| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008648 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117952 | Gp0126199 | Ga0103610 |
| Sample Name | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-60 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8565479 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000344 | Metagenome / Metatranscriptome | 1257 | Y |
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103610_100207 | Not Available | 775 | Open in IMG/M |
| Ga0103610_100273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103610_100207 | Ga0103610_1002072 | F030135 | APGFLRGPENREELATLSSFTDIWHSTFAGCQFPDAILPDKEAFDLVAGPLN* |
| Ga0103610_100273 | Ga0103610_1002731 | F000344 | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |