Protein Family IF12278
Metagenome
Isolate
555
Members
422
Samples
241
Scaffolds
331.06
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2834852038|2834853762|
- Length
- 397 aa
- Sequence
- MAVTTANWPSSQRADLPSCGRGCITRQGAHTRLSIHPVSPRPDARRFFLARHIRRLTRKEIAPMKAGRFPLTRPRRNRFDDFTRRLVAENSLGINNLIWPIFFTEGTNTVTEVASMPGALRVTLDRLAAHVEPAAKLGIPAVALFPVTPTEVRDAEGTEALNPDNLMCRAARLLKKEFPNVGLIGDVALDPYTSHGHDGIVRDDYVQNDESVVILTQQAVNQAAAGVDIIAPSDMMDGRIGTMRMALDDNDLVNTRIMSYAAKYASAFYGPFRDALGSGSMLKGDKKTYQMDPANSDEALREVEMDIAEGADMVMVKPGMPYLDIIRRVRDTFAVPTFAYQVSGEYAMLMAAIQNGWLDRDRAIMESLLAFRRAGAHGVLTYFAIEAAEKIKETYGV
Sample Types
Isolate
56.6%
Metagenome
43.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
18.5%
Unclassified
15.2%
Apidae
12.8%
Termitidae
6.5%
Formicidae
6.2%
Curculionidae
4.5%
Ixodidae
3.8%
Culicidae
3.2%
Tenebrionidae
3.2%
Muscidae
3.0%
Kalotermitidae
2.5%
Calliphoridae
2.2%
Armadillidiidae
2.2%
Elmidae
1.8%
Tephritidae
1.2%
Pteromalidae
1.2%
Termopsidae
1.0%
Rhinotermitidae
0.8%
Psyllidae
0.5%
Daphniidae
0.5%
Sarcophagidae
0.5%
Aphididae
0.5%
Pulicidae
0.5%
Nephropidae
0.5%
Rhopalidae
0.2%
Ceratopogonidae
0.2%
Cylisticidae
0.2%
Nymphalidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Thripidae
0.2%
Delphacidae
0.2%
Anthomyiidae
0.2%
Pentatomidae
0.2%
Silvanidae
0.2%
Gryllidae
0.2%
Cimicidae
0.2%
Carposinidae
0.2%
Anthocoridae
0.2%
Bombycidae
0.2%
Cicadellidae
0.2%
Cerambycidae
0.2%
Plutellidae
0.2%
Siricidae
0.2%
Passalidae
0.2%
Crambidae
0.2%
Pseudococcidae
0.2%
Hydrophilidae
0.2%
Lysianassidae
0.2%
Aphalaridae
0.2%
Aphrophoridae
0.2%
Hodotermitidae
0.2%
Taxonomy
Archaea
0
Bacteria
496
Eukaryota
0
Viruses
0
Unclassified
59
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 2 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 3 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 4 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 5 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 6 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 7 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 8 | 2846025955 | Wolbachia endosymbiont of Cylisticus convexus Wcon | Isolate | Cylisticidae |
| 9 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 10 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 11 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 12 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 13 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 14 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 15 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 16 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 17 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 18 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 19 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 20 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 21 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 22 | 2511231061 | Rickettsia slovaca 13-B | Isolate | Ixodidae |
| 23 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 24 | 2548876922 | Rickettsia sibirica mongolitimonae HA-91 | Isolate | Ixodidae |
| 25 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 26 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 27 | 2597489904 | Rickettsia helvetica C9P9 | Isolate | Ixodidae |
| 28 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 29 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 30 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 31 | 638341232 | Wolbachia endosymbiont of Drosophila ananassae | Isolate | Drosophilidae |
| 32 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 33 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 34 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 35 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 36 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 37 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 38 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 39 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 40 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 41 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 46 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 47 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 48 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 49 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 50 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 51 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 52 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 53 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 54 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 55 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 56 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 57 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 58 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 59 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 60 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 61 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 62 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 63 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 64 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 65 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 66 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 67 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 68 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 69 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 70 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 71 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 72 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 73 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 74 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 75 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 76 | 2718218151 | Rickettsia rickettsii Iowa Large Clone | Isolate | Ixodidae |
| 77 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 78 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 79 | 640753045 | Rickettsia canadensis McKiel | Isolate | Ixodidae |
| 80 | 641228503 | Rickettsia massiliae MTU5 | Isolate | Ixodidae |
| 81 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 82 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 83 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 84 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 85 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 86 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 87 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 88 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 89 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 90 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 91 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 92 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 93 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 94 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 95 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 96 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 97 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 98 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 99 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 100 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 101 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 102 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 103 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 104 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 105 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 106 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 107 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 108 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 109 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 110 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 111 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 112 | 2845988041 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 113 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 114 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 115 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 116 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 117 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 118 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 119 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 120 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 121 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 122 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 123 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 124 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 125 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 126 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 127 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 128 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 129 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 130 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 131 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 132 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 133 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 134 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 135 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 136 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 137 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 138 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 139 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 140 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 141 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 142 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 143 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 144 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 145 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 146 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 147 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 148 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 149 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 150 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 151 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 152 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 153 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 154 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 155 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 156 | 3002821025 | Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig | Isolate | Aphididae |
| 157 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 158 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 159 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 160 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 161 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 162 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 163 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 164 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 165 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 166 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 167 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 168 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 169 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 170 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 171 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 172 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 173 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 174 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 175 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 176 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 177 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 178 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 179 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 180 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 181 | 2848715743 | Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia | Isolate | Drosophilidae |
| 182 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 183 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 184 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 185 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 186 | 2582581025 | Rickettsia tamurae buchneri ISO7 | Isolate | Ixodidae |
| 187 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 188 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 189 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 190 | 2718217968 | Rickettsia rickettsii Iowa Small Clone | Isolate | Ixodidae |
| 191 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 192 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 193 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 194 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 195 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 196 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 197 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 198 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 199 | 644736402 | Rickettsia africae ESF-5 | Isolate | Ixodidae |
| 200 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 201 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 202 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 203 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 204 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 205 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 206 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 207 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 208 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 209 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 210 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 211 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 212 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 213 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 214 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 215 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 216 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 217 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 218 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 219 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 220 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 221 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 222 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 223 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 224 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 225 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 226 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 227 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 228 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 229 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 230 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 231 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 232 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 233 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 234 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 235 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 236 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 237 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 238 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 239 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 240 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 241 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 242 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 243 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 244 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 245 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 246 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 247 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 248 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 249 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 250 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 251 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 252 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 253 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 254 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 255 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 256 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 257 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 258 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 259 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 260 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 261 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 262 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 263 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 264 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 265 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 266 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 267 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 268 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 269 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 270 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 271 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 272 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 273 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 274 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 275 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 276 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 277 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 278 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 279 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 280 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 281 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 282 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 283 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 284 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 285 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 286 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 287 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 288 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 289 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 290 | 2811995359 | Rickettsia bellii An04 | Isolate | Ixodidae |
| 291 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 292 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 293 | 640753044 | Rickettsia bellii OSU 85-389 | Isolate | Ixodidae |
| 294 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 295 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 296 | 643886011 | Wolbachia sp. wUni (Muscidifurax uniraptor) | Isolate | Pteromalidae |
| 297 | 644736403 | Rickettsia peacockii Rustic | Isolate | Ixodidae |
| 298 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 299 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 300 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 301 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 302 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 303 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 304 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 305 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 306 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 307 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 308 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 309 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 310 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 311 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 312 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 313 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 314 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 315 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 316 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 317 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 318 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 319 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 320 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 321 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 322 | 2834762790 | Rickettsia fournieri AUS118 | Isolate | Unclassified |
| 323 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 324 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 325 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 326 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 327 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 328 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 329 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 330 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 331 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 332 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 333 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 334 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 335 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 336 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 337 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 338 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 339 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 340 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 341 | 2636416119 | Wolbachia endosymbiont of Drosophila simulans | Isolate | Drosophilidae |
| 342 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 343 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 344 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 345 | 2811994999 | Candidatus Rickettsia amblyommii An13 | Isolate | Ixodidae |
| 346 | 638341178 | Rickettsia sibirica 246 | Isolate | Unclassified |
| 347 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 348 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 349 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 350 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 351 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 352 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 353 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 354 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 355 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 356 | 650716082 | Rickettsia conorii heilongjiangensis 054 | Isolate | Pseudococcidae |
| 357 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 358 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 359 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 360 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 361 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 362 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 363 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 364 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 365 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 366 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 367 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 368 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 369 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 370 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 371 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 372 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 373 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 374 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 375 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 376 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 377 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 378 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 379 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 380 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 381 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 382 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 383 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 384 | 2548876780 | Rickettsia sibirica BJ-90 | Isolate | Ixodidae |
| 385 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 386 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 387 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 388 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 389 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 390 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 391 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 392 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 393 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 394 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 395 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 396 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 397 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 398 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 399 | 8068887342 | Rickettsia asiatica Maytaro1284 | Isolate | Ixodidae |
| 400 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 401 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 402 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 403 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 404 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 405 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 406 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 407 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 408 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 409 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 410 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 411 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 412 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 413 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 414 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 415 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 416 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 417 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 418 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 419 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 420 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 421 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 422 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_180466 | 3300042612 | Bacteria | 12565 |
| 2 | Ga0530661_000301 | 3300056564 | Bacteria | 38229 |
| 3 | Ga0562377_0043 | 3300056842 | Bacteria | 596387 |
| 4 | Ga0562376_0277 | 3300056857 | Bacteria | 101764 |
| 5 | Ga0562376_0597 | 3300056857 | Bacteria | 61826 |
| 6 | Ga0466705_511816 | 3300042612 | Bacteria | 14094 |
| 7 | Ga0466711_443435 | 3300042615 | Bacteria | 18879 |
| 8 | Ga0466715_256671 | 3300042616 | Bacteria | 9050 |
| 9 | Ga0466726_259065 | 3300042619 | Unclassified | 5718 |
| 10 | Ga0466731_046911 | 3300042622 | Bacteria | 9430 |
| 11 | Ga0466724_08012 | 3300042649 | Bacteria | 67064 |
| 12 | Ga0466724_52064 | 3300042649 | Bacteria | 126311 |
| 13 | Ga0466724_68275 | 3300042649 | Unclassified | 5758 |
| 14 | Ga0123355_10261479 | 3300009826 | Unclassified | 2420 |
| 15 | Ga0466706_260998 | 3300042599 | Bacteria | 1342 |
| 16 | Ga0466707_166837 | 3300042601 | Unclassified | 7067 |
| 17 | Ga0160467_100158 | 3300012829 | Bacteria | 94072 |
| 18 | Ga0160467_104823 | 3300012829 | Unclassified | 1820 |
| 19 | Ga0160444_101419 | 3300012841 | Unclassified | 4661 |
| 20 | Ga0160445_100641 | 3300012847 | Bacteria | 14629 |
| 21 | Ga0160445_102381 | 3300012847 | Unclassified | 4368 |
| 22 | Ga0160445_105180 | 3300012847 | Unclassified | 2257 |
| 23 | Ga0160457_1009467 | 3300012858 | Unclassified | 1393 |
| 24 | Ga0316159_10253 | 3300030930 | Bacteria | 8908 |
| 25 | FGTW_contig30480 | 2065487013 | Unclassified | 23107 |
| 26 | HBC_ctgsDRAFT_1027698 | 3300000333 | Unclassified | 1391 |
| 27 | Meta3P_1005852 | 3300002464 | Unclassified | 7337 |
| 28 | Ga0103263_102120 | 3300007042 | Bacteria | 2483 |
| 29 | Ga0104147_1022735 | 3300007224 | Unclassified | 12090 |
| 30 | Ga0127656_115981 | 3300009453 | Bacteria | 5054 |
| 31 | Ga0562374_0175 | 3300057007 | Bacteria | 142924 |
| 32 | Ga0466710_109317 | 3300042613 | Bacteria | 4609 |
| 33 | Ga0466734_126682 | 3300042623 | Bacteria | 2162 |
| 34 | Ga0466735_202849 | 3300042624 | Bacteria | 2080 |
| 35 | Ga0466709_387525 | 3300042648 | Unclassified | 15383 |
| 36 | Ga0466724_30107 | 3300042649 | Bacteria | 107498 |
| 37 | Ga0466724_59573 | 3300042649 | Bacteria | 10544 |
| 38 | Ga0123355_10022471 | 3300009826 | Bacteria | 10112 |
| 39 | Ga0123355_10266690 | 3300009826 | Bacteria | 2386 |
| 40 | Ga0123356_10139280 | 3300010049 | Bacteria | 2391 |
| 41 | Ga0160470_100014 | 3300012813 | Bacteria | 330009 |
| 42 | Ga0466701_024260 | 3300042598 | Bacteria | 4362 |
| 43 | Ga0466722_019267 | 3300042609 | Bacteria | 26286 |
| 44 | Ga0309904_1000006 | 3300029810 | Bacteria | 54211 |
| 45 | Ga0309904_1000474 | 3300029810 | Unclassified | 3491 |
| 46 | Ga0247290_00379 | 3300035364 | Unclassified | 9279 |
| 47 | Ga0466696_046448 | 3300042596 | Bacteria | 15258 |
| 48 | DPO_contig00007 | 2032320009 | Unclassified | 3665 |
| 49 | gam1t_NODE_560359_length=16208_GC=33_8_Contigs=1 | 2189573031 | Bacteria | 16208 |
| 50 | HBC_ctgsDRAFT_1006831 | 3300000333 | Bacteria | 2678 |
| 51 | CVPL005L_10000001 | 3300002938 | Bacteria | 447235 |
| 52 | Ga0102735_1000896 | 3300007080 | Bacteria | 7787 |
| 53 | Ga0104042_1034878 | 3300007130 | Unclassified | 4443 |
| 54 | Ga0102740_1000190 | 3300007140 | Bacteria | 17251 |
| 55 | Ga0103264_1000177 | 3300007188 | Bacteria | 72281 |
| 56 | Ga0103268_1000068 | 3300007192 | Bacteria | 31452 |
| 57 | Ga0466732_135551 | 3300042656 | Bacteria | 52880 |
| 58 | Ga0466730_037626 | 3300042625 | Bacteria | 40362 |
| 59 | Ga0466730_076369 | 3300042625 | Unclassified | 7580 |
| 60 | Ga0466724_07773 | 3300042649 | Unclassified | 1750 |
| 61 | Ga0466727_264503 | 3300042655 | Unclassified | 2590 |
| 62 | Ga0123356_10000678 | 3300010049 | Bacteria | 37723 |
| 63 | Ga0123356_10010152 | 3300010049 | Bacteria | 9261 |
| 64 | Ga0123356_10082724 | 3300010049 | Bacteria | 3040 |
| 65 | Ga0123356_10105617 | 3300010049 | Bacteria | 2710 |
| 66 | Ga0123354_10000821 | 3300010882 | Unclassified | 34120 |
| 67 | Ga0160454_100003 | 3300012798 | Bacteria | 498364 |
| 68 | Ga0160454_100275 | 3300012798 | Bacteria | 45129 |
| 69 | Ga0466701_044033 | 3300042598 | Bacteria | 112210 |
| 70 | Ga0466706_182067 | 3300042599 | Bacteria | 6144 |
| 71 | Ga0466717_072547 | 3300042604 | Unclassified | 1501 |
| 72 | Ga0466698_154051 | 3300042610 | Unclassified | 2174 |
| 73 | Ga0160469_100224 | 3300012824 | Unclassified | 46868 |
| 74 | Ga0160430_102046 | 3300012852 | Bacteria | 6717 |
| 75 | Ga0309902_000020 | 3300028910 | Unclassified | 14219 |
| 76 | Ga0309903_100285 | 3300029809 | Unclassified | 1972 |
| 77 | Ga0466656_084959 | 3300042550 | Unclassified | 26669 |
| 78 | Ga0466657_337307 | 3300042582 | Bacteria | 7291 |
| 79 | Ga0466701_008162 | 3300042598 | Bacteria | 138467 |
| 80 | DPO_contig08106 | 2032320009 | Bacteria | 25636 |
| 81 | CVPL005L_10009984 | 3300002938 | Bacteria | 8235 |
| 82 | Ga0068302_10064936 | 3300005071 | Bacteria | 1589 |
| 83 | Ga0074278_102300 | 3300005721 | Bacteria | 233912 |
| 84 | Ga0104050_1029000 | 3300007153 | Bacteria | 3849 |
| 85 | Ga0105005_1032061 | 3300007505 | Bacteria | 24375 |
| 86 | Ga0105553_1041524 | 3300007767 | Unclassified | 19765 |
| 87 | Ga0123357_10000066 | 3300009784 | Bacteria | 85043 |
| 88 | Ga0562374_0247 | 3300057007 | Bacteria | 108964 |
| 89 | Ga0466711_248682 | 3300042615 | Bacteria | 1679 |
| 90 | Ga0466728_252409 | 3300042620 | Bacteria | 10912 |
| 91 | Ga0466729_009946 | 3300042621 | Bacteria | 39791 |
| 92 | Ga0466730_022697 | 3300042625 | Bacteria | 29318 |
| 93 | Ga0466730_079756 | 3300042625 | Bacteria | 1199 |
| 94 | Ga0466730_090818 | 3300042625 | Unclassified | 3227 |
| 95 | Ga0466704_154581 | 3300042643 | Bacteria | 4899 |
| 96 | Ga0466724_31269 | 3300042649 | Unclassified | 4112 |
| 97 | Ga0466724_41787 | 3300042649 | Bacteria | 42491 |
| 98 | Ga0466725_208422 | 3300042654 | Bacteria | 9187 |
| 99 | Ga0466725_292782 | 3300042654 | Bacteria | 1685 |
| 100 | Ga0466725_436555 | 3300042654 | Bacteria | 1992 |
| 101 | Ga0123357_10012125 | 3300009784 | Unclassified | 11108 |
| 102 | Ga0466707_212579 | 3300042601 | Bacteria | 1184 |
| 103 | Ga0160456_100119 | 3300012820 | Bacteria | 80857 |
| 104 | Ga0160433_100263 | 3300012846 | Bacteria | 36584 |
| 105 | Ga0160435_1001537 | 3300012857 | Bacteria | 5828 |
| 106 | Ga0265387_1000023 | 3300024582 | Bacteria | 64853 |
| 107 | Ga0415639_137432 | 3300038395 | Bacteria | 3601 |
| 108 | Ga0466657_225471 | 3300042582 | Bacteria | 1404 |
| 109 | Ga0466695_245654 | 3300042595 | Bacteria | 2633 |
| 110 | FGTW_contig16985 | 2065487013 | Unclassified | 1651 |
| 111 | SWWA_contig02187__length_4641___numreads_218 | 2100351016 | Bacteria | 4641 |
| 112 | 2227480174 | 2225789004 | Bacteria | 88099 |
| 113 | CVPL010L_1000002 | 3300002932 | Bacteria | 371144 |
| 114 | Ga0063521_1000425 | 3300003973 | Bacteria | 22346 |
| 115 | Ga0074278_122797 | 3300005721 | Bacteria | 2877 |
| 116 | Ga0102735_1002215 | 3300007080 | Bacteria | 3033 |
| 117 | Ga0104045_1005618 | 3300007085 | Unclassified | 13689 |
| 118 | Ga0104041_1115186 | 3300007106 | Bacteria | 1377 |
| 119 | Ga0104050_1005350 | 3300007153 | Unclassified | 12222 |
| 120 | Ga0103264_1000704 | 3300007188 | Bacteria | 15873 |
| 121 | Ga0103264_1001740 | 3300007188 | Bacteria | 10474 |
| 122 | Ga0105524_108296 | 3300007733 | Bacteria | 1384 |
| 123 | Ga0127649_104004 | 3300009460 | Bacteria | 43415 |
| 124 | Ga0127649_107289 | 3300009460 | Bacteria | 3252 |
| 125 | Ga0562377_0137 | 3300056842 | Bacteria | 212469 |
| 126 | Ga0562376_0006 | 3300056857 | Bacteria | 1972915 |
| 127 | Ga0466710_195947 | 3300042613 | Bacteria | 1486 |
| 128 | Ga0466735_049240 | 3300042624 | Bacteria | 7817 |
| 129 | Ga0466730_025396 | 3300042625 | Unclassified | 1265 |
| 130 | Ga0466730_084108 | 3300042625 | Bacteria | 1330 |
| 131 | Ga0466724_29726 | 3300042649 | Bacteria | 169575 |
| 132 | Ga0160464_100642 | 3300012805 | Bacteria | 21797 |
| 133 | Ga0466701_069841 | 3300042598 | Unclassified | 7629 |
| 134 | Ga0466713_034260 | 3300042602 | Bacteria | 72573 |
| 135 | Ga0160469_100139 | 3300012824 | Unclassified | 86949 |
| 136 | Ga0160460_101690 | 3300012845 | Unclassified | 6628 |
| 137 | Ga0160433_102888 | 3300012846 | Bacteria | 3396 |
| 138 | Ga0255572_1000001 | 3300026175 | Bacteria | 634207 |
| 139 | Ga0309903_100006 | 3300029809 | Bacteria | 89427 |
| 140 | Ga0120204_000453 | 3300038942 | Bacteria | 1847 |
| 141 | FGTW_contig30408 | 2065487013 | Bacteria | 95193 |
| 142 | SCG598I20_12745 | 3300000473 | Bacteria | 63326 |
| 143 | JGI24702J35022_10023412 | 3300002462 | Bacteria | 3340 |
| 144 | CVPL010W_10000511 | 3300002931 | Bacteria | 41376 |
| 145 | CVPL005L_10001286 | 3300002938 | Bacteria | 28714 |
| 146 | Ga0063521_1032244 | 3300003973 | Unclassified | 1216 |
| 147 | Ga0103266_1000072 | 3300007067 | Bacteria | 62849 |
| 148 | Ga0102735_1000391 | 3300007080 | Bacteria | 9670 |
| 149 | Ga0105005_1278769 | 3300007505 | Bacteria | 2326 |
| 150 | Ga0127655_1044740 | 3300009459 | Unclassified | 17983 |
| 151 | Ga0466705_037551 | 3300042612 | Bacteria | 17603 |
| 152 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 153 | Ga0562377_0395 | 3300056842 | Bacteria | 79456 |
| 154 | Ga0562375_2107 | 3300056856 | Bacteria | 23531 |
| 155 | Ga0466715_527226 | 3300042616 | Bacteria | 3840 |
| 156 | Ga0466734_037011 | 3300042623 | Bacteria | 28446 |
| 157 | Ga0466735_164501 | 3300042624 | Bacteria | 6191 |
| 158 | Ga0466730_009810 | 3300042625 | Bacteria | 79781 |
| 159 | Ga0466730_100780 | 3300042625 | Bacteria | 6717 |
| 160 | Ga0123356_10042533 | 3300010049 | Bacteria | 4232 |
| 161 | Ga0123356_10052337 | 3300010049 | Bacteria | 3799 |
| 162 | Ga0123353_10049752 | 3300010167 | Bacteria | 6678 |
| 163 | Ga0123354_10001810 | 3300010882 | Unclassified | 26994 |
| 164 | Ga0466717_006857 | 3300042604 | Unclassified | 2324 |
| 165 | Ga0466716_196929 | 3300042605 | Bacteria | 7349 |
| 166 | Ga0466719_311339 | 3300042606 | Bacteria | 7405 |
| 167 | Ga0466720_063929 | 3300042607 | Bacteria | 4142 |
| 168 | Ga0466698_197314 | 3300042610 | Bacteria | 16845 |
| 169 | Ga0160469_102411 | 3300012824 | Bacteria | 3487 |
| 170 | Ga0160467_100517 | 3300012829 | Unclassified | 36390 |
| 171 | Ga0160433_100101 | 3300012846 | Bacteria | 86629 |
| 172 | Ga0160433_100787 | 3300012846 | Bacteria | 11454 |
| 173 | Ga0247290_00948 | 3300035364 | Unclassified | 3911 |
| 174 | Ga0415639_086341 | 3300038395 | Bacteria | 5312 |
| 175 | Ga0466701_015013 | 3300042598 | Unclassified | 31022 |
| 176 | SPBB_contig00253 | 2044078006 | Bacteria | 34953 |
| 177 | Ga0063521_1000440 | 3300003973 | Bacteria | 21455 |
| 178 | Ga0063521_1003803 | 3300003973 | Unclassified | 3569 |
| 179 | Ga0074188_1000166 | 3300005318 | Bacteria | 22045 |
| 180 | Ga0102736_1005297 | 3300007052 | Bacteria | 1660 |
| 181 | Ga0104043_1093056 | 3300007058 | Bacteria | 1351 |
| 182 | Ga0104049_1027415 | 3300007103 | Bacteria | 2580 |
| 183 | Ga0104048_1004086 | 3300007143 | Bacteria | 10161 |
| 184 | Ga0104050_1002233 | 3300007153 | Unclassified | 8259 |
| 185 | Ga0562378_0438 | 3300056814 | Bacteria | 72726 |
| 186 | Ga0466724_54195 | 3300042649 | Unclassified | 1609 |
| 187 | Ga0466724_56819 | 3300042649 | Bacteria | 199566 |
| 188 | Ga0123356_10220030 | 3300010049 | Bacteria | 1954 |
| 189 | Ga0466713_026507 | 3300042602 | Bacteria | 9204 |
| 190 | Ga0466714_140563 | 3300042603 | Bacteria | 2076 |
| 191 | Ga0466719_354291 | 3300042606 | Bacteria | 1439 |
| 192 | Ga0466722_197795 | 3300042609 | Bacteria | 30191 |
| 193 | Ga0160456_100075 | 3300012820 | Unclassified | 137674 |
| 194 | Ga0160467_104537 | 3300012829 | Bacteria | 1946 |
| 195 | Ga0160443_103972 | 3300012848 | Bacteria | 2372 |
| 196 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 197 | Ga0466692_004208 | 3300042591 | Bacteria | 61105 |
| 198 | Ga0466701_003261 | 3300042598 | Unclassified | 4586 |
| 199 | DPOL_contig17044 | 2035918003 | Bacteria | 19735 |
| 200 | SPBB_contig00978 | 2044078006 | Bacteria | 221403 |
| 201 | FGTW_contig18848 | 2065487013 | Unclassified | 4788 |
| 202 | SWWA_contig01497__length_2526___numreads_47 | 2100351016 | Bacteria | 2526 |
| 203 | JGI24705J35276_12218891 | 3300002504 | Unclassified | 2172 |
| 204 | JGI24705J35276_12232612 | 3300002504 | Bacteria | 4409 |
| 205 | WW0001_100261 | 3300002732 | Bacteria | 24199 |
| 206 | CVPL010W_10000551 | 3300002931 | Bacteria | 41299 |
| 207 | CVPL010L_1000110 | 3300002932 | Unclassified | 53357 |
| 208 | Ga0063521_1000003 | 3300003973 | Bacteria | 326101 |
| 209 | Ga0102738_1000057 | 3300007141 | Bacteria | 46246 |
| 210 | Ga0104048_1003071 | 3300007143 | Bacteria | 6057 |
| 211 | Ga0103267_1000137 | 3300007190 | Bacteria | 29225 |
| 212 | Ga0127649_136748 | 3300009460 | Unclassified | 6152 |
| 213 | Ga0562378_1905 | 3300056814 | Unclassified | 20032 |
| 214 | Ga0562375_0001 | 3300056856 | Bacteria | 3661630 |
| 215 | Ga0562375_0838 | 3300056856 | Unclassified | 51619 |
| 216 | Ga0466724_25179 | 3300042649 | Bacteria | 4230 |
| 217 | Ga0123356_10176202 | 3300010049 | Unclassified | 2155 |
| 218 | Ga0160470_100039 | 3300012813 | Bacteria | 196914 |
| 219 | Ga0466701_056399 | 3300042598 | Bacteria | 11841 |
| 220 | Ga0466719_140825 | 3300042606 | Bacteria | 7013 |
| 221 | Ga0160470_100325 | 3300012813 | Unclassified | 26529 |
| 222 | Ga0160459_100228 | 3300012831 | Bacteria | 28476 |
| 223 | Ga0160446_100051 | 3300012835 | Bacteria | 123786 |
| 224 | Ga0160455_100011 | 3300012837 | Bacteria | 590588 |
| 225 | Ga0309902_000002 | 3300028910 | Bacteria | 357102 |
| 226 | Ga0316159_10004 | 3300030930 | Bacteria | 218282 |
| 227 | Ga0316159_10463 | 3300030930 | Bacteria | 16305 |
| 228 | Ga0466657_113665 | 3300042582 | Bacteria | 6023 |
| 229 | Ga0466690_302727 | 3300042590 | Bacteria | 11261 |
| 230 | DPO_contig08731 | 2032320009 | Bacteria | 25815 |
| 231 | 2217613300 | 2209111014 | Bacteria | 37476 |
| 232 | JGI24705J35276_12216625 | 3300002504 | Bacteria | 2055 |
| 233 | JGI24705J35276_12238702 | 3300002504 | Bacteria | 39902 |
| 234 | WW0001_100192 | 3300002732 | Bacteria | 5800 |
| 235 | CVPL005W_1000250 | 3300002934 | Bacteria | 27384 |
| 236 | Ga0103266_1000023 | 3300007067 | Bacteria | 120822 |
| 237 | Ga0102737_1001997 | 3300007142 | Bacteria | 5277 |
| 238 | Ga0104050_1003231 | 3300007153 | Bacteria | 1836 |
| 239 | Ga0104050_1026939 | 3300007153 | Bacteria | 2476 |
| 240 | Ga0103264_1000138 | 3300007188 | Bacteria | 73886 |
| 241 | Ga0123357_10002333 | 3300009784 | Bacteria | 21091 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00490 | ALAD | Delta-aminolevulinic acid dehydratase | 72 | 389 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.