Basic Information | |
---|---|
IMG/M Taxon OID | 3300008648 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117952 | Gp0126199 | Ga0103610 |
Sample Name | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-60 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Michigan |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 8565479 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000344 | Metagenome / Metatranscriptome | 1257 | Y |
F030135 | Metagenome / Metatranscriptome | 186 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103610_100207 | Not Available | 775 | Open in IMG/M |
Ga0103610_100273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103610_100207 | Ga0103610_1002072 | F030135 | APGFLRGPENREELATLSSFTDIWHSTFAGCQFPDAILPDKEAFDLVAGPLN* |
Ga0103610_100273 | Ga0103610_1002731 | F000344 | MRPKHPRAAESGVGKHTARESEGAKACAIGKERVANAHPHKKKKKT |
⦗Top⦘ |