NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031499

3300031499: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031499 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132857 | Gp0330680 | Ga0314818
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R3 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21155343
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas vasicola1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → biofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F001679Metagenome / Metatranscriptome653Y
F077504Metagenome / Metatranscriptome117Y
F104573Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314818_102772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas vasicola1393Open in IMG/M
Ga0314818_106200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia808Open in IMG/M
Ga0314818_111414Not Available542Open in IMG/M
Ga0314818_112393Not Available515Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314818_102772Ga0314818_1027721F104573LGIQPKRGGRFHLKINIVWKPIEKNYIDGKVKRTLKKGLKVLEIVKRERNKII
Ga0314818_106200Ga0314818_1062001F000344MRPKHPHAVESGVGKHITRESERVQACAAGKERVTNAHP
Ga0314818_111414Ga0314818_1114141F001679GARGMSWHQQAMKGVEGCDKPWGAVKQALIPGYPNQCILNP
Ga0314818_112393Ga0314818_1123932F077504ETKEMTMTTYRNLTGAELYAIELRARRQRQEELGRLLRAAAVAVKAAYERAVSHFNAKVVKHA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.