| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026386 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114432 | Gp0238656 | Ga0213909 |
| Sample Name | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0907-MT (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18166342 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 8 |
| Associated Families | 8 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 8 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → research facility → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Iowa | |||||||
| Coordinates | Lat. (o) | 42.0 | Long. (o) | -93.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000344 | Metagenome / Metatranscriptome | 1257 | Y |
| F015442 | Metagenome / Metatranscriptome | 254 | Y |
| F025750 | Metagenome / Metatranscriptome | 200 | Y |
| F033328 | Metagenome / Metatranscriptome | 177 | Y |
| F037756 | Metagenome / Metatranscriptome | 167 | Y |
| F057921 | Metagenome / Metatranscriptome | 135 | N |
| F061584 | Metagenome / Metatranscriptome | 131 | Y |
| F095062 | Metagenome / Metatranscriptome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0213909_105779 | Not Available | 805 | Open in IMG/M |
| Ga0213909_106007 | Not Available | 788 | Open in IMG/M |
| Ga0213909_107533 | Not Available | 680 | Open in IMG/M |
| Ga0213909_109617 | Not Available | 578 | Open in IMG/M |
| Ga0213909_109630 | Not Available | 578 | Open in IMG/M |
| Ga0213909_109670 | Not Available | 577 | Open in IMG/M |
| Ga0213909_111906 | Not Available | 505 | Open in IMG/M |
| Ga0213909_112082 | Not Available | 500 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0213909_105779 | Ga0213909_1057791 | F037756 | VRHTLFPVPTLGAHLAVAAGFPTPFSVTTGVFGLVAGPSNISRC |
| Ga0213909_106007 | Ga0213909_1060071 | F033328 | NARMSPKASWIIPGDWGKAESGWLTQPLLKSDRKVETAEA |
| Ga0213909_107533 | Ga0213909_1075331 | F000344 | MRPRHPHAAESGVGKHTARESERVQACAAGKEHVTN |
| Ga0213909_109617 | Ga0213909_1096171 | F057921 | VTRQAACSPAGMHGQNVASGDGVTLSPLLPVAGFARQRINALVRVR |
| Ga0213909_109630 | Ga0213909_1096301 | F061584 | LTHRFPFGGSRTWCGIPRPRRRAAVTSHEVGRSTECCERRSCKRIGLLAPSLTSLFPVSLSGLTPPPAPVLLRVRVHPPMSFTSPTEYEPLQTCPARFRAKRLPWGFVPHRGTSTQSPLPSELPMSRPTVPSSAFLAPSTVCSSVCLAGLFHPAATSGIHLPGVLSRRQAEPSRRWPVPSCRSSTRSCRRVA |
| Ga0213909_109670 | Ga0213909_1096701 | F015442 | VKGQSFQASERSLRGVGSEQEVLAGGLGSVDPQPSKDGGGESTKGRSGILFAKLSAGHAGGERGCDSDHLE |
| Ga0213909_111906 | Ga0213909_1119061 | F025750 | MEADAHLRTDPQLAKTGGGEQRAHVSPDPDATFRPRMPVGEQT |
| Ga0213909_112082 | Ga0213909_1120822 | F095062 | SQVAFLSQVSGTVFNIANSSEAFHGSCLELVSFPASELTLSRLSASFLWLTFAWWQKPPESHARADTQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |