGKHNARESESAKACAAGKERVANAHPQ |
Ga0187791_11305241 | 3300019245 | Peatland | MRPKHPHAAESGVGKHNARESESAKACAAGKERVANAHPQ |
Ga0187791_12079851 | 3300019245 | Peatland | MSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0187791_12102981 | 3300019245 | Peatland | MRPKHPHAAESGVGKHTARESERAEACAAGKERVANAHP |
Ga0187791_12397642 | 3300019245 | Peatland | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHP |
Ga0187791_12545732 | 3300019245 | Peatland | MRPRHPHAAESGVGKHTARESESAQACAAGKERVAN |
Ga0187791_12553851 | 3300019245 | Peatland | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0187791_12683951 | 3300019245 | Peatland | MRPKHPHAAESGVGKHTARESESAQECAAGKERVANAHP |
Ga0187791_12930121 | 3300019245 | Peatland | MRPRHPHAAENSVGKHTARESESAKACAAGKERVANAHP |
Ga0187791_13069181 | 3300019245 | Peatland | MRPRHPHAAESGVGKHTARESERAEACAAGKERVANAHP |
Ga0187791_14069891 | 3300019245 | Peatland | MRPIHPHAAESGVGEHTARESESAQRCAIGKERVAN |
Ga0187791_14904771 | 3300019245 | Peatland | MRPRHPHAAESGVGEHTARESEAPNSVQWKERAANA |
Ga0187791_14911701 | 3300019245 | Peatland | MRPKHPHAAESGVGKHIARESESAQACAAGKERVANA |
Ga0179937_12736441 | 3300019247 | Anaerobic Digestor Sludge | MRPIHPHAADSGVGKHTARESESAQACAAGKERVANAH |
Ga0179937_13522721 | 3300019247 | Anaerobic Digestor Sludge | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0180117_12777401 | 3300019248 | Groundwater Sediment | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTN |
Ga0180117_14068362 | 3300019248 | Groundwater Sediment | MRPKSAHAALSGVGEHTARESESAQCCAVGKERVANA |
Ga0184648_11967531 | 3300019249 | Groundwater Sediment | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHP |
Ga0184648_13898111 | 3300019249 | Groundwater Sediment | MRPKHPHAVESGVGKHTARESERVQACAAGKERVTNAH |
Ga0184648_13964641 | 3300019249 | Groundwater Sediment | MRPKHPHAAESGVGKYTARESESAKACADGKERVANAH |
Ga0187790_10310911 | 3300019250 | Peatland | MRPRHPHAAESGVGKHTARESESAKACATGKERVANAHP |
Ga0187790_10320532 | 3300019250 | Peatland | MRPRHPHAAESGVGEHKARESESAQHCAAGKERVA |
Ga0187790_10701941 | 3300019250 | Peatland | MRPKHPHAAESGVGKYTARESESAKACAAGKERVANAH |
Ga0187790_11301241 | 3300019250 | Peatland | MRPRHPRAAESGVGKHIARESESAKACAAGKERVANAHPH |
Ga0187790_12780651 | 3300019250 | Peatland | MSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHPQ |
Ga0187790_15159501 | 3300019250 | Peatland | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHP |
Ga0187790_15163122 | 3300019250 | Peatland | MRPIHPHAAESGVGEHKARESESAQRCAAGKERVANAHP |
Ga0187795_12412901 | 3300019251 | Peatland | MRPRHPHAAESGVGKHTARESESAKACAAGKERVAN |
Ga0172286_11282821 | 3300019252 | Wetland | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAH |
Ga0172286_15757011 | 3300019252 | Wetland | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0184641_11591352 | 3300019254 | Groundwater Sediment | MRPIHPHAAESGVGKHTARKCERVQACAAGKERVTNAHPHKLA |
Ga0184641_12843221 | 3300019254 | Groundwater Sediment | MRPRHPRAAESGVGKHTARDSEGVQACAAGKERVTNAH |
Ga0184643_10169711 | 3300019255 | Groundwater Sediment | MRPIHPHAADSGVGKHTARESERVQACAAGKERVTNA |
Ga0184643_11029852 | 3300019255 | Groundwater Sediment | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTN |
Ga0184643_12243271 | 3300019255 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESERAQLCADGKERVANAHP |
Ga0184643_14508211 | 3300019255 | Groundwater Sediment | MRPRHPHAAESGVGRHIARESESVQACAAGKERVTNAHP |
Ga0184643_14839601 | 3300019255 | Groundwater Sediment | MRPRASHAAVSGVGKHTARESERAQLCADGKERVANA |
Ga0180115_10656661 | 3300019257 | Groundwater Sediment | MRPKHPHAAESGVGKHNARESESVQACAAGKERVTNAHPQKLA |
Ga0180115_12329621 | 3300019257 | Groundwater Sediment | MRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAH |
Ga0180115_12757452 | 3300019257 | Groundwater Sediment | MRLKHPHAAESGVGKHTARESERAQACATGKERVAN |
Ga0180115_14336491 | 3300019257 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHS |
Ga0181504_10477951 | 3300019258 | Peatland | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0184646_11157801 | 3300019259 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQ |
Ga0184646_13522761 | 3300019259 | Groundwater Sediment | MRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAHPH |
Ga0181506_14285721 | 3300019260 | Peatland | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIW |
Ga0184647_11531311 | 3300019263 | Groundwater Sediment | MRPRHPHAAESVLEKYTGRESESANACAIGKERVANAHS |
Ga0187796_10168232 | 3300019264 | Peatland | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHP |
Ga0187796_11792131 | 3300019264 | Peatland | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPH |
Ga0187792_10102822 | 3300019265 | Peatland | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANA |
Ga0187792_10629111 | 3300019265 | Peatland | MRPIHPHAAESGVGEHTARESESAQRCAIGKERVANAHP |
Ga0187792_11085451 | 3300019265 | Peatland | MRPKHPHAAENSVGKHIARESESAKACAAGKERVANAHPH |
Ga0187792_11112671 | 3300019265 | Peatland | MSPRYPHAAESGVGKHTARESERVQACAAGKERVTNAHPQNLAP |
Ga0187792_14669862 | 3300019265 | Peatland | MRPRHPHAAESGVGEHKARESEGAQRCAAGKERVANAHP |
Ga0187792_14675451 | 3300019265 | Peatland | MRPKHPHAAESGVGKHTARESESAQECAAGKERVAN |
Ga0187792_15189081 | 3300019265 | Peatland | MRPRHPHAAESGVGEHTARESEAPNSVQWKERAANAH |
Ga0187792_16708931 | 3300019265 | Peatland | MRPRHPHAAESGVGKHTARESERAEACAAGKERVANAHPQKL |
Ga0182069_15508961 | 3300019267 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWCATGKERVAN |
Ga0181514_13025461 | 3300019268 | Peatland | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHIWP |
Ga0184644_10181211 | 3300019269 | Groundwater Sediment | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPH |
Ga0184644_11403121 | 3300019269 | Groundwater Sediment | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAH |
Ga0184644_11621121 | 3300019269 | Groundwater Sediment | MRPRHPHAAESGVGKHTARESERVQACAAGKEHVT |
Ga0184644_15618241 | 3300019269 | Groundwater Sediment | MRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAH |
Ga0181512_17339831 | 3300019270 | Peatland | MRPRHPHAAESGVGEHTARESERAQQCAIGKERVANAHP |
Ga0187794_11911191 | 3300019273 | Peatland | MRPKHPHAAESGVGKHTARESERAEACATGKERVANAHPQ |
Ga0187794_17296461 | 3300019273 | Peatland | MRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0182081_14148652 | 3300019277 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWCATGKERVANAHP |
Ga0187800_12325212 | 3300019278 | Peatland | MRSKPSLAAVSGVGEHTARESESAQGCATGKECVA |
Ga0184642_11257111 | 3300019279 | Groundwater Sediment | MRPIHPHAAESGVGKYTARESERVQACAAGKERVTNAHP |
Ga0184642_11602291 | 3300019279 | Groundwater Sediment | MRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAHPQ |
Ga0184642_12233382 | 3300019279 | Groundwater Sediment | MRPKHLHAAESGVGKHIARESERVQVCAAGKERVTNAHPH |
Ga0182077_16380962 | 3300019281 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWCATGKERVA |
Ga0182044_13087421 | 3300020014 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANA |
Ga0180118_12407101 | 3300020063 | Groundwater Sediment | MRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAHPHFEP |
Ga0180118_12499811 | 3300020063 | Groundwater Sediment | MRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHPQNWGSTKM |
Ga0180107_10480601 | 3300020064 | Groundwater Sediment | MRPIHPHAAESGVVKHTARESERVQACAAGKEHVTNAHP |
Ga0180113_11427372 | 3300020065 | Groundwater Sediment | MRPRHPHAAESGVGEHTARKSESAQCVYREERAASAH |
Ga0180109_12073371 | 3300020067 | Groundwater Sediment | MRLKHPHAAESGVGKHIARESESAKACAAGKERVANAHP |
Ga0180109_12949841 | 3300020067 | Groundwater Sediment | MRPRSAHAALSGVGEHTARESESAQCCAVGKERVANAHPHFEPG |
Ga0180109_13466021 | 3300020067 | Groundwater Sediment | MRPKLRYAAESGVGKHTAPHCESAKTCAIEERAASA |
Ga0184649_14665471 | 3300020068 | Groundwater Sediment | MRPKSAHAALSGVGEHTARESESAQCCAVGKERVANAHP |
Ga0197907_108683371 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHIARESESAKACAAGKERVANA |
Ga0206356_100891352 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAHP |
Ga0206356_103243891 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAQACAAGKERVA |
Ga0206356_106243531 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKPPHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0206356_115863862 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKYIARESESAQACTAGKERVA |
Ga0206349_15289262 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHP |
Ga0206349_19191981 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPRAAESGVGKHIARESESAKACAAGKERVANA |
Ga0206349_19833551 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKHPHAAESGVGKHTARESESAKACAAGKERVANAHP |
Ga0206355_10141711 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAS |
Ga0206355_12235121 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAVESGVGEHKARESESAQRCAAGKERVAN |
Ga0206355_14320551 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHNARESERVQACAAGKEHVTNAHP |
Ga0206352_106752351 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKLAPE |
Ga0206352_108475181 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHPH |
Ga0206350_107235011 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0206350_111998282 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKYIARESESAQACTAGKERVANA |
Ga0211734_105253282 | 3300020159 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRN |
Ga0154015_13520821 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKYIARESESAQACTAGKERVANAH |
Ga0154015_13528121 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRHPHAAESGVGKYIARESESAQACTAGKERVANAHP |
Ga0154015_14540811 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKHIARESESAKACAAGKERVANAHPHKLAP |
Ga0179584_10023341 | 3300021151 | Vadose Zone Soil | MRPKHPHAAESGVGEHTARESERAQQCADGKERVANAH |
Ga0179584_11954401 | 3300021151 | Vadose Zone Soil | MRPKLRLVAESGVGKHTARESEGAQACAMGERVANA |
Ga0210329_1105381 | 3300021257 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACVTGKERVANAH |
Ga0210345_1137871 | 3300021258 | Estuarine | MRPKHPHAAESGVGKHTARESESAKACANGKERVANAHSHKLA |
Ga0210345_1459632 | 3300021258 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWSADGKERVANAH |
Ga0210353_1083482 | 3300021267 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAH |
Ga0210294_1089361 | 3300021268 | Estuarine | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHS |
Ga0210356_1841702 | 3300021269 | Estuarine | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0210360_1042052 | 3300021270 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHSH |
Ga0210360_1688982 | 3300021270 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAHP |
Ga0210340_10554521 | 3300021273 | Estuarine | MRPRHPHAAESGVGKHTARESERVQACATGKERVTHAHPH |
Ga0210340_10728601 | 3300021273 | Estuarine | MRPKAPPAAGSGVGKHTARESERVQACATGKERVTNAHSHKL |
Ga0210327_1442362 | 3300021274 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWCAEGKERVANAHPH |
Ga0210303_10408641 | 3300021282 | Estuarine | MRPKHPHAAESGVGKHTARESESAQACAIGKERVANAHSH |
Ga0210357_10252901 | 3300021283 | Estuarine | MRPIHPHAAESGVGKHTARESERAQACATGKERVANAHSH |
Ga0210357_10337382 | 3300021283 | Estuarine | MRPKHPHAAESGVGEHTARESESAKRCAVGKERVANAHP |
Ga0210357_10466991 | 3300021283 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPHFDPG |
Ga0210357_10668941 | 3300021283 | Estuarine | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAH |
Ga0210357_10826841 | 3300021283 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHH |
Ga0210299_1388662 | 3300021284 | Estuarine | MRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHP |
Ga0179583_10260511 | 3300021286 | Vadose Zone Soil | MRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAHPHNLAL |
Ga0179583_10297111 | 3300021286 | Vadose Zone Soil | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAH |
Ga0179583_10330411 | 3300021286 | Vadose Zone Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0179583_10696922 | 3300021286 | Vadose Zone Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAH |
Ga0179583_10932901 | 3300021286 | Vadose Zone Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKECVANTHP |
Ga0210338_1872852 | 3300021287 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHS |
Ga0210355_10019281 | 3300021292 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHS |
Ga0210355_10064542 | 3300021292 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHP |
Ga0210325_10499882 | 3300021294 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANA |
Ga0210325_10894731 | 3300021294 | Estuarine | MRPRHPHAAESGVGKHTARESESAKACAIGKERVANAHS |
Ga0210328_10461692 | 3300021302 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANAH |
Ga0179585_10004911 | 3300021307 | Vadose Zone Soil | MRPKHPHAAESGVGEHTARESERAQQCAVGKERVANAHP |
Ga0179585_10540321 | 3300021307 | Vadose Zone Soil | MRPKYPHAAESGVGQHTARESESAQPCAIGKERVAN |
Ga0179585_10734732 | 3300021307 | Vadose Zone Soil | MRPKTLHAAESGVGEHTARESESAQQCAVGKERVANAH |
Ga0210370_10985442 | 3300021314 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHP |
Ga0179958_10063822 | 3300021315 | Vadose Zone Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTN |
Ga0179958_11687881 | 3300021315 | Vadose Zone Soil | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHP |
Ga0210351_13464381 | 3300021316 | Estuarine | MRPKSTHAALSGVGEHPARESESAKWCAEGKERVANA |
Ga0210309_11658612 | 3300021317 | Estuarine | MRPKHPPAAESGVGKHTARESERAQACVTGKECVANTHPQ |
Ga0210295_11765341 | 3300021323 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACVTGKECVANTH |
Ga0210301_12338412 | 3300021325 | Estuarine | MRPNPPPAAESGVGKHTARESERAQACVTGKECVANTH |
Ga0210362_11890581 | 3300021329 | Estuarine | MRPRHPHAAESGVGKHTARESERVQACATGKERVTNAHPH |
Ga0210347_10842651 | 3300021331 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVANAHSHKL |
Ga0210324_10373811 | 3300021333 | Estuarine | MRPKHPPAAESGVGKHTARESERAQACATGKERVANAHSHKSWETRIA |
Ga0210324_13315151 | 3300021333 | Estuarine | MRPKHPHAAKSGVGKHTARESERAQACATGKERAAN |
Ga0210324_13761671 | 3300021333 | Estuarine | MRPRHPHAAESGVGKHTARESESAQACATGKERVA |
Ga0210307_11186612 | 3300021336 | Estuarine | MRPNPPPAAESGVGKHTARESERAQACVTGKECVANTHPQIR |
Ga0210307_13912771 | 3300021336 | Estuarine | MRPKHPPAAESGVGKHTARESERAQACVTGKECVANTH |
Ga0210392_106589311 | 3300021475 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAPGPQGSGALLFLWLKHGTR |
Ga0194060_103044701 | 3300021602 | Anoxic Zone Freshwater | MRPKHPPAEESGVGKHTARESERAQSCATGKERVA |
Ga0210304_10914961 | 3300021849 | Estuarine | MRPKHPPAAESGVGKHTARESERAQACATGKERVANAH |
Ga0210304_10917331 | 3300021849 | Estuarine | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0210317_11585642 | 3300021852 | Estuarine | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAH |
Ga0210323_10000511 | 3300021853 | Estuarine | MRPIHPHAAESGVGKHTARESERVQACATGKERVTNA |
Ga0210323_10137601 | 3300021853 | Estuarine | MRPIHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP |
Ga0210323_10917531 | 3300021853 | Estuarine | MRPRHPHAAESGVGKRTARESERVQACVKGEERVTSAHTRKLA |
Ga0210323_11102112 | 3300021853 | Estuarine | MRPKHPLAAESGVGEHTARESERAQACAAGKERVANAH |
Ga0210323_11240781 | 3300021853 | Estuarine | MRPIHPHAAESGVGEHTARESESAKCCAAGKERVANA |
Ga0213854_10454782 | 3300021855 | Watersheds | MRPRHPHAAESGVGKHTARESERAQACAAGKERVA |
Ga0213854_11484031 | 3300021855 | Watersheds | MRPRHPHAAESGVGEHKARESESAQRCAAGKERVANAHP |
Ga0213854_12890871 | 3300021855 | Watersheds | MRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPQNS |
Ga0213850_11906451 | 3300021856 | Watersheds | MRPKHPHAAESGVGKHTARESERAQACAIGKERVANAHP |
Ga0213849_11544161 | 3300021857 | Watersheds | MRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPQNSAPE |
Ga0213852_14271721 | 3300021858 | Watersheds | MRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHP |
Ga0210334_111244551 | 3300021859 | Estuarine | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSH |
Ga0213851_10292421 | 3300021860 | Watersheds | MRPNATLAALSGVGEHTARESESAQGCATGKECVASTH |
Ga0213851_14486901 | 3300021860 | Watersheds | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHP |
Ga0213851_14496862 | 3300021860 | Watersheds | MRPKHPHAAESGVGEHTARESESAQRCAAGKERVANAHP |
Ga0213851_18207401 | 3300021860 | Watersheds | MRPKHPHAAESGVGKHTARESEGAKACAAGKERVANAHP |
Ga0213853_107300741 | 3300021861 | Watersheds | MRPRSAHAALSGVGEHPARESESAKWCAEGKERAANAHP |
Ga0213845_10066791 | 3300021929 | Watersheds | MRPKHPHAVESGVGKHTARESERVQVCAAGKERVTPAH |
Ga0213845_10718321 | 3300021929 | Watersheds | MRPRSAHAALSGVGEHTARESEAPNVCAGKERVANAH |
Ga0213845_11756381 | 3300021929 | Watersheds | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPQ |
Ga0213845_11766801 | 3300021929 | Watersheds | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQ |
Ga0213847_10760072 | 3300021938 | Watersheds | MRPKHPPAAESGVGKHTARESERAQACAIGKECVANTHP |
Ga0213847_10803822 | 3300021938 | Watersheds | MRPRHPHAAESGVGKYIARESERVQACTAGKERVTNAHPHNLALKP |
Ga0213847_10942891 | 3300021938 | Watersheds | MRPKHPPAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0213847_12035891 | 3300021938 | Watersheds | MRPKHPHAAESGVGKHNARESESVKVCAAGKERVTNAHP |
Ga0213856_10466341 | 3300021947 | Watersheds | MRPELPHAAESGVGEHTARESERAQQCAIGKERVANAHP |
Ga0213856_11382621 | 3300021947 | Watersheds | MRPKHPHAAESGVGEHTARESESAKCCAAGKERVANAHPHFDPG |
Ga0213856_12176201 | 3300021947 | Watersheds | MRPKAPPAAGSGVGKHTARESERVQACAAGKERVTNAHP |
Ga0213848_10548071 | 3300021967 | Watersheds | MRPIAPLAAVSGVGKHTARESESAQQCAAGKERVANAHP |
Ga0213848_10970351 | 3300021967 | Watersheds | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAH |
Ga0232063_11503402 | 3300021969 | Anaerobic Bioreactor Biomass | MRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAH |
Ga0232057_11460791 | 3300021970 | Anaerobic Bioreactor Biomass | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHPH |
Ga0213933_1114871 | 3300022141 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSH |
Ga0213933_1116591 | 3300022141 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACSTGKERVANAHS |
Ga0213855_10303101 | 3300022144 | Watersheds | MRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQIWPR |
Ga0213855_11215911 | 3300022144 | Watersheds | MRPRHPHAAESGVGKHTARESERVQACAAGKEHVTNAH |
Ga0213930_1067892 | 3300022147 | Freshwater | MRPRHPHAAESGVGEHTARESERAQQCAIGKERVANAHPH |
Ga0213930_1155181 | 3300022147 | Freshwater | MRPRSAHAALSGVGEHTARESEAPNVCAGKECVASTH |
Ga0232064_1161462 | 3300022151 | Anaerobic Bioreactor Biomass | MRPRSAHAALSGVGEHPARESESAKWCATGEERVANAH |
Ga0213929_10107742 | 3300022154 | Freshwater | MRPKHPLAAESGVGEHTARESERAQACAAGKERVANAHPH |
Ga0213929_10123231 | 3300022154 | Freshwater | MRPIHPHAAESGVGEHTARESESAQQCASGKERVASAHP |
Ga0213929_10251511 | 3300022154 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHP |
Ga0213934_10334501 | 3300022156 | Freshwater | MRPKHPPAAESGVGEHTARESERAQACAAGKERVANAH |
Ga0213934_10378011 | 3300022156 | Freshwater | MRPIHPHAAESGVGEHKARESESAQQCAAGKERVANAHP |
