NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011299

3300011299: Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_D5L_HD (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011299 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0103597 | Gp0123883 | Ga0138294
Sample NameActive sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_D5L_HD (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size53483942
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActive Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationAustria: Klosterneuburg
CoordinatesLat. (o)48.3Long. (o)16.2Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F017318Metagenome / Metatranscriptome241Y
F021769Metagenome / Metatranscriptome217Y
F059886Metagenome / Metatranscriptome133Y
F075814Metagenome / Metatranscriptome118Y
F104545Metagenome / Metatranscriptome100N
F105419Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138294_1021024All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1068Open in IMG/M
Ga0138294_1021679Not Available514Open in IMG/M
Ga0138294_1021829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia831Open in IMG/M
Ga0138294_1042150Not Available534Open in IMG/M
Ga0138294_1043760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria630Open in IMG/M
Ga0138294_1063386Not Available988Open in IMG/M
Ga0138294_1076218All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage880Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138294_1021024Ga0138294_10210242F105419MRKLFALGALMVAAAVSNGCISNTMYGCEITETLAPGASEGEVVMKHGAPDNIVYLGNQYCNPQTGERGEVDKYLYEYRIGGGTTLLGWLFASDEFHNIAYLIEGGRVMGGGYVGEGKGSIILGNNFGVVSTPLGVFDMNFGGFVHPKARAGYGGDGTPE
Ga0138294_1021679Ga0138294_10216791F075814NESVNRPTKCFDTREVGVVQLGTGKYDVTVSVMPHSSFNQTTRLTLKSVDPASVPAVTGGTLVENVVFSLDAQSSCDGAAVAPLPNLVNLGVIYNTAPALDKSKLQLVFWNGSAWTNIDTTPDPVPGNPYVSSTISQPGTYALIVKP*
Ga0138294_1021829Ga0138294_10218291F000344MRPKHPHAAESGVGKHTARESERAQACATGKERVANAHSHKLAP
Ga0138294_1042150Ga0138294_10421501F059886VIYASRTAFADLRGERHQLSPTIPRSPGIIPAVLSVAPFRPLRFDC
Ga0138294_1043760Ga0138294_10437601F104545MTAKGVRVGKDQPIRTCTAQHAQQRIVGQQAGIDCDAATRAVRVPTASGQPDVEPVDTILRSGGRRKTFRDAPASRGRVRQRLEMAPVANPFRHAVIKVAAQ
Ga0138294_1063386Ga0138294_10633861F017318MGIPLLAAPLKFERTVEGLFDISCDGINPSVGLFNFSLSDLPNNSDFTNLFDMYRIDKIEVAWYPEYTVLSDSGLVSNAVDVQVNTAIAQISNTPTVVSDVLQYISCVGTGITQIHKRSFQPSYLMDGICPCSCFLSCNNATANWYGVAYGVAPTGTAMLFKSRAKFFMSFVQSR*
Ga0138294_1076218Ga0138294_10762181F021769KNLKLELFNFKQSLDFDRSDIAYIVEGHMNACNDLSEKTIIFSLNEKLKSFTYDDDVNTLLEGLNDDMSKYQLLYELKNLYSVLNSKNQGELYRQPINVLLQTINLDTDEDRMSKVLNELAIYDWVPEIKLFVYNLTKSPEQRSNLLSGGKSEVVYTIVEQVEDGHLAYIKDSWFLLTDDSIEKTLLENHVKDDNRMKTLRSLQTAMQFATINESRIDFRISEYLTIGLSVNDSTIFINEDELSEDTSLENLFSSPIVPIVNRNFYPLLVEVSNNIDSFVELDVVKRVSNLIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.