


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300031491 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0132857 | Gp0330686 | Ga0314824 |
| Sample Name | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R3 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 13333482 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 9 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → biofilm material |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 40.7997 | Long. (o) | -77.8629 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000344 | Metagenome / Metatranscriptome | 1257 | Y |
| F001633 | Metagenome / Metatranscriptome | 660 | Y |
| F044880 | Metagenome / Metatranscriptome | 153 | Y |
| F053640 | Metagenome / Metatranscriptome | 141 | Y |
| F059886 | Metagenome / Metatranscriptome | 133 | Y |
| F080014 | Metagenome / Metatranscriptome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0314824_103121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 824 | Open in IMG/M |
| Ga0314824_103206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
| Ga0314824_103270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
| Ga0314824_103413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 783 | Open in IMG/M |
| Ga0314824_103661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 752 | Open in IMG/M |
| Ga0314824_104096 | Not Available | 706 | Open in IMG/M |
| Ga0314824_105856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 584 | Open in IMG/M |
| Ga0314824_107376 | Not Available | 523 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0314824_103121 | Ga0314824_1031211 | F001633 | GQLVGVGVRHTLFPGGTRLDTLAFAGVVLPDATLCGMQMFRSHGGTVLTVAGRDLSSEASAPGSDAPCRERRAGRGADTPATFIVARRHPYHGDGTGFWPIVGPALRV |
| Ga0314824_103206 | Ga0314824_1032061 | F001633 | FVTRSFPAAHAWTRSLFAGGDLPDATLRGMRMFRSHGGTVLTVAGRELSSEASAPGSDAPCRERRAGRGVDTPATFIFRVGTFYRGVGISLWLIVGPALRV |
| Ga0314824_103270 | Ga0314824_1032701 | F000344 | MRPKHLHAAESGVGKHTARESERVQACAAGKERVTN |
| Ga0314824_103413 | Ga0314824_1034131 | F053640 | TVAAQRSEMVAESTTGIIPGDRGKAGGNWCRPPLMPAKAVMRHISPVPLAGVVSGQSTHELGTEPQGAIRNRVEWSQATQGVSTCASTQLPQRLRLLLRRPERHRVSRRDDPAKRPHSPHEWGAQGTYGGGERTDLGKVREPPHRGGVKHTSPSCKRQRSLRGKRSDP |
| Ga0314824_103661 | Ga0314824_1036611 | F059886 | VIYASRLAFAVLRGGRHQLSPTFPRSPGIIPVVFSV |
| Ga0314824_103661 | Ga0314824_1036612 | F001633 | GTRLDALAFAGGVLPDATLRGMRMFRSHGGTVLIVSDRDLSSEAFAPGSDTPCRERRAGRGADTPATFFVARRHLYHGDGTGFWPVVGPALRV |
| Ga0314824_104096 | Ga0314824_1040961 | F080014 | FDVVGSPAELQAEVPGRPRKTTGTNASAKNELALAA |
| Ga0314824_105856 | Ga0314824_1058561 | F059886 | VIYASHLALAIGRGGRHQLSPAFPRSPGIIPAVLSATFFRPLRFD |
| Ga0314824_107376 | Ga0314824_1073761 | F044880 | MTASVKILFVSMMVAVALLTTTGTLTTAPSAEAQTPYCQVNPTACTPQFCAIYPQLCNLPVVNPVYPVYPVYPINQCGYVNCVAPINCAPVPYSPIYGQIYRPANCGVYPYGYGYNNLCTFNAPCNAPYVGGAPARLNLAVSPAIATCGSTPVTVQAHITDAYGVAVAN |
| ⦗Top⦘ |