Ga0213931_10422971 | 3300022161 | Freshwater | MRPKHPLAAESGVGEHTARESESAQACVIGKERVANAH |
Ga0213931_10497461 | 3300022161 | Freshwater | MRPRHPHAAESGVGKYTARESESAKACAAGKERVANAH |
Ga0213932_10311021 | 3300022166 | Freshwater | MRPIHPHAADSGVGKHTARESESAQACAIGKERVANAH |
Ga0213932_10389361 | 3300022166 | Freshwater | MRPRHPHAAESGVGEHTARESERAQRCAIGKERVANAHSH |
Ga0213857_10133081 | 3300022171 | Watersheds | MRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAHPQIWP |
Ga0213857_10140152 | 3300022171 | Watersheds | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPH |
Ga0213857_10142881 | 3300022171 | Watersheds | MRPRHPHAAESGVGKHTARESERAQACATGKERVANAHP |
Ga0079039_12792751 | 3300022185 | Freshwater Wetlands | MRPRHPRAAESGVGKHTARESESAKACAAGKERVANAHSHK |
Ga0222625_11669241 | 3300022195 | Groundwater Sediment | MRPRSLHAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0226658_101772121 | 3300022222 | Freshwater Microbial Mat | MRPVSALAALSGVGEHTARESERAQCCANGKECVASTHTQIWP |
Ga0210293_1133821 | 3300022372 | Estuarine | MRPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPH |
Ga0210319_10099742 | 3300022373 | Estuarine | MRPIHPHAAESGVGKHTARESESAKACAIGKERVAN |
Ga0210376_10245311 | 3300022385 | Estuarine | MRPRHPHAAESGVGKHTARESERAQACATGKERVANAH |
Ga0224712_102440011 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGKYIARESERAQACITGKERVANAHPQNLAP |
Ga0242644_10111721 | 3300022498 | Soil | MRPRHPHAAESGVGKHTARESESAKACAVGKERVANAHP |
Ga0242644_10112151 | 3300022498 | Soil | MRPKHPHAAESGVGKYTARESERAQSCTTGKERVANA |
Ga0242641_10107721 | 3300022499 | Soil | MRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAHP |
Ga0242641_10108141 | 3300022499 | Soil | MRPKHPHAAESGVGKHTARESERAQACANGKERVANAHP |
Ga0242641_10312001 | 3300022499 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQI |
Ga0242646_10087782 | 3300022502 | Soil | MRPKHPHAAESGVGKHIARESERAQACANGKEHVAHAH |
Ga0242650_10060991 | 3300022503 | Soil | MRPRHPHAAESRVGKHTARESERVQACAAGKERVTNA |
Ga0242642_10243311 | 3300022504 | Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANA |
Ga0242642_10348031 | 3300022504 | Soil | MRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANA |
Ga0242642_10519251 | 3300022504 | Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNL |
Ga0242642_10644651 | 3300022504 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNL |
Ga0242647_10115162 | 3300022505 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVAN |
Ga0242648_10229351 | 3300022506 | Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAH |
Ga0242648_10241551 | 3300022506 | Soil | MRPRHPHAAESGVGKHTARESESAKACAVGKERVAN |
Ga0242648_10294952 | 3300022506 | Soil | MRPKHPHAAESGVGKHIARESERAQACATGKERVAN |
Ga0222729_10168581 | 3300022507 | Soil | MRPKHPHAAESGVGKHIARESERAQACATGKERVANAHPHKLAS |
Ga0222729_10178041 | 3300022507 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTHAH |
Ga0222729_10304451 | 3300022507 | Soil | MRPRHPHAAESGVGKHTARESERVHACAAGKERVTNA |
Ga0242652_10139052 | 3300022510 | Soil | MRPRHPRAAESGVGKHTARESERAQACAAGKERVANA |
Ga0242652_10354471 | 3300022510 | Soil | MRPKHPHAAESGVGKHTASESERVQACAAGKERVTN |
Ga0242651_10118011 | 3300022511 | Soil | MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP |
Ga0242669_10359221 | 3300022528 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVA |
Ga0242668_10525001 | 3300022529 | Soil | MRPRHPHAAESGVGKHTARESESAKACAVGKERVANA |
Ga0242658_10622381 | 3300022530 | Soil | MRPKHPHAAESGVGEHTARESERAQRCAIGKERVANA |
Ga0242658_10800571 | 3300022530 | Soil | MRPKHPHAAESGVGKHTARESERAQACANGKERVANA |
Ga0242658_11231911 | 3300022530 | Soil | MRPKHPHAAESSVGEHTARESERAQQCAIGKECVAS |
Ga0242658_11278131 | 3300022530 | Soil | MRPIHPHAADSGVGKHTARESERAQACAAGKERVANA |
Ga0242660_10685601 | 3300022531 | Soil | MRPRHPPAAESGVGKHTARESERAQACANGKECVANT |
Ga0242660_10710901 | 3300022531 | Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVAN |
Ga0242660_10726221 | 3300022531 | Soil | MRPRHPRAAESGVGKHTARESESAKACAAGKERVANA |
Ga0242660_10902781 | 3300022531 | Soil | MRPKHPHAAESGVGKHTTRESESAKVCAAGKERVANAH |
Ga0232058_14286582 | 3300022645 | Anaerobic Bioreactor Biomass | MRPRSALAALSGVGEHAARESESAQCRAAGKERVANAH |
Ga0232059_10424971 | 3300022652 | Anaerobic Bioreactor Biomass | MRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAHPH |
Ga0242670_10190512 | 3300022708 | Soil | MRPKHPRAAESGVGKHTARESESAQACAAGKERVANA |
Ga0242670_10190522 | 3300022708 | Soil | MRPKHPHAAESGVGKHTTRESESAKVCAAWKERVANAH |
Ga0242670_10563991 | 3300022708 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVAN |
Ga0222756_10240201 | 3300022709 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAH |
Ga0242653_10131401 | 3300022712 | Soil | MRPKHPPAAESGVGKHIARESERAQACANGKECVAHTHPR |
Ga0242653_10296761 | 3300022712 | Soil | MRPKHPHAAESGVGKHTTRESESAKVCAAGKERVAN |
Ga0242677_10055411 | 3300022713 | Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALE |
Ga0242677_10198621 | 3300022713 | Soil | MRPKHPHAAESGVGKYTARESERAQSCTTGKERVANAHPQNLAS |
Ga0242671_10302022 | 3300022714 | Soil | MRPRHPHAAESGVGKHIARESERAQACANGKEHVAH |
Ga0242675_10956711 | 3300022718 | Soil | MRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAHP |
Ga0242672_10295181 | 3300022720 | Soil | MRPKHPHAAESGVGEHTARESERAQRCAIGKERVANAH |
Ga0242672_10302931 | 3300022720 | Soil | MRPRQPHAAESGVGKHTARESERAQACAAGKERVANA |
Ga0242672_10310772 | 3300022720 | Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAN |
Ga0242672_10310841 | 3300022720 | Soil | MRPIHSHAAKSGVGKHTARESERVQACAAGKERVTNAH |
Ga0242672_10582111 | 3300022720 | Soil | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAH |
Ga0242666_10578481 | 3300022721 | Soil | MRPKHPHAAESGVGKYIARESERAQVCITGKERVANAHPQNLAS |
Ga0242666_10608091 | 3300022721 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHP |
Ga0242666_10743511 | 3300022721 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNLAP |
Ga0242666_10797551 | 3300022721 | Soil | MRPKHPHAAESGVGKHVARESERVQACAAGKERVTNA |
Ga0242666_11443161 | 3300022721 | Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERLTN |
Ga0242657_10699281 | 3300022722 | Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHNL |
Ga0242657_10715861 | 3300022722 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAH |
Ga0242657_10733911 | 3300022722 | Soil | MRPRHPLGAESAVGKHAARESERAQACAAGKERVA |
Ga0242665_101146211 | 3300022724 | Soil | MRPRHPRAAESGVGKHTARESESAKACAVGKERVANAHP |
Ga0242665_101188161 | 3300022724 | Soil | MRPKHPHAAESGVGKYIARESERAQACITGKERVANAH |
Ga0242665_101192671 | 3300022724 | Soil | MRPKHPHAAESGAGKHTARESESAQACAAGKERVAN |
Ga0242665_101890171 | 3300022724 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANA |
Ga0242654_101376462 | 3300022726 | Soil | MRPKHPHAAESGVGKYTARESERAQSCTTGKERVANAH |
Ga0242654_101380181 | 3300022726 | Soil | MRPKHPHAAESGVGKHIARESERVQACATGKERVTN |
Ga0242654_101406491 | 3300022726 | Soil | MTPKHPQAAQSGVGKHTARESESTQACAAGKERVANAHP |
Ga0242654_104257451 | 3300022726 | Soil | MRLKHPHAAESGVGKHIARESERAQACANGKECVAHTHP |
Ga0228704_1086292 | 3300023691 | Freshwater | MRPKHPLAAESGVGEHTARESESAQACVIGKERVANA |
Ga0228704_1241271 | 3300023691 | Freshwater | MRPKHPHAAESGGGKHTARESERAQSCAAGKERVANA |
Ga0228706_10198082 | 3300023697 | Freshwater | MRPRHPHAAESGVGKHKARESESAKRCAAGKERVANAHPH |
Ga0228706_10198651 | 3300023697 | Freshwater | MRPRATPAALSGVGEHTARESERAQCRATGKECVASTHP |
Ga0228706_10208031 | 3300023697 | Freshwater | MRPIHPHAAESGVGEHTARESERAQQCAIGKERVANA |
Ga0228706_10279271 | 3300023697 | Freshwater | MRPKSPHAVESGVGEHTARESERAQRCATGKERVANA |
Ga0228707_10694181 | 3300023700 | Freshwater | MRLRHPHAAESGVGKHTARESERAQACATGKERVANAH |
Ga0228708_10300521 | 3300023703 | Freshwater | MSPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0228708_10304171 | 3300023703 | Freshwater | MRPIHPHAADSGVGKHTARESESAQACAIGKERAANAH |
Ga0228708_10447291 | 3300023703 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQ |
Ga0228708_10745731 | 3300023703 | Freshwater | MSPKHPHAAESGVGKHTARESESAQACAAGKERVANAHSH |
Ga0232123_10527182 | 3300023706 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAQWCANGKERVANAHPH |
Ga0228709_10523771 | 3300023708 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKSESN |
Ga0228709_10542412 | 3300023708 | Freshwater | MRPIHPHAAESGVGKHTARESERVQACATGKQRVTNAHS |
Ga0228709_10543961 | 3300023708 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHP |
Ga0228709_10551761 | 3300023708 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSH |
Ga0228709_10647811 | 3300023708 | Freshwater | MRPRHPRAAESGVGKHTARESERAQACATGKERVASAHPH |
Ga0228709_10719501 | 3300023708 | Freshwater | MRPKHPHAAESGVGEHTARESESAKCCADGKERVANAHP |
Ga0228709_10835551 | 3300023708 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVANA |
Ga0228709_11106061 | 3300023708 | Freshwater | MRPRHPHAAESGVGEHKARESESAQHCAAGKERVANAHP |
Ga0232122_10752362 | 3300023709 | Salt Marsh | MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANAHP |
(restricted) Ga0233425_100174122 | 3300024054 | Freshwater | MRPKHPHAAESGVGKHTARESESVKACATGKERVTNAHPHKLASEV |
Ga0244775_102466392 | 3300024346 | Estuarine | MRPRHPHAAESGVGKHTARESESAKACADAQERVANAHPRT |
Ga0255223_10795972 | 3300024480 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVANAHS |
Ga0256330_10583441 | 3300024481 | Freshwater | MRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANAHPHFEPG |
Ga0256330_10598621 | 3300024481 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVA |
Ga0256330_10697891 | 3300024481 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACANGKERVANAHTHNW |
Ga0256330_10928091 | 3300024481 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACATGKERVAN |
Ga0256330_10960001 | 3300024481 | Freshwater | MRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAHP |
Ga0256330_11270381 | 3300024481 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAAGEERVAN |
Ga0255265_11020341 | 3300024482 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAR |
Ga0255224_10553901 | 3300024483 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQ |
Ga0255224_10674942 | 3300024483 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHNW |
Ga0256332_10614531 | 3300024484 | Freshwater | MRPRSALAALSGVGEHTARESESAQCCAAGKERVAN |
Ga0256332_10804491 | 3300024484 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPH |
Ga0256332_11189792 | 3300024484 | Freshwater | MRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANAH |
Ga0256318_10867641 | 3300024485 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAVGKERVAN |
Ga0255164_10304951 | 3300024495 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACVSGKERVANAHSHISPGDRKV |
Ga0255144_10434061 | 3300024513 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVANAHSRNWPRRLQN |
Ga0255228_10538671 | 3300024531 | Freshwater | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANA |
Ga0256352_10440952 | 3300024532 | Freshwater | MRPRSAHAALSSVGEHPTRESESAKWCAEGKERVAN |
Ga0256352_10486452 | 3300024532 | Freshwater | MRPRHPRAAESGVGKHTARESERVQACAAGKEHVTNA |
Ga0256352_10511212 | 3300024532 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAH |
Ga0256299_10481201 | 3300024533 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWP |
Ga0256299_10873471 | 3300024533 | Freshwater | MRPKHPHAAESGVGKHTARESERVQACATGKERVTNAHPHKL |
Ga0256357_10491991 | 3300024534 | Freshwater | MRPRHPHAAESGVGKQTARESESAKACADGEERVANAHS |
Ga0256357_11147741 | 3300024534 | Freshwater | MRPRSALAALSGVGEHTARESESAQCCAAGKERVANAHPHF |
Ga0255303_10526972 | 3300024535 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANA |
Ga0256338_10679461 | 3300024536 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACANGKERVANAH |
Ga0255225_10379221 | 3300024537 | Freshwater | MRPRSAHAALSGVGEHAARESESAQCCAAGKERVANA |
Ga0255225_10380161 | 3300024537 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACATGKERVAN |
Ga0255225_10461262 | 3300024537 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSH |
Ga0255231_10454601 | 3300024539 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVAN |
Ga0255300_10869991 | 3300024540 | Freshwater | MRPRHPHAAESGVGEHTARESESAQCCATGKERAAN |
Ga0256343_10403192 | 3300024541 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAHTH |
Ga0256343_10429821 | 3300024541 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACADGEERVANA |
Ga0256343_10527511 | 3300024541 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAVGKERVANAHPHFL |
Ga0256350_10433911 | 3300024542 | Freshwater | MRPKHPHAAESGVGKHTARESESAKASADGEERVANAH |
Ga0256350_10467741 | 3300024542 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHP |
Ga0256350_10473261 | 3300024542 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVANAH |
Ga0256350_10696372 | 3300024542 | Freshwater | MRPKHSHAAESGVGKHITRESERAQACAKGEERVAN |
Ga0256350_10840942 | 3300024542 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVAN |
Ga0256350_11002211 | 3300024542 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVAN |
Ga0256348_10384711 | 3300024543 | Freshwater | MRPRHPRAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0256348_10391671 | 3300024543 | Freshwater | MRPKHPHAAESGVGKHTTRESERAQACAHGEERVANAH |
Ga0256348_10407322 | 3300024543 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVA |
Ga0256348_10733841 | 3300024543 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVANA |
Ga0256348_10854791 | 3300024543 | Freshwater | MRPKHPHAAESGVGEHTARESESAKCCAAGKERVANA |
Ga0255294_10425721 | 3300024544 | Freshwater | MRPKHPHAAETGVGKHIARESERVQACATGKERVTSAH |
Ga0255294_10435791 | 3300024544 | Freshwater | MRPRSALAALSGVGEHTARESESAQCCAAGKERVANA |
Ga0255294_10594471 | 3300024544 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSH |
Ga0255294_10839761 | 3300024544 | Freshwater | MRPRHPHAAESGVGKHPARESERVQACAAGKERVTNAH |
Ga0256347_10578931 | 3300024545 | Freshwater | MRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAHPH |
Ga0256356_11008162 | 3300024546 | Freshwater | MRPRHPQAAESGVGKHTARESERVQACATGKERVTHA |
Ga0256356_11048331 | 3300024546 | Freshwater | MRPRSAHAALSSVGEHPTRESEIAKWCAEGKERVAN |
Ga0255292_10526952 | 3300024547 | Freshwater | MRPKHLHAAESGVGKHTARESERAQACATGKERVAN |
Ga0256342_10674001 | 3300024548 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNW |
Ga0256342_10723772 | 3300024548 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAAGKERVANA |
Ga0256342_10775841 | 3300024548 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVAN |
Ga0256308_10590602 | 3300024549 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTH |
Ga0255266_10722692 | 3300024550 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAH |
Ga0255280_10533992 | 3300024555 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQL |
Ga0255280_10613381 | 3300024555 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACANGKERVANAHT |
Ga0255280_10991431 | 3300024555 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANA |
Ga0255283_10594961 | 3300024557 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHQTCP |
Ga0255284_10588311 | 3300024559 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNWP |
Ga0255284_10603312 | 3300024559 | Freshwater | MRPKHPHAAESGVGKHIARESESVQACAAGKERVTSAH |
Ga0255284_10609772 | 3300024559 | Freshwater | MRPRHQHAAESGVGEHTARESESAKACATGKERAANA |
Ga0255284_10772161 | 3300024559 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVANAHSR |
Ga0256306_10756941 | 3300024560 | Freshwater | MRPRHPPAAESGVGKHITRESERAQACAIGKERVANA |
Ga0255288_10656142 | 3300024561 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAHPH |
Ga0256336_10612872 | 3300024562 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAAGKERVANAH |
Ga0256336_10620091 | 3300024562 | Freshwater | MRPRHPPAAESGVGEHTARESESAQACAEGEERVANA |
Ga0255236_10707571 | 3300024563 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANA |
Ga0255273_10700851 | 3300024565 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHS |
Ga0255273_10825981 | 3300024565 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTH |
Ga0256309_10864561 | 3300024566 | Freshwater | MRPRHPPAAESGVGKHITRESERAQACANGKERVAN |
Ga0255238_10771421 | 3300024568 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACVIGKERVAN |
Ga0255238_11667931 | 3300024568 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHP |
Ga0255243_10822212 | 3300024569 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLAP |
Ga0255276_10924491 | 3300024570 | Freshwater | MSPRHPHAAESGVGKHTTRESERAQACAAGKERVANA |
Ga0256302_10713421 | 3300024571 | Freshwater | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVANAHP |
Ga0256302_11565911 | 3300024571 | Freshwater | MRPKHPPAAESGVGKHTARESERAQACANGKERVAHAHPQIW |
Ga0255268_11149971 | 3300024572 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAH |
Ga0256337_10778831 | 3300024573 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSHN |
Ga0256337_10970261 | 3300024573 | Freshwater | MRPKHPPAAESGIGEHTARESESAQACAEGEERVANAH |
Ga0255275_11168481 | 3300024574 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACANGKERVAN |
Ga0255275_11473041 | 3300024574 | Freshwater | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANAHPQKL |
Ga0255229_10380771 | 3300024848 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPLRGQ |
Ga0255229_10407611 | 3300024848 | Freshwater | MRPRSAHAALSGVGEHAARESESAQCRAAGKERVAIA |
Ga0255293_10627511 | 3300024851 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAKGEERVAN |
Ga0255295_10507292 | 3300024852 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKDRVAN |
Ga0255295_10507372 | 3300024852 | Freshwater | MRPKHPHAAESGVGEHTARESESAQWCGTWKERAANA |
Ga0255287_10656601 | 3300024854 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHK |
Ga0255286_10587841 | 3300024858 | Freshwater | MRPKHPHAAESGVGKHIARESESAQACADGEERVANA |
Ga0255278_10515591 | 3300024859 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHT |
Ga0256317_10652151 | 3300024862 | Freshwater | MRPRHPHAAESGVGKHTARESESVKACATGKERVTN |
Ga0255246_10731001 | 3300024863 | Freshwater | MRPRHPHAAESGVGKHTARESERVQACANGKERVTN |
Ga0255271_10924621 | 3300024864 | Freshwater | MSPRHPHAAESGVGKLTTRESERAQACAAGKERVANA |
Ga0256340_11366001 | 3300024865 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACATGKERAANAHP |
Ga0256340_11549241 | 3300024865 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVAN |
Ga0255272_10997121 | 3300024866 | Freshwater | MRPRHPRAAESGVGKHTARESESAQACVSGKERVANA |
Ga0255267_10679811 | 3300024867 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQLAP |
Ga0255267_10900772 | 3300024867 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSRTRSTK |
Ga0255267_11216281 | 3300024867 | Freshwater | MRQKHPHAAESGVGKHTARESERAQACADGEERVAN |
Ga0255258_1034781 | 3300025726 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRPNWAK |
Ga0255241_10270001 | 3300025746 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIWPRD |
Ga0255235_10329311 | 3300025753 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVA |
Ga0256313_10291611 | 3300025757 | Freshwater | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANA |
Ga0256313_10726871 | 3300025757 | Freshwater | MRPKHPHAAESGVGKCTARESERAQSYTTGKEHVANAH |
Ga0255249_10393001 | 3300025760 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAH |
Ga0207684_114732061 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLA |
Ga0207649_113182811 | 3300025920 | Corn Rhizosphere | MRPKHPHAAESGVGKHTARESERAQSCATGKECVANTQPQIWPRDRKV |
Ga0207651_112223901 | 3300025960 | Switchgrass Rhizosphere | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLAPEASK |
Ga0209901_10625301 | 3300026275 | Permafrost Soil | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAHPHNLALEP |
Ga0209847_11106201 | 3300026276 | Permafrost Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHNLALEPQGSG |
Ga0213909_1075331 | 3300026386 | Enriched Soil Aggregate | MRPRHPHAAESGVGKHTARESERVQACAAGKEHVTN |
Ga0255304_10212141 | 3300026402 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHS |
Ga0255304_10214171 | 3300026402 | Freshwater | MRPRSALAALSGVGEHTARESESAQCCAAGKERVANAHPH |
Ga0256296_10193771 | 3300026405 | Freshwater | MRPKPPHAAERGVGKHTARESERAQACVTGKESVAN |
Ga0256296_10201472 | 3300026405 | Freshwater | MRPRHPHAAESGVGKHTARESERAQACAAGKERVAN |
Ga0256296_10303251 | 3300026405 | Freshwater | MRPKAPPAAGSGVGKHTARESERVQACAAGKECVTNT |
Ga0256326_10317501 | 3300026412 | Freshwater | MRPKHPPAAESGVGKHTARESERVQACATGKERVTSA |
Ga0256300_10257841 | 3300026425 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQI |
Ga0256300_10294291 | 3300026425 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACAAGKERVANAH |
Ga0255309_10391681 | 3300026428 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSRNQ |
Ga0255309_10594961 | 3300026428 | Freshwater | MRPRHPHAAESGVGKHTARESERAQACAAGKERVANA |
Ga0256297_10320051 | 3300026435 | Freshwater | MRPRHPPAAESGVGEHTARESESAQACAEGEERVANAHSHQL |
Ga0256361_10384931 | 3300026439 | Freshwater | MRPRHPHAAESGVGKHTARESERLQACATGKERVTNAH |
Ga0256364_10392881 | 3300026444 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEP |
Ga0256319_10525171 | 3300026454 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACVTGKECVAN |
Ga0256319_10542752 | 3300026454 | Freshwater | MRPIHPHAAESGVGKHTARESERVQACATGKERVTNAHS |
Ga0255285_10613171 | 3300026562 | Freshwater | MRPKHPHAAESGVGKQIVRESESVQACAAGKERVTSAH |
Ga0256355_10408562 | 3300026563 | Freshwater | MRPKHPHAAESGVGKHTARESESDKACAAGKERVANA |
Ga0256355_10635481 | 3300026563 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAVGKERVAN |
Ga0256355_10790871 | 3300026563 | Freshwater | MRPKHLHAAESGVGKHTARESERAQACATGKERVANAH |
Ga0256359_10283821 | 3300026564 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSR |
Ga0256359_10506921 | 3300026564 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFE |
Ga0256359_10664651 | 3300026564 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVA |
Ga0256311_11490181 | 3300026565 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPLGAA |
Ga0256334_10688981 | 3300026566 | Freshwater | MRPKHPHAAESGVGKHTTRESERAQACAAGKERVANA |
Ga0256334_10693281 | 3300026566 | Freshwater | MRPKHPHAAESGVGKHIARESESVQACAAGKERVTSA |
Ga0255289_10685102 | 3300026571 | Freshwater | MRPKHPHAAESGVGKHTARERESAKACAAGKERVANA |
Ga0255270_10806561 | 3300026572 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAIGKERVANAHTHNWPR |
Ga0255270_10832002 | 3300026572 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACATGKERAANA |
Ga0255269_10965651 | 3300026573 | Freshwater | MSPRHPHAAESGVGKHTARESESAKACATGKERVANA |
Ga0255269_10980401 | 3300026573 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACANGKERVANA |
Ga0255188_10054952 | 3300027079 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACADGEERVANAHSRN |
Ga0255081_10383321 | 3300027155 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACADGEERVANAHSHN |
Ga0255158_10347791 | 3300027541 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVANAHTRNWP |
Ga0209515_105684441 | 3300027835 | Groundwater | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKL |
Ga0256320_1192871 | 3300028074 | Freshwater | MRPKHPPAAESGVGKHTARESERAQTCVNGKECVAHTH |
Ga0255305_10252362 | 3300028079 | Freshwater | MRPIHPHAAESGVGKHTARESESVQACANGKERVTNAH |
Ga0256324_10287061 | 3300028080 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVANAHSRSMRMSRSRHETE |
Ga0255260_10370871 | 3300028081 | Freshwater | MRPRHPPAAESGVGKHTTRESERAQACAVGKERVANAH |
Ga0255299_10467541 | 3300028089 | Freshwater | MRPTSAHAALSSVGEHPTRESESAKWCAEGKERVANA |
Ga0255261_10352941 | 3300028097 | Freshwater | MRPRHPHAAESGVGKHTARESERVQACATGKERVTNAH |
Ga0256363_10385682 | 3300028100 | Freshwater | MRPRSALAALSGVGEHTARESESAQCCAAGKERVANAH |
Ga0256363_10396772 | 3300028100 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVA |
Ga0256363_10628401 | 3300028100 | Freshwater | MRPRHPHAAESGVGKHTARESESAQACAEGEERVANAHS |
Ga0256349_10394822 | 3300028101 | Freshwater | MRPRHPRAAESGVGKHTARESERVQACATGKERVTNA |
Ga0256349_10398561 | 3300028101 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAEGEEREANAHS |
Ga0256349_10400432 | 3300028101 | Freshwater | MRPKHPHAAESGVGEHTARESESAKCCAAGKERVAN |
Ga0256349_10449021 | 3300028101 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVAN |
Ga0256349_10471161 | 3300028101 | Freshwater | MRPRSAHAALSGVGEHTARESESAQCCAVGKERVANAHP |
Ga0256305_10750152 | 3300028108 | Freshwater | MRPKPPHAAESGVGKHAARESERAQACVTGKECVANTQ |
Ga0256305_10947321 | 3300028108 | Freshwater | MRPKHPHAAESGVGKHTARESESAQACADGEERVAN |
Ga0256305_11309211 | 3300028108 | Freshwater | MRPKHPHAAESGVGKHTARESERVQACAAGEERVTNAHSHKLAS |
Ga0256335_10870201 | 3300028112 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAAGKERVANAHPHFL |
Ga0256335_10879501 | 3300028112 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLA |
Ga0256335_11650061 | 3300028112 | Freshwater | MRPKHPPAAESGVGEHTARESESAQACAAGEERVANAHS |
Ga0255234_11965931 | 3300028113 | Freshwater | MRPRHPPAAESGVGEHTARESESAQACAEGEERVANAHSH |
Ga0256346_1061871 | 3300028247 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERGANAHS |
Ga0255227_10311632 | 3300028266 | Freshwater | MRPKHPPAAESGVGKHTARESERAQACVTGKECVANTHP |
Ga0255227_10312661 | 3300028266 | Freshwater | MRPKHPHAAESGVGKHTARESERVQACATGKERVTNAH |
Ga0255227_10632862 | 3300028266 | Freshwater | MRPKHPHAAESVVGKHTARESESAQACADGEERVANAHS |
Ga0256358_10526691 | 3300028267 | Freshwater | MRPKHPHAAESGVGKHTARESESDKACADGEERVANAHS |
Ga0256358_10895041 | 3300028267 | Freshwater | MRPKHPHAAESGVGKYTARESESVQACAAGKERVTNAHP |
Ga0256358_11038031 | 3300028267 | Freshwater | MRPKHPHAAESGVGKHITRESERAQACAKGEERVANA |
Ga0256331_10694861 | 3300028286 | Freshwater | MRPKHPHAAESGVGKHTARESESAKACAAGEERVAN |
Ga0256331_10714711 | 3300028286 | Freshwater | MRPKHPHAAESGVGKHTARESERAQACATGKERVAHAH |
Ga0256331_10722621 | 3300028286 | Freshwater | MRPKHPHAAQSGVGKHIARESERAQACAIGKERVANA |
Ga0256331_11009171 | 3300028286 | Freshwater | MRPRSAHAALSSVGEHPTRESESAKWCAEGKERVANA |
Ga0210315_10353211 | 3300028329 | Estuarine | MRPKHPHAAESGVGKHTARESERVQACAPGQERVT |
Ga0255279_10402571 | 3300028530 | Freshwater | MRPRHPHAAESGVGKHTTRESERAQACAVGKERVANA |
Ga0255279_10434801 | 3300028530 | Freshwater | MRPRHPHAAESGVGKHTARESESAKACADGEERVA |
Ga0257136_10430682 | 3300028619 | Marine | MRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPH |
Ga0257136_10432671 | 3300028619 | Marine | MRPKHPHAAESGVGKHTARESESAKRCAAGKERVANAHP |
Ga0257136_10433412 | 3300028619 | Marine | MRLKHPRAAESGVGKHTARESESAQACANGKERVANAHSHKLAP |
Ga0257139_10393991 | 3300028620 | Marine | MRPKHPPAAESGVGKHTARESERVQACATGKERVTSAH |
Ga0257142_10431532 | 3300028621 | Marine | MRLKHPRAAESGVGKHTARESESAQACAAGKERVANAHSHK |
Ga0257142_10623972 | 3300028621 | Marine | MRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHP |
Ga0257142_10630501 | 3300028621 | Marine | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEALT |
Ga0257141_10449141 | 3300028623 | Marine | MRPKHPPAAESGVGKHTARESERAQSCATGKERVANAHP |
Ga0257141_10456282 | 3300028623 | Marine | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLAS |
Ga0257141_10462751 | 3300028623 | Marine | MRPKHPHAAESGVGKHTARESESAKRCAAGKERVANAHPQ |
Ga0257141_10490631 | 3300028623 | Marine | MRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPHFEPG |
Ga0272412_11992091 | 3300028647 | Activated Sludge | MRPRSAHAALSGVGEHTARESESAQCCAAGKERVANAHPHFEPG |
Ga0257143_10295261 | 3300028670 | Marine | MRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPHKL |
Ga0257143_10309812 | 3300028670 | Marine | MRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHP |
Ga0307294_103688881 | 3300028810 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAHPHKLAPEASKLP |
Ga0265297_109763461 | 3300029288 | Landfill Leachate | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKLASEA |
Ga0222749_103166932 | 3300029636 | Soil | MRPKHPPAAESGVGKHIARESERAQACANGKECVAHTH |
Ga0265597_1015382 | 3300029639 | Marine | MRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPHTLQCKAK |
Ga0265597_1016522 | 3300029639 | Marine | MRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPH |
Ga0206093_1027731 | 3300029640 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0206093_1028271 | 3300029640 | Soil | MRPKHPHAAESGVGKHNARESERVQACAAGKERVTN |
Ga0206093_1028512 | 3300029640 | Soil | MRPKHPHAAESGVGEHTARESEAPNVCVGKERVANAHP |
Ga0206093_1028861 | 3300029640 | Soil | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANA |
Ga0206092_1068932 | 3300029646 | Soil | MRPKHPHAAESGVGEHTARESEAPNVCVGKERVAN |
Ga0206085_1059601 | 3300029649 | Soil | MRPKHPHAAESGVGKHTARESESVQACAAGKERVT |
Ga0206091_1076151 | 3300029655 | Soil | MRPIHPHAAESGVGKHTARESESAQACAAGKERVANAHPHKL |
Ga0206094_1088321 | 3300029659 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVT |
Ga0265600_1141772 | 3300029666 | Marine | MRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHP |
Ga0265600_1250341 | 3300029666 | Marine | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKL |
Ga0265604_1148531 | 3300029674 | Marine | MRPKHPHAAESGVGKHTARESESAKRCAAGKERVAN |
Ga0265604_1151692 | 3300029674 | Marine | MRPTSAHAALSGVGEHTARESESAKCCADGKERVAN |
Ga0265603_10196531 | 3300029685 | Marine | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLASE |
Ga0265603_10199981 | 3300029685 | Marine | MRPKHPHVAESGVGKHTARESESVKVCAAGKERVVNAHSYKL |
Ga0265603_10205052 | 3300029685 | Marine | MRPKHPPAAESGVGKHTARESERAQSCATGKERVANA |
Ga0265602_10246232 | 3300029687 | Marine | MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLA |
Ga0265602_10250121 | 3300029687 | Marine | MRPKHPHAAESGVGKHTARESERAQACANGKERVANAHSH |
Ga0265598_10309351 | 3300029691 | Marine | MRPRHPHAAESGVGKHTARESESAKACAAGKERVANAHSHKLASEAL |
Ga0265598_10317752 | 3300029691 | Marine | MRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPHLTAKR |
Ga0265598_10335871 | 3300029691 | Marine | MRPKHPHAAESGVGKHTARESESAKRCAAGKERVANA |
Ga0265598_10342271 | 3300029691 | Marine | MRPIHPHAAESGVGKHTARESESVQACATGKERVTN |
Ga0257137_10365082 | 3300029693 | Marine | MRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAHPHKLAP |
Ga0255233_10407371 | 3300029699 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTDH |
Ga0222748_11119121 | 3300029701 | Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVA |
Ga0247632_10080421 | 3300030533 | Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0210289_16018321 | 3300030543 | Soil | MRPRHPHAAESGVGKHTARESERAQSCAAGKERVAN |
Ga0247631_10120431 | 3300030550 | Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLRGKEWRRFE |
Ga0247654_11573021 | 3300030552 | Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVAN |
Ga0247654_11726111 | 3300030552 | Soil | MRPIHPRAAESGVGKHTARESERAQACATGKERLANA |
Ga0247635_10708021 | 3300030565 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVTN |
Ga0247652_11088771 | 3300030571 | Soil | MRPKHPHAAESGVGKHTARESESVQACAAGKEHVTN |
Ga0247644_10517871 | 3300030576 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAHSHKL |
Ga0247633_102530331 | 3300030579 | Soil | MRPKHLHAAESGVGKYTARESERVQACAAGKERVTSAHPHKFTRLKAKI |
Ga0247612_10890601 | 3300030592 | Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0247659_12238871 | 3300030600 | Soil | MRPKHPHAAESGVGKHITRESERAQACAAGKERVANAHSHK |
Ga0247634_102439491 | 3300030609 | Soil | MRPKHLHAAESGVGKHIARESESAKACAAGKERVAN |
Ga0247613_101212791 | 3300030610 | Soil | MRPKHPRAAESGVGKHTARESERVQACAAGKEHVTNAHCIAF |
Ga0247613_101860841 | 3300030610 | Soil | MRLIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLGKRKK |
Ga0247655_102622011 | 3300030621 | Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANA |
Ga0265392_11829691 | 3300030623 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRNRKVP |
Ga0247629_103663561 | 3300030628 | Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLASRKR |
Ga0247636_101012821 | 3300030634 | Soil | MRPKHLHAAESGVGKYTARESERVQACAAGKERVTNAH |
Ga0247621_11802451 | 3300030683 | Soil | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKKKK |
Ga0307482_10779791 | 3300030730 | Hardwood Forest Soil | MRPIHPRAAESGVGKHTARESERAQACAAGKERVANAHPQKLAPE |
Ga0307482_10943711 | 3300030730 | Hardwood Forest Soil | MRPKHPRAAESGVGKHTARESESAQACAAGKERVANAH |
Ga0307482_10945642 | 3300030730 | Hardwood Forest Soil | MRPKHPHAAESGVGKHIARESERVQACAAGKERVTNA |
Ga0307482_11212602 | 3300030730 | Hardwood Forest Soil | MRPKHPHAAESGVGEYTARESERAQQCTDGKERVANAH |
Ga0265459_110395862 | 3300030741 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTHPQIEKNKRKGEGQKK |
Ga0265459_134913971 | 3300030741 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQKKK |
Ga0102764_18893462 | 3300030751 | Soil | MRPKHPHAAESGVGKHKARESERAQRCAAGKERVANAHPQ |
Ga0265720_10040231 | 3300030764 | Soil | MRPRHPHAAESGVGEYTARESERAQQCADGKERVANAH |
Ga0102752_16515071 | 3300030783 | Soil | MRPKHLHAAESGVGKYTARESERVQACAAGKERVT |
Ga0138304_13393931 | 3300030790 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKERVANAHPQIW |
Ga0074037_18777901 | 3300030803 | Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHPQK |
Ga0265756_1034031 | 3300030805 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHP |
Ga0265735_1018612 | 3300030811 | Soil | MRPRHPHAAESGVGKHIARESERAQACANGKEHVAHAQ |
Ga0265734_1058761 | 3300030812 | Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTHAHP |
Ga0265746_10235351 | 3300030815 | Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNA |
Ga0265729_1012262 | 3300030816 | Soil | MRSKTSHAAKSGVGEHTARESERAQQCAIGKECVAYTH |
Ga0265729_1036851 | 3300030816 | Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKERVTHAH |
Ga0265726_1015281 | 3300030824 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAHP |
Ga0308203_10243342 | 3300030829 | Soil | MRPKHPHAAESGVGKYTARESERAQSYITGKERVANA |
Ga0308203_10244592 | 3300030829 | Soil | MRPIHPHAAESGVGKHIARESERVQACAAGKERVTN |
Ga0308203_10537451 | 3300030829 | Soil | MRPIHPHAAESGVGKYTARESERVQACAAGKEHVTNA |
Ga0308203_10941071 | 3300030829 | Soil | MRPRHPHAAESGVGKHTARESERAQLCANGKERVANAH |
Ga0308205_10168291 | 3300030830 | Soil | MRPKHPHAAESGVGKCTARESERAQSYTTGKERVANA |
Ga0308152_1035101 | 3300030831 | Soil | MRPKHPHAAESGVWKHTARKCEGAKACAAGKERVAN |
Ga0308152_1151881 | 3300030831 | Soil | PRHPHAAESGVGKYTARESERVQACAAGKERAGALKQ |
Ga0265736_1013281 | 3300030833 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAH |
Ga0265736_1015651 | 3300030833 | Soil | MRPKHPHAAESGVGKYIARESERAQACIIGKERVANAHP |
Ga0265738_1016491 | 3300030834 | Soil | MRPRHPHAAESGVGKHIARESERAQACANGKEHVAHAH |
Ga0265738_1017011 | 3300030834 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKEQVTN |
Ga0075374_100603921 | 3300030855 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQ |
Ga0265723_10070291 | 3300030872 | Soil | MRPKHPHAAESGVGKYIARESERAQACTIGKERVANA |
Ga0265751_1039551 | 3300030873 | Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTNAHP |
Ga0265727_1009231 | 3300030875 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQI |
Ga0265727_1014821 | 3300030875 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKEQVTNAHPH |
Ga0265730_1011051 | 3300030876 | Soil | MRPKHPHAAESGVGKHTARESERAQSCANGKERVANA |
Ga0265776_1029921 | 3300030880 | Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVT |
Ga0265733_1019971 | 3300030887 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHP |
Ga0308202_10437532 | 3300030902 | Soil | MRLKHPHAAESGVGKHNARESERVQACAAGKERVTN |
Ga0308202_10437761 | 3300030902 | Soil | MRPKHPHAAESGVGKHTARKCEGAKACAAGKERVAN |
Ga0308202_10799471 | 3300030902 | Soil | MRPKHPPAAESGVGKHTARESERAQSCATGKERVAN |
Ga0308202_11137001 | 3300030902 | Soil | MRPIHPHAAESGVGKYTARESERVQACAAGKERVTN |
Ga0308206_10540171 | 3300030903 | Soil | MRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTQ |
Ga0308206_10542212 | 3300030903 | Soil | MRPKHLHAAESGVGKYTARESERVQACAAGKERVTN |
Ga0308206_10768421 | 3300030903 | Soil | MRPRHPHAAESGVGKHIARESESVQACAAGKERVTN |
Ga0308198_10261271 | 3300030904 | Soil | MRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAH |
Ga0308198_10268251 | 3300030904 | Soil | MRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAH |
Ga0308200_10423842 | 3300030905 | Soil | MRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL |
Ga0308200_10444191 | 3300030905 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKECVANT |
Ga0138296_10948991 | 3300030923 | Soil | MRPKHPHAAESGVGKCTARESERAQSYTTGKESKMKR |
Ga0138302_14484291 | 3300030937 | Soil | MRPIHPRAAESGVGKHTARESERVQACAAGKERVTNAHIRPHQT |
Ga0138302_15249141 | 3300030937 | Soil | MRPKHPHAAESGVGEHTARESESAQRCAIGKERVAIA |
Ga0311366_112303571 | 3300030943 | Fen | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQNLAPGPQGSGAIFFVNLRSWDT |
Ga0075399_100348211 | 3300030967 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQK |
Ga0075376_100313801 | 3300030968 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVANAHPQ |
Ga0075395_100357601 | 3300030973 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPQKLASEASK |
Ga0265721_10021771 | 3300030977 | Soil | MRPRHPHAAESGVGKHTARESERAQACANGEEHVAHAH |
Ga0265721_10102521 | 3300030977 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANA |
Ga0265748_1025911 | 3300030982 | Soil | MRPRHPHAAESGVGKHTARESERAQSCAAGKERVANAH |
Ga0265748_1062771 | 3300030982 | Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKECVANTH |
Ga0308154_1043981 | 3300030986 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVAN |
Ga0308155_10080611 | 3300030987 | Soil | MRPKHPHAAESGVGKYTARESERAQSYITGKERVANAH |
Ga0308183_10552172 | 3300030988 | Soil | MRPIHPHAAESGVGKHTARKCERVQACAAGKERVTNA |
Ga0308183_10560011 | 3300030988 | Soil | MRPRHPLAAESGVGKLSARESESALACAAGKERVAN |
Ga0308196_10175932 | 3300030989 | Soil | MRPIHPHAAESGVGKHIARESERVQACAAGKERVTNAH |
Ga0308196_10273461 | 3300030989 | Soil | MRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQIW |
Ga0308196_10625441 | 3300030989 | Soil | MRPQHPHAAESGVGKHTARESERVQACAAGKEHVTNAH |
Ga0308178_10434051 | 3300030990 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQIW |
Ga0308190_10573542 | 3300030993 | Soil | MRPRHPHAAESGVGKYTARESERVQACAAGKERVTN |
Ga0308190_11305941 | 3300030993 | Soil | MRPRHPHAAECGVGKHTARESERAQACAAGKERVAN |
Ga0308190_11387171 | 3300030993 | Soil | MRPIHPHAAESGVGKHTARESERVQACAAGKEHVTN |
Ga0073997_100922271 | 3300030997 | Soil | MRLKHPHAAESGVGKHTARESESVQACAAGKEHVTNAH |
Ga0073996_100850321 | 3300030998 | Soil | MRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTHPQ |
Ga0265732_1011932 | 3300031016 | Soil | MRPKHPHAAESGVGKYIARESERAQACTIGKERVANAH |
Ga0265732_1012002 | 3300031016 | Soil | MRPKHPHAAESGVGEHTARESERAQQCADGKERVANAHP |
Ga0073998_116425571 | 3300031023 | Soil | MRLKHPHAAESGVGKYTARESESVKACAAGKERVTNAH |
Ga0073978_16282171 | 3300031036 | Marine | MRPKHPHAAESGVGKHTARESESAQACADGEERVANAH |
Ga0265749_1011051 | 3300031042 | Soil | MRPRHPHAAESGVGKHIARESERVQACAAGKERVTN |
Ga0265779_1039591 | 3300031043 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNAH |
Ga0308189_101315721 | 3300031058 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQIWPRSR |
Ga0308189_101398091 | 3300031058 | Soil | MRPKHLHAAESGVGKHITRESERAQECAAGKERVANAHSH |
Ga0308189_101434891 | 3300031058 | Soil | MRPIHPHAAESGVGKHTARESERAQACAAGKERVANAH |
Ga0308189_101437052 | 3300031058 | Soil | MRPKHPHAAESGVGKHTARESELVQACAAGIERVTNA |
Ga0308189_101702431 | 3300031058 | Soil | MRPKHPHAAESGVGKHTARESESAQACADGKERVANAH |
Ga0308189_102765271 | 3300031058 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANA |
Ga0308189_104238061 | 3300031058 | Soil | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANA |
Ga0308189_104956771 | 3300031058 | Soil | MRPRHPHAAVSGVGKHTARESERVQACAAGKERVTN |
Ga0308185_10299332 | 3300031081 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKECVANTH |
Ga0308192_10268302 | 3300031082 | Soil | MRPIHPPAGESGVGKHRARESERAKSCAIGKECVAN |
Ga0308192_10531021 | 3300031082 | Soil | MRPRHPHAAESGVGKHTARESERAQLCANGKERVAN |
Ga0308201_101105881 | 3300031091 | Soil | MRPKHPHAAESGVGKHNARESERVQACAAGKERVTNA |
Ga0308201_101136601 | 3300031091 | Soil | MRPKHPLAAESGVGEHTARESESAQQCAVGKECVA |
Ga0308201_103405471 | 3300031091 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAIGKECVAN |
Ga0308204_100927181 | 3300031092 | Soil | MRPRHPHAAESGVGKHTARESERAQLCANGKERVANAHPQIWPR |
Ga0308204_101007271 | 3300031092 | Soil | MRPKHPHAAESGVGEHTARESESAQQCAVGKERVAN |
Ga0308204_101755061 | 3300031092 | Soil | MRPRHPRAAESGVGKHTARESESAQACAAGKERVANA |
Ga0308204_101797901 | 3300031092 | Soil | MRPIHLHAAESGVGKHIARESERVQACAAGKERVTNA |
Ga0308197_101068141 | 3300031093 | Soil | MRPRHPHAAESGVGKHTARESERAQACATGKERVANAHPHKLAP |
Ga0308197_101178982 | 3300031093 | Soil | MRPIHPHAAESGVGKHIARESERVQACAAGKERVTNA |
Ga0308199_10519061 | 3300031094 | Soil | MRPKHPHAAESGVGKHTARKCEGAKACAAGKERVA |
Ga0308184_10128282 | 3300031095 | Soil | MRPRHPHAAESGVGKHIARESESVQACAAGKERVTNAHPH |
Ga0308184_10229681 | 3300031095 | Soil | MRPKHPHAAESGVGKHTARESERAQACAAGKERVA |
Ga0308184_10303681 | 3300031095 | Soil | MRPKHPHAAESGVGKHTARESESAQECAAGKERVANA |
Ga0308193_10234881 | 3300031096 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAH |
Ga0308193_10297971 | 3300031096 | Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHPHIW |
Ga0308193_10471771 | 3300031096 | Soil | MRPKHPHAAESGVGKHTARESERVQACATGKEHVTNAH |
Ga0308188_10318491 | 3300031097 | Soil | MRPRHPHAAESGVGKYTARESERVQACAAGKERVTNA |
Ga0308188_10378711 | 3300031097 | Soil | MRPKHPHAAESGVGKHTARESESAQECAAGKERVA |
Ga0308181_10485392 | 3300031099 | Soil | MRPITSHAAVSGVGKHTARESERVQAFAAGNERVTNA |
Ga0308181_11082181 | 3300031099 | Soil | MRTKHPHAAESGVGKHNARECERVQACAAGKERVTN |
Ga0308180_10104391 | 3300031100 | Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVAN |
Ga0308180_10106481 | 3300031100 | Soil | MRPKHPHAAESGVGEHTARESERAQRCADGKERVAN |
Ga0308180_10115481 | 3300031100 | Soil | MRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL |
Ga0308187_101342142 | 3300031114 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKEHVTNA |
Ga0308187_101388561 | 3300031114 | Soil | MRPKHPHAAESGVGKHNARESERVQACAAGKERVT |
Ga0308187_103348371 | 3300031114 | Soil | MRPKHPHAAESGVGKHTARDSERVQACAAGKEHVTNA |
Ga0308195_10211201 | 3300031123 | Soil | MRPKTLHAAESGVGEHTARESESAQPCAIGKERVA |
Ga0308195_10348731 | 3300031123 | Soil | MRPKHPHAAESGVGEYTARESERAQQCADGKERVANAHPQ |
Ga0308151_10125521 | 3300031124 | Soil | MRPKHPHAAESGVGKYTARESERVQACAAGKERVTNA |
Ga0308182_10069201 | 3300031125 | Soil | MRPKHPHAAESGVGKHTARESERAQLCADGKERVANAH |
Ga0308182_10120821 | 3300031125 | Soil | MRPRHPHAAESGVGKHTARESERAQACATGKERVANA |
Ga0308182_10190261 | 3300031125 | Soil | MRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANAH |
Ga0170824_1067552172 | 3300031231 | Forest Soil | MRSKAALAALSGVGEHTARESESAQGCATGKERVANAPP |
Ga0170824_1240560691 | 3300031231 | Forest Soil | MRPRHPHAAESGVGKYTARESERVQACAAGKERVTNAHPQ |
Ga0265328_104640981 | 3300031239 | Rhizosphere | MRPRHPHAAESGVGKHTARESERAQACAIGKERVANAHPQIWPRD |
Ga0265327_104558321 | 3300031251 | Rhizosphere | MRPKHPHAAESGVGKHTARESERAQSCATGKERVANAHPQIW |
Ga0308194_102068931 | 3300031421 | Soil | MRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANAHS |
Ga0308194_102596732 | 3300031421 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKEHVTNA |
Ga0308186_10095441 | 3300031422 | Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKL |
Ga0308186_10097911 | 3300031422 | Soil | MRPKHPPAAESGVGKHTARESERAQSCAIGKECVANTHPQIW |
Ga0308186_10231921 | 3300031422 | Soil | MRPIHPHAADSGVGKHTARESERVQACAAGKERVTNAHPR |
Ga0308177_10206171 | 3300031423 | Soil | MRPKHLHAAESGVGKYTARESERVQACAAGKEHVTNA |
Ga0308179_10145271 | 3300031424 | Soil | MRPKHLHAAESGDGKFSARESERVQACAAGKEHVTNA |
Ga0308179_10147191 | 3300031424 | Soil | MRPKHPHAAESGVGKHTARESERAQACATGKERVAN |
Ga0308179_10163471 | 3300031424 | Soil | MRPRHPHAAESGVGKHNARESESVKACAAGKERVTNAH |
Ga0308179_10257571 | 3300031424 | Soil | MRPIHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKL |
Ga0170820_168135101 | 3300031446 | Forest Soil | MRPKHPHAAESGVGKHNARESESAKACAAGKERVANAH |
Ga0170819_119916181 | 3300031469 | Forest Soil | MRPKHPRAAESGVGKHTARESERVQACAAGKERVTNAHPQK |
Ga0170819_132324601 | 3300031469 | Forest Soil | MRLKPPHAAESGVGKHTARESESAKACAAGKERVANAH |
Ga0170819_177401391 | 3300031469 | Forest Soil | MRPKYPHAAESGVGEHTARESESAQPCAIGKERVANAHPQ |
Ga0314827_1084481 | 3300031476 | Soil | MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAH |
Ga0314827_1085641 | 3300031476 | Soil | MRPKHPRAAESGVGKHTARESESAQACAAGKERVAN |
Ga0314816_10200331 | 3300031481 | Soil | MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHPHQL |
Ga0314822_1046191 | 3300031484 | Soil | MRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAH |
Ga0314823_1052242 | 3300031487 | Soil | MRPKHLHAAESGVGKHIARESERVQACAAGKERVTNAHPHKLAP |
Ga0314823_1052701 | 3300031487 | Soil | MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHPHQLAS |
Ga0314825_1051661 | 3300031490 | Soil | MRPKHPRDAESGVGKHTARESERVQACAAGKERVTNA |
Ga0314824_1032701 | 3300031491 | Soil | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTN |
Ga0314826_1141371 | 3300031493 | Soil | MRPKHPHAAESGVGKHTARESERAQSCATGKERVA |
Ga0314826_1141911 | 3300031493 | Soil | MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNA |
Ga0314826_1161851 | 3300031493 | Soil | MRPKHLHAAESGVGKHIARESERVQACAAGKERVTN |
Ga0314817_1138921 | 3300031495 | Soil | MRPKHPHAVESGVGKHNTRESERVQACAAGKERVTNA |
Ga0314818_1062001 | 3300031499 | Soil | MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHP |
Ga0314819_1050251 | 3300031502 | Soil | MRPKHPHAAESGVGKHTARESEAPNSMRGKERAANAH |
Ga0314820_1048062 | 3300031503 | Soil | MRPKHPHAVESGVGKHIARESESVQVCAAGKERVTN |
Ga0307408_1006062722 | 3300031548 | Rhizosphere | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHKLAPEAARPP |
Ga0265605_10296442 | 3300031560 | Marine | MRPIHPHAAESGVGKHTARNCESAQACAAGKERVANAH |
Ga0265605_10473702 | 3300031560 | Marine | MRPKHPHAAESGVGKYTARESERVQACATGKERVTN |
Ga0307483_10097361 | 3300031590 | Hardwood Forest Soil | MRPRHPRAAESGVGKHTARESESAQACAAGKERVANAHPQKL |
Ga0265313_101203172 | 3300031595 | Rhizosphere | MRPKHPHAAESGVGKHTARESERAQSCANGKERVANAHPQIWPRDRKVPG |
Ga0307274_10226902 | 3300031661 | Subsurface Water | MRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPHFD |
Ga0307480_10050681 | 3300031677 | Hardwood Forest Soil | MRPRHPHAAESGVGKHIARESESVKECAAGKERVTNA |
Ga0307480_10221822 | 3300031677 | Hardwood Forest Soil | MRPKHPHAAESGVGKHNARESESAQACAAGKERVANA |
Ga0310901_104238272 | 3300031940 | Soil | MRPKHPHAAESGVGKYTARESERVQACAAGKERVTNAHPHKLAPEAAKL |
Ga0307272_10381162 | 3300031960 | Subsurface Water | MRPKSAHAALSGVGEHPARESESAKWSADGKERVANAHPH |
Ga0315302_10454952 | 3300032149 | Marine | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKLAP |
Ga0316593_102475671 | 3300032168 | Rhizosphere | MRPKSAHAALSGVGEHPARESESAKWCANGKERVANAHSQPRRRP |
Ga0315276_110995572 | 3300032177 | Sediment | MRPKHPHAAESGVGKHTARESESVQACATGKERVTNAHSHK |
Ga0315271_101608082 | 3300032256 | Sediment | MRPRHPHAAESGVGKHTARESESAQACAIGKERVANAHSHKLASEA |
Ga0335069_116157161 | 3300032893 | Soil | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPH |
Ga0335076_114976921 | 3300032955 | Soil | MSPKHPHAAESGVGKHTARESERVQACAAGKERVTNAHPHTLAPGPQGSGALLFS |
Ga0335084_109239981 | 3300033004 | Soil | MSPRHPHAAESGVGKHTARESESAQACAAGKERVANAHPHFLAPEPGGSGAKLFLRVENRSGD |
