NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029639

3300029639: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300029639 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114292 | Gp0306340 | Ga0265597
Sample NameMetatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7551858
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomelakesaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)N/ADepth (m)36
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F004323Metagenome / Metatranscriptome443Y
F041277Metagenome / Metatranscriptome160Y
F053640Metagenome / Metatranscriptome141Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0265597_101538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei839Open in IMG/M
Ga0265597_101634Not Available817Open in IMG/M
Ga0265597_101652Not Available815Open in IMG/M
Ga0265597_101676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia810Open in IMG/M
Ga0265597_101692Not Available807Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0265597_101538Ga0265597_1015381F053640NSRSAAALKNVAESTAGIIPGDRGMEGDSWCCPPLQAAQAVERHISPVPLAGVVSGQFTHESGTERQGAIRIRVEPSQAHGRFRPVRRRSYPRGFWLLLRRPERSHGSRRANPAKRPHSEHEGGAQGSRDGGERADLAKSVKPPQGGGVKNHVTPLQKRKQP
Ga0265597_101538Ga0265597_1015382F000344MRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPHTLQCKAK
Ga0265597_101634Ga0265597_1016341F041277MRPETPLAVENGVGKPAAHEAPNVGTGKRAWRTPIPRFVP
Ga0265597_101652Ga0265597_1016522F000344MRPTSAHAALSGVGEHTARESESAKCCADGKERVANAHPH
Ga0265597_101676Ga0265597_1016761F004323MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSNIFQTTALR
Ga0265597_101692Ga0265597_1016922F041277MRPKTPLAVENGVGKPAAPEAPNVGTGKRVWRTPIP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.