Ga0316592_10663602 | 3300033524 | Rhizosphere | MRPRSAHAALSGVGEHPARESESAKWCANGKERVANAHPH |
Ga0316586_10612062 | 3300033527 | Rhizosphere | MRPKSAHAALSGVGEHPARESESAKWCANGKERVANAHP |
Ga0316588_10759941 | 3300033528 | Rhizosphere | MRPRSAHAALSGVGEHPARESESAKWCANGKERVANAHPHFEPG |
Ga0316588_10825401 | 3300033528 | Rhizosphere | MRPKSAHAALSGVGEHPARESESAKWCANGKERVA |
Ga0316587_10441372 | 3300033529 | Rhizosphere | MRPRSAHAALSGVGEHPARESESAKWCAEGEERVANAH |
Ga0316587_10928932 | 3300033529 | Rhizosphere | MRPRSAHAALSGVGEHPARECESAKWSAEGEERVANAH |
Ga0335036_0398093_1_135 | 3300034106 | Freshwater | MRPIHPHAAESGVGKHTARESERVQACATGKERVTNAHSHKLASE |
Ga0370510_0131509_618_764 | 3300034160 | Untreated Peat Soil | MRPKHPHAAESGVGKHTARESERAQSCAAGKERVANAHPQIWPRDRKVP |
Ga0335064_0754562_2_130 | 3300034357 | Freshwater | MRPKPPHAAESGVGKHTARESERAQACVTGKECVANTHPQIRP |
Ga0370540_04018_639_770 | 3300034448 | Soil | MRPKHPHAAESGVGEHTARESESAQQCAIGKERVANAHSQIWPR |
Ga0314785_005053_744_854 | 3300034479 | Soil | MRPKHPRAAESGVGKHNARESERAQVCAAGKERVANA |
Ga0314785_005895_700_813 | 3300034479 | Soil | MRPRHPHAAESGVGKYTARESERVQACAAGKERVTNAH |
Ga0314785_009479_583_693 | 3300034479 | Soil | MRPKHPHAAESGVGKHNTRESERVQACAAGKEHVTNA |
Ga0314789_007886_2_133 | 3300034480 | Soil | MRPKHPHAAESGVGKHNARESERAQVCAAGKERVANAHPQKLAP |
Ga0314789_008281_701_817 | 3300034480 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0314789_008772_1_105 | 3300034480 | Soil | MRPRHPLAAESGVGEHTARESERAQQCAIGKERVA |
Ga0314789_012624_1_135 | 3300034480 | Soil | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHPQKLAPE |
Ga0315299_09137_693_821 | 3300034481 | Marine | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKLA |
Ga0326770_009772_3_119 | 3300034482 | Soil | MRPKHLHAAESGVGKHTTRESESAKGCAAGKERVASAHS |
Ga0370545_153818_3_119 | 3300034643 | Soil | MRPRHPHAAESGVGKHIARESESVKECAAGKERVTNAHP |
Ga0370548_039891_691_801 | 3300034644 | Soil | MRPRHPHAAESGVGKHTARESERAQLCANGKERVANA |
Ga0316598_099494_695_805 | 3300034652 | Untreated Peat Soil | MRPKHPLAAESGVGEHTARESERAQACAAGKERVANA |
Ga0316599_088225_696_806 | 3300034653 | Untreated Peat Soil | MRPIHPHAAESGVGEHTARESESAQQCAVGKERVANA |
Ga0316599_088254_694_804 | 3300034653 | Untreated Peat Soil | MRPKSAHAALSGVGEHTARESESAQCCAAGKERVANA |
Ga0316599_088355_692_805 | 3300034653 | Untreated Peat Soil | MRPRHPHAAESGVGKPNARASESAKPCAAGNERVANAH |
Ga0316599_121671_574_687 | 3300034653 | Untreated Peat Soil | MRPKHPHAAESGVGEHTARESERVQQCAIGKECVTNTH |
Ga0314780_052756_701_817 | 3300034659 | Soil | MRPKHPHAAESGVGEHTARESERAQQCAIGKERVANAHP |
Ga0314780_053333_700_816 | 3300034659 | Soil | MRPKHPPAAESGVGTHTARESERVQACAAGTEHVTNAHP |
Ga0314780_054541_2_112 | 3300034659 | Soil | MRPNPPHAAESGVGKHTARESERVQACAAGKEHVTNA |
Ga0314780_055443_694_804 | 3300034659 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0314780_067018_637_756 | 3300034659 | Soil | MRPKSPHAVESGVGEHTARESERAQRCATGKERVANAHPH |
Ga0314780_067083_644_754 | 3300034659 | Soil | MRPKHPHAAESGVGEHTARETERAQRCAIGKERVANA |
Ga0314780_154667_2_109 | 3300034659 | Soil | MRPKHPHAAESGVGKYTARESERVQACAAGKERVTN |
Ga0314781_019554_929_1042 | 3300034660 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0314781_038859_702_815 | 3300034660 | Soil | MRPKHPHAAESGVGKHTARESEGAKECAAGKERVANAH |
Ga0314781_039131_3_134 | 3300034660 | Soil | MRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHPQIWPR |
Ga0314781_052627_621_734 | 3300034660 | Soil | MRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAH |
Ga0314781_057532_599_709 | 3300034660 | Soil | MRPKHPHAAESGVGKHTARESERAHSCAAGKERVANA |
Ga0314781_099839_1_114 | 3300034660 | Soil | MRPKHLHAAESGVGKHITRERQRAQACAAGKERVAHAH |
Ga0314782_052062_702_818 | 3300034661 | Soil | MRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAHP |
Ga0314782_052063_699_818 | 3300034661 | Soil | MRSKAALAALSGVGEHTARESESAQGCATGKECVASTHPP |
Ga0314782_070939_621_737 | 3300034661 | Soil | MRPKHPLAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0314782_147198_455_574 | 3300034661 | Soil | MRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPH |
Ga0314782_150529_454_570 | 3300034661 | Soil | MRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAHP |
Ga0314782_188441_396_527 | 3300034661 | Soil | MRLKHPHAAESGVGKHNARESECVQACAAGKERVTNAHPHKLAP |
Ga0314782_191929_388_525 | 3300034661 | Soil | MRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHSHKLAPED |
Ga0314783_042398_699_827 | 3300034662 | Soil | MRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHSHKLA |
Ga0314783_071859_575_691 | 3300034662 | Soil | MRSKATLAALSGVGEHTARESESAQGCATGKECVASTHP |
Ga0314783_163740_3_116 | 3300034662 | Soil | MRPKHPHAAESGVGKHNARESERAQVCAAGKERVANAH |
Ga0314784_021821_899_1009 | 3300034663 | Soil | MRPRHPHAAESGVGKHNARESESAKACAAGKERVANA |
Ga0314784_041381_697_813 | 3300034663 | Soil | MRSKAALAALSGVGEHTARESESAQGCATGKECVASTHP |
Ga0314784_096301_495_611 | 3300034663 | Soil | MRPKQPHAAESGVGKPTARESERVQACAAGKEHVTNAHP |
Ga0314786_032446_795_905 | 3300034664 | Soil | MRPTHPHAAESGVGKHITRESERAQACAAGKERVANA |
Ga0314786_046243_700_804 | 3300034664 | Soil | MRPKHPHAAESGVGKHTARDSERVQACAAGKEHVT |
Ga0314786_085439_544_657 | 3300034664 | Soil | MRPKHPHVAESGVGKHIARESESAKACAAGKERVANAH |
Ga0314786_093690_506_634 | 3300034664 | Soil | MRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLA |
Ga0314786_095145_520_633 | 3300034664 | Soil | MRPRHPHAAESGVGKHNARESERVQACAAGKERVTNAH |
Ga0314787_030791_695_814 | 3300034665 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAQPH |
Ga0314787_033334_678_791 | 3300034665 | Soil | MRLKHPHAAESGVGKHTARESERAQSCATGKERVANAH |
Ga0314787_039039_632_748 | 3300034665 | Soil | MRPIHPHAAESGVGEHTARESERVQACAAGKERVTNAHP |
Ga0314787_055510_554_661 | 3300034665 | Soil | MRPKHPPAAESGVGMHTARDSERALSCAIGKECVAN |
Ga0314787_063316_515_631 | 3300034665 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHP |
Ga0314788_048321_3_128 | 3300034666 | Soil | MRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAHPHNL |
Ga0314788_058514_664_780 | 3300034666 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKERVTNAHP |
Ga0314788_152301_2_133 | 3300034666 | Soil | MRPKHLHAAESGVGKHITRESERAQACAAGKERVANAHSHKLAP |
Ga0314792_070292_703_813 | 3300034667 | Soil | MRPKHPHAAESGVGKYPARESERVLACAAGKERVTNA |
Ga0314792_078391_671_784 | 3300034667 | Soil | MRPRHPRAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0314792_093712_618_737 | 3300034667 | Soil | MRPRSTHAVLSSVGEHTTRESEGAKCCAAGKERVANAHPH |
Ga0314793_041240_699_815 | 3300034668 | Soil | MRPIHPHAADSGVGKHTARESERAQACAAGKERVANAHP |
Ga0314793_042493_696_806 | 3300034668 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTHA |
Ga0314793_044274_682_795 | 3300034668 | Soil | MRSKATLAALSGVGEHTARESESAQGCATGKECVASTH |
Ga0314793_051199_645_758 | 3300034668 | Soil | MRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAH |
Ga0314793_089996_507_623 | 3300034668 | Soil | MRPKHPRAAESGVGKHNARESERAQVCAAGKERVANAHP |
Ga0314794_137383_1_129 | 3300034669 | Soil | MRPKHPHAAESGVGKHTARESESAQACAAGKERVANAHSQKLA |
Ga0314794_160155_2_112 | 3300034669 | Soil | MRPRHPHAAESGVGKHTARESERVQACAAGKERVTSA |
Ga0314795_121086_1_120 | 3300034670 | Soil | MRSKATLAALSGVGEHTARESESAQGCATGKECVASTHPR |
Ga0314796_036533_768_884 | 3300034671 | Soil | MRPRHPLAADSGVGKHTARESEAPNSVAAGKERVANAHP |
Ga0314797_038384_701_829 | 3300034672 | Soil | MRPRHPRAAESGVGKHTARKSERVQACAAGKERVTNAQPHRGC |
Ga0314797_042212_685_804 | 3300034672 | Soil | MRPKHPHAAESGVGKHITRESERAQACAAGKERVANAHSH |
Ga0314797_046737_660_776 | 3300034672 | Soil | MRPRHPLAAESGVGEHTARESERAQQCAIGKERVANAHP |
Ga0314797_049016_646_762 | 3300034672 | Soil | MRPKHLHAEESGVGKHNSRESERVLACAAGKERVTNAHP |
Ga0314797_073197_547_663 | 3300034672 | Soil | MRPRSPHAAESGVGKHTARESESAQACAAGKERVANAHP |
Ga0314797_083407_506_631 | 3300034672 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKL |
Ga0314798_045230_696_809 | 3300034673 | Soil | MRPKHPPAAESGVGKHTARESERVQACAAGKERVTNAH |
Ga0314798_104064_486_602 | 3300034673 | Soil | MRLKHPHAAESGVGKHTARESERVQACAAGKERVTSAHP |
Ga0314799_013513_698_811 | 3300034674 | Soil | MRPKHPHAAESGVGKHNARESESAQACAAGKERVANAH |
Ga0314799_035629_455_574 | 3300034674 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHSH |
Ga0314800_061120_437_556 | 3300034675 | Soil | MRPKHPHAAESGVGKLTARESERVQACAAGKERVTSAHPH |
Ga0314801_051366_688_816 | 3300034676 | Soil | MRPKHPRAAESGVGKHTARESESAQACAAGKERVANAHPQKLA |
Ga0314801_053389_1_114 | 3300034676 | Soil | MRPIHPHAAESGVGEHTARESERAQRCAIGKERVANAH |
Ga0314801_053594_692_805 | 3300034676 | Soil | MRPIHPHAADSGVGKHTARESERAQACAAGKERVANAH |
Ga0314801_059330_658_777 | 3300034676 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPH |
Ga0314802_006656_867_986 | 3300034677 | Soil | MRPKHPPAAESGVGKHTARESERVQACAAGKERVTNAHPH |
Ga0314802_020078_555_671 | 3300034677 | Soil | MRPIHPHAAESGVGEHTARESERAQRCATGKERVANAHP |
Ga0314803_035191_2_112 | 3300034678 | Soil | MRPIHPHAAESGVGKHTARESERAQACAAGKERVATA |
Ga0314803_036322_697_804 | 3300034678 | Soil | MRPTHPHAAESGVGKHTARESERVQACAAGKERVTN |
Ga0314803_061697_2_133 | 3300034678 | Soil | MRPKHPHAAESGVGKHTARESERVQACAAGKERVTSAHPHKLAP |
Ga0314803_143555_390_500 | 3300034678 | Soil | MRPTHLHAAESGVGKHTARESERVQACAAGKERVTNA |
Ga0370541_015725_696_812 | 3300034680 | Soil | MRPIHPHAAESGVGKHTARESERAQACAAGKERVANAHP |
Ga0370541_055113_412_528 | 3300034680 | Soil | MRPQHPHAAESGVGKHTARESERVQACAAGKEHVTNAHP |
Ga0370546_025527_699_809 | 3300034681 | Soil | MRPKHPHAAESGVGKHTARKCEGAKACAAGKERVANA |
⦗Top⦘ |