Protein Family IF09061
Metagenome
Isolate
938
Members
679
Samples
386
Scaffolds
343.12
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_261313|Ga0466702_261313_1098_2288
- Length
- 396 aa
- Sequence
- MRKTLCERAHYAPEKYSSICPASLCDFIYASLFPALSIPVIETDKLSVLPNADRLIAPQAKSLQEEAFERALRPQRLADYTGQEKIRAQLEIFIAAAKKRGEALDHVLLFGPPGLGKTTLAHILAQEMGVNLRQTSGPVLERAGDLAALLTNLEPRDILFIDEMHRLSPVVEEILYPAMEDYQIDILIGEGPAARSVKIDLPPFTLVGATTRAGMLTNPLRDRFGITHRLEFYTPDELRQIVHRSARLLNVALDAEGALEIARRSRGTPRVANRLLRRVRDYAEVKFDGVISRAVADTALSLLDVDPAGLDLMDRKLLLAIIEKFDGGPVGVENLAAAIGESRDTIEDVLEPYLIQQGYLQRTLRGRVANPAIYRHLGLPASKSADEPPTLWETSS
Sample Types
Isolate
58.9%
Metagenome
41.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
27.6%
Unclassified
19.8%
Coreidae
12.3%
Termitidae
4.0%
Elmidae
3.5%
Formicidae
2.9%
Drosophilidae
2.8%
Kalotermitidae
2.1%
Muscidae
2.0%
Culicidae
2.0%
Curculionidae
2.0%
Tenebrionidae
1.5%
Armadillidiidae
1.4%
Calliphoridae
1.4%
Sarcophagidae
1.2%
Anthocoridae
1.2%
Aphididae
1.1%
Ixodidae
0.9%
Rhinotermitidae
0.8%
Tephritidae
0.8%
Argasidae
0.6%
Termopsidae
0.6%
Talitridae
0.5%
Palinuridae
0.5%
Hydrophilidae
0.5%
Largidae
0.3%
Cerambycidae
0.3%
Crambidae
0.3%
Pteromalidae
0.3%
Majidae
0.3%
Passalidae
0.3%
Berytidae
0.3%
Pentatomidae
0.3%
Aleyrodidae
0.3%
Alydidae
0.3%
Stratiomyidae
0.2%
Anthomyiidae
0.2%
Pediculidae
0.2%
Artemiidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Nephropidae
0.2%
Triozidae
0.2%
Cicadellidae
0.2%
Plutellidae
0.2%
Pseudococcidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Cixiidae
0.2%
Gryllidae
0.2%
Lysianassidae
0.2%
Hodotermitidae
0.2%
Noctuidae
0.2%
Taxonomy
Archaea
0
Bacteria
865
Eukaryota
0
Viruses
0
Unclassified
73
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 2 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 3 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 4 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 5 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 6 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 7 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 8 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 9 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 10 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 11 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 12 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 13 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 14 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 15 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 16 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 17 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 18 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 19 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 20 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 21 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 22 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 23 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 24 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 25 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 26 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 27 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 28 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 29 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 30 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 31 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 32 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 33 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 34 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 35 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 36 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 37 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 38 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 39 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 40 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 41 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 42 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 43 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 44 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 45 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 46 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 49 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 50 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 54 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 55 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 56 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 57 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 58 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 59 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 60 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 61 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 62 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 63 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 64 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 65 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 66 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 67 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 68 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 69 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 70 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 71 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 72 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 73 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 74 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 79 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 80 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 81 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 82 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 83 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 84 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 85 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 86 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 87 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 88 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 89 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 90 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 91 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 92 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 93 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 94 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 95 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 96 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 97 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 98 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 99 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 100 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 101 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 102 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 103 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 104 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 105 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 106 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 107 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 108 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 109 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 110 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 111 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 112 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 113 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 114 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 115 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 116 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 117 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 118 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 119 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 120 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 121 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 122 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 123 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 124 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 125 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 126 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 127 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 128 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 129 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 130 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 131 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 132 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 133 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 134 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 135 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 136 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 137 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 138 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 139 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 140 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 141 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 142 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 143 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 144 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 145 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 146 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 147 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 148 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 149 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 150 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 151 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 152 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 153 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 154 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 155 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 156 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 157 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 158 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 159 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 160 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 161 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 162 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 163 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 164 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 165 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 166 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 167 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 168 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 169 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 170 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 171 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 172 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 173 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 174 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 175 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 176 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 177 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 178 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 179 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 180 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 181 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 182 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 183 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 184 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 185 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 186 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 187 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 188 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 189 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 190 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 191 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 192 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 193 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 194 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 195 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 196 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 197 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 198 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 199 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 200 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 201 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 202 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 203 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 204 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 205 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 206 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 207 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 208 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 209 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 210 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 211 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 212 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 213 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 214 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 215 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 216 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 217 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 218 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 219 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 220 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 221 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 222 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 223 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 224 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 225 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 226 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 227 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 228 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 229 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 230 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 231 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 232 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 233 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 234 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 235 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 236 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 237 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 238 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 239 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 240 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 241 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 242 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 243 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 244 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 245 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 246 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 247 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 248 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 249 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 250 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 251 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 252 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 253 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 254 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 255 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 256 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 257 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 258 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 259 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 260 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 261 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 262 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 263 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 264 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 265 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 266 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 267 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 268 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 269 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 270 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 271 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 272 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 273 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 274 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 275 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 276 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 277 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 278 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 279 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 280 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 281 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 282 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 283 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 284 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 285 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 286 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 287 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 288 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 289 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 290 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 291 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 292 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 293 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 294 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 295 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 296 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 297 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 298 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 299 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 300 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 301 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 302 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 303 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 304 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 305 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 306 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 307 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 308 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 309 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 310 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 311 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 312 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 313 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 314 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 315 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 316 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 317 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 318 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 319 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 320 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 321 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 322 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 323 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 324 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 325 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 326 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 327 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 328 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 329 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 330 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 331 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 332 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 333 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 334 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 335 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 336 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 337 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 338 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 339 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 340 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 341 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 342 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 343 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 344 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 345 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 346 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 347 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 348 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 349 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 350 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 351 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 352 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 353 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 354 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 355 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 356 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 357 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 358 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 359 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 360 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 361 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 362 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 363 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 364 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 365 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 366 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 367 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 368 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 369 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 370 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 371 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 372 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 373 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 374 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 375 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 376 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 377 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 378 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 379 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 380 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 381 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 382 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 383 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 384 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 385 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 386 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 387 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 388 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 389 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 390 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 391 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 392 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 393 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 394 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 395 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 396 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 397 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 398 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 399 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 400 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 401 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 402 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 403 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 404 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 405 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 406 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 407 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 408 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 409 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 410 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 411 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 412 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 413 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 414 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 415 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 416 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 417 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 418 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 419 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 420 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 421 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 422 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 423 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 424 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 425 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 426 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 427 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 428 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 429 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 430 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 431 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 432 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 433 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 434 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 435 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 436 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 437 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 438 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 439 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 440 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 441 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 442 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 443 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 444 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 445 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 446 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 447 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 448 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 449 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 450 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 451 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 452 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 453 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 454 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 455 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 456 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 457 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 458 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 459 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 460 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 461 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 462 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 463 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 464 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 465 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 466 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 467 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 468 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 469 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 470 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 471 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 472 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 473 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 474 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 475 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 476 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 477 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 478 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 479 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 480 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 481 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 482 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 483 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 484 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 485 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 486 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 487 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 488 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 489 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 490 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 491 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 492 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 493 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 494 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 495 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 496 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 497 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 498 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 499 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 500 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 501 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 502 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 503 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 504 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 505 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 506 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 507 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 508 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 509 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 510 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 511 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 512 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 513 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 514 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 515 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 516 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 517 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 518 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 519 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 520 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 521 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 522 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 523 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 524 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 525 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 526 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 527 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 528 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 529 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 530 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 531 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 532 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 533 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 534 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 535 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 536 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 537 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 538 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 539 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 540 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 541 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 542 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 543 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 544 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 545 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 546 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 547 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 548 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 549 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 550 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 551 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 552 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 553 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 554 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 555 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 556 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 557 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 558 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 559 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 560 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 561 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 562 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 563 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 564 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 565 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 566 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 567 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 568 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 569 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 570 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 571 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 572 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 573 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 574 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 575 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 576 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 577 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 578 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 579 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 580 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 581 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 582 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 583 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 584 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 585 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 586 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 587 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 588 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 589 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 590 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 591 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 592 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 593 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 594 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 595 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 596 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 597 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 598 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 599 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 600 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 601 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 602 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 603 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 604 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 605 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 606 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 607 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 608 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 609 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 610 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 611 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 612 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 613 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 614 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 615 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 616 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 617 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 618 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 619 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 620 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 621 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 622 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 623 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 624 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 625 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 626 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 627 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 628 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 629 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 630 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 631 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 632 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 633 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 634 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 635 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 636 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 637 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 638 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 639 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 640 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 641 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 642 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 643 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 644 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 645 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 646 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 647 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 648 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 649 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 650 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 651 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 652 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 653 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 654 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 655 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 656 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 657 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 658 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 659 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 660 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 661 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 662 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 663 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 664 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 665 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 666 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 667 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 668 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 669 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 670 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 671 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 672 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 673 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 674 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 675 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 676 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 677 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 678 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 679 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_018523 | 3300042613 | Bacteria | 58589 |
| 2 | Ga0466715_058200 | 3300042616 | Bacteria | 8825 |
| 3 | Ga0466715_150513 | 3300042616 | Bacteria | 21916 |
| 4 | Ga0466715_392279 | 3300042616 | Bacteria | 1113 |
| 5 | Ga0466718_149892 | 3300042617 | Bacteria | 1565 |
| 6 | Ga0466728_249811 | 3300042620 | Bacteria | 3717 |
| 7 | Ga0466701_101009 | 3300042598 | Bacteria | 28631 |
| 8 | Ga0466713_037544 | 3300042602 | Bacteria | 80640 |
| 9 | Ga0466717_029840 | 3300042604 | Bacteria | 6839 |
| 10 | Ga0466716_182187 | 3300042605 | Bacteria | 20424 |
| 11 | Ga0466722_062110 | 3300042609 | Unclassified | 10055 |
| 12 | Ga0530661_000874 | 3300056564 | Bacteria | 18753 |
| 13 | Ga0562375_0331 | 3300056856 | Bacteria | 112487 |
| 14 | Ga0466734_125625 | 3300042623 | Bacteria | 6502 |
| 15 | Ga0466730_022772 | 3300042625 | Bacteria | 14854 |
| 16 | Ga0466730_086547 | 3300042625 | Bacteria | 310448 |
| 17 | Ga0466702_261313 | 3300042635 | Bacteria | 8044 |
| 18 | Ga0466704_255360 | 3300042643 | Bacteria | 31086 |
| 19 | Ga0466704_336500 | 3300042643 | Bacteria | 17787 |
| 20 | Ga0466709_416403 | 3300042648 | Bacteria | 1895 |
| 21 | Ga0466724_33236 | 3300042649 | Unclassified | 2396 |
| 22 | Ga0466724_40402 | 3300042649 | Bacteria | 12885 |
| 23 | Ga0466724_67643 | 3300042649 | Bacteria | 8286 |
| 24 | Ga0466708_136907 | 3300042652 | Unclassified | 30647 |
| 25 | Ga0466708_265174 | 3300042652 | Bacteria | 3630 |
| 26 | Ga0466725_006538 | 3300042654 | Bacteria | 1924 |
| 27 | Ga0466725_187630 | 3300042654 | Unclassified | 20718 |
| 28 | Ga0466725_247354 | 3300042654 | Bacteria | 5372 |
| 29 | Ga0160453_105509 | 3300012814 | Bacteria | 2042 |
| 30 | Ga0160440_100012 | 3300012815 | Bacteria | 357729 |
| 31 | Ga0160444_100054 | 3300012841 | Bacteria | 164713 |
| 32 | Ga0160443_100181 | 3300012848 | Bacteria | 85846 |
| 33 | Ga0160434_104684 | 3300012850 | Unclassified | 2274 |
| 34 | Ga0160430_100126 | 3300012852 | Bacteria | 65835 |
| 35 | Ga0466657_014972 | 3300042582 | Bacteria | 2669 |
| 36 | Ga0466657_027069 | 3300042582 | Bacteria | 28240 |
| 37 | Ga0466657_338583 | 3300042582 | Bacteria | 3530 |
| 38 | Ga0466696_116197 | 3300042596 | Bacteria | 1556 |
| 39 | SCG598L16_135381 | 3300000490 | Unclassified | 4924 |
| 40 | JGI24702J35022_10018868 | 3300002462 | Bacteria | 3757 |
| 41 | CVPL010W_10000762 | 3300002931 | Bacteria | 59721 |
| 42 | CVPL010W_10001195 | 3300002931 | Bacteria | 30010 |
| 43 | CVPL010W_10002762 | 3300002931 | Unclassified | 20609 |
| 44 | CVPL010W_10005230 | 3300002931 | Unclassified | 13988 |
| 45 | Ga0063521_1000088 | 3300003973 | Bacteria | 75984 |
| 46 | Ga0068302_10061161 | 3300005071 | Unclassified | 4013 |
| 47 | Ga0102736_1001918 | 3300007052 | Unclassified | 6282 |
| 48 | Ga0102734_1001891 | 3300007129 | Unclassified | 5080 |
| 49 | Ga0102740_1004650 | 3300007140 | Unclassified | 2695 |
| 50 | Ga0102737_1000802 | 3300007142 | Bacteria | 9716 |
| 51 | Ga0104050_1200014 | 3300007153 | Bacteria | 2904 |
| 52 | Ga0103268_1000521 | 3300007192 | Bacteria | 11518 |
| 53 | Ga0103268_1000575 | 3300007192 | Unclassified | 24607 |
| 54 | Ga0123356_10295976 | 3300010049 | Unclassified | 1721 |
| 55 | Ga0123354_10025517 | 3300010882 | Unclassified | 9318 |
| 56 | Ga0123354_10072302 | 3300010882 | Bacteria | 4967 |
| 57 | Ga0160471_100028 | 3300012812 | Bacteria | 250178 |
| 58 | Ga0466710_197514 | 3300042613 | Bacteria | 3161 |
| 59 | Ga0466711_050511 | 3300042615 | Bacteria | 4414 |
| 60 | Ga0466711_193748 | 3300042615 | Bacteria | 5417 |
| 61 | Ga0466715_053289 | 3300042616 | Unclassified | 66115 |
| 62 | Ga0466701_061335 | 3300042598 | Bacteria | 23425 |
| 63 | Ga0466701_070798 | 3300042598 | Unclassified | 22724 |
| 64 | Ga0466713_041366 | 3300042602 | Bacteria | 9753 |
| 65 | Ga0466716_024070 | 3300042605 | Bacteria | 10307 |
| 66 | Ga0466719_446317 | 3300042606 | Unclassified | 4129 |
| 67 | Ga0466721_067970 | 3300042608 | Bacteria | 3431 |
| 68 | Ga0466722_206370 | 3300042609 | Unclassified | 1852 |
| 69 | Ga0562377_0071 | 3300056842 | Bacteria | 439264 |
| 70 | Ga0466734_077239 | 3300042623 | Bacteria | 22817 |
| 71 | Ga0466730_007932 | 3300042625 | Unclassified | 4384 |
| 72 | Ga0466730_008869 | 3300042625 | Bacteria | 313970 |
| 73 | Ga0466730_076754 | 3300042625 | Bacteria | 3821 |
| 74 | Ga0466703_284619 | 3300042636 | Bacteria | 67055 |
| 75 | Ga0466724_19623 | 3300042649 | Unclassified | 4050 |
| 76 | Ga0466708_027660 | 3300042652 | Bacteria | 11484 |
| 77 | Ga0466725_243771 | 3300042654 | Bacteria | 53152 |
| 78 | Ga0466725_293398 | 3300042654 | Bacteria | 108111 |
| 79 | Ga0160431_100119 | 3300012828 | Bacteria | 58715 |
| 80 | Ga0160447_101757 | 3300012849 | Unclassified | 8127 |
| 81 | Ga0247290_00919 | 3300035364 | Bacteria | 4048 |
| 82 | Ga0466656_297191 | 3300042550 | Unclassified | 1560 |
| 83 | Ga0466690_354186 | 3300042590 | Bacteria | 14821 |
| 84 | Ga0466692_106464 | 3300042591 | Bacteria | 2799 |
| 85 | IMNBGM34_c000103 | 3300000036 | Bacteria | 24740 |
| 86 | HBC_ctgsDRAFT_1025324 | 3300000333 | Bacteria | 1455 |
| 87 | SCG598B02_12320 | 3300000472 | Bacteria | 34669 |
| 88 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 89 | CVPL010W_10000887 | 3300002931 | Bacteria | 33859 |
| 90 | CVPL005W_1000010 | 3300002934 | Bacteria | 73250 |
| 91 | CVPL005L_10001770 | 3300002938 | Unclassified | 24957 |
| 92 | CVPL005L_10013145 | 3300002938 | Unclassified | 5967 |
| 93 | Ga0102734_1006544 | 3300007129 | Bacteria | 2615 |
| 94 | Ga0103260_1007290 | 3300007139 | Unclassified | 1568 |
| 95 | Ga0102740_1000646 | 3300007140 | Bacteria | 9493 |
| 96 | Ga0102740_1001591 | 3300007140 | Unclassified | 5631 |
| 97 | Ga0102738_1004263 | 3300007141 | Unclassified | 2053 |
| 98 | Ga0102737_1000305 | 3300007142 | Bacteria | 16700 |
| 99 | Ga0103264_1001542 | 3300007188 | Bacteria | 10153 |
| 100 | Ga0105005_1025482 | 3300007505 | Bacteria | 7514 |
| 101 | Ga0123357_10001127 | 3300009784 | Bacteria | 27764 |
| 102 | Ga0123357_10008259 | 3300009784 | Bacteria | 12987 |
| 103 | Ga0136159_1000014 | 3300010217 | Bacteria | 131100 |
| 104 | Ga0466705_499493 | 3300042612 | Unclassified | 2057 |
| 105 | Ga0466710_235104 | 3300042613 | Bacteria | 11594 |
| 106 | Ga0466711_091507 | 3300042615 | Bacteria | 36001 |
| 107 | Ga0466715_156350 | 3300042616 | Bacteria | 120435 |
| 108 | Ga0466723_014509 | 3300042618 | Bacteria | 63718 |
| 109 | Ga0466701_026127 | 3300042598 | Bacteria | 91784 |
| 110 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 111 | Ga0466701_094759 | 3300042598 | Unclassified | 3474 |
| 112 | Ga0466707_099567 | 3300042601 | Bacteria | 43816 |
| 113 | Ga0466707_156670 | 3300042601 | Bacteria | 1412 |
| 114 | Ga0466713_003470 | 3300042602 | Bacteria | 99693 |
| 115 | Ga0466713_077596 | 3300042602 | Bacteria | 70669 |
| 116 | Ga0466713_091552 | 3300042602 | Bacteria | 57189 |
| 117 | Ga0466733_064462 | 3300042659 | Bacteria | 9786 |
| 118 | Ga0562377_0066 | 3300056842 | Bacteria | 455762 |
| 119 | Ga0466735_118783 | 3300042624 | Bacteria | 5702 |
| 120 | Ga0466703_254996 | 3300042636 | Bacteria | 15867 |
| 121 | Ga0466704_548979 | 3300042643 | Unclassified | 1625 |
| 122 | Ga0466709_005288 | 3300042648 | Bacteria | 8740 |
| 123 | Ga0466709_198599 | 3300042648 | Bacteria | 15529 |
| 124 | Ga0466724_08647 | 3300042649 | Unclassified | 4785 |
| 125 | Ga0466708_316190 | 3300042652 | Bacteria | 3603 |
| 126 | Ga0466727_074891 | 3300042655 | Bacteria | 85958 |
| 127 | Ga0160468_100007 | 3300012819 | Bacteria | 512481 |
| 128 | Ga0160469_100012 | 3300012824 | Bacteria | 446228 |
| 129 | Ga0160455_100009 | 3300012837 | Bacteria | 602667 |
| 130 | Ga0160448_100218 | 3300012854 | Bacteria | 23562 |
| 131 | Ga0160457_1008558 | 3300012858 | Unclassified | 1473 |
| 132 | Ga0265387_1000012 | 3300024582 | Bacteria | 74513 |
| 133 | Ga0247290_01062 | 3300035364 | Unclassified | 3528 |
| 134 | Ga0466657_262341 | 3300042582 | Bacteria | 5895 |
| 135 | Ga0466690_405819 | 3300042590 | Bacteria | 18442 |
| 136 | SCG598L16_135382 | 3300000490 | Unclassified | 2471 |
| 137 | CVPL010W_10018752 | 3300002931 | Bacteria | 4267 |
| 138 | CVPL005W_1004552 | 3300002934 | Bacteria | 2280 |
| 139 | CVPL005L_10001949 | 3300002938 | Unclassified | 43178 |
| 140 | Ga0074278_150101 | 3300005721 | Bacteria | 8442 |
| 141 | Ga0103260_1000034 | 3300007139 | Bacteria | 49468 |
| 142 | Ga0102737_1000028 | 3300007142 | Bacteria | 48041 |
| 143 | Ga0102737_1003808 | 3300007142 | Unclassified | 3351 |
| 144 | Ga0104019_1036105 | 3300007150 | Unclassified | 2097 |
| 145 | Ga0103264_1000522 | 3300007188 | Bacteria | 19337 |
| 146 | Ga0103264_1033823 | 3300007188 | Bacteria | 2302 |
| 147 | Ga0127649_145138 | 3300009460 | Bacteria | 4161 |
| 148 | Ga0123357_10000047 | 3300009784 | Bacteria | 99859 |
| 149 | Ga0123355_10372697 | 3300009826 | Unclassified | 1868 |
| 150 | Ga0160464_100322 | 3300012805 | Bacteria | 41868 |
| 151 | Ga0466705_500615 | 3300042612 | Bacteria | 16692 |
| 152 | Ga0466711_275855 | 3300042615 | Unclassified | 12538 |
| 153 | Ga0466715_425257 | 3300042616 | Bacteria | 3226 |
| 154 | Ga0466715_529625 | 3300042616 | Bacteria | 3866 |
| 155 | Ga0466723_133614 | 3300042618 | Bacteria | 24457 |
| 156 | Ga0466728_355792 | 3300042620 | Bacteria | 14865 |
| 157 | Ga0466707_021848 | 3300042601 | Bacteria | 26269 |
| 158 | Ga0466707_415793 | 3300042601 | Bacteria | 6108 |
| 159 | Ga0466719_253802 | 3300042606 | Bacteria | 11288 |
| 160 | Ga0466719_405757 | 3300042606 | Bacteria | 1985 |
| 161 | Ga0466722_239292 | 3300042609 | Bacteria | 73982 |
| 162 | Ga0530661_005526 | 3300056564 | Bacteria | 3703 |
| 163 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 164 | Ga0466705_091155 | 3300042612 | Bacteria | 29389 |
| 165 | Ga0466730_018277 | 3300042625 | Bacteria | 12369 |
| 166 | Ga0466730_026922 | 3300042625 | Unclassified | 5371 |
| 167 | Ga0466704_290921 | 3300042643 | Bacteria | 19251 |
| 168 | Ga0466724_07985 | 3300042649 | Unclassified | 6292 |
| 169 | Ga0466708_032822 | 3300042652 | Bacteria | 55307 |
| 170 | Ga0466708_130429 | 3300042652 | Bacteria | 31456 |
| 171 | Ga0466708_391702 | 3300042652 | Unclassified | 7418 |
| 172 | Ga0466725_019526 | 3300042654 | Bacteria | 20294 |
| 173 | Ga0466725_044242 | 3300042654 | Bacteria | 6857 |
| 174 | Ga0160444_100186 | 3300012841 | Bacteria | 57198 |
| 175 | Ga0160460_100010 | 3300012845 | Bacteria | 503980 |
| 176 | Ga0160447_104683 | 3300012849 | Bacteria | 3988 |
| 177 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 178 | Ga0316159_10922 | 3300030930 | Bacteria | 4105 |
| 179 | Ga0466657_117791 | 3300042582 | Bacteria | 208686 |
| 180 | Ga0466657_185828 | 3300042582 | Bacteria | 2404 |
| 181 | Ga0466692_049502 | 3300042591 | Bacteria | 26947 |
| 182 | Ga0466695_218234 | 3300042595 | Bacteria | 21608 |
| 183 | JGI24705J35276_12235915 | 3300002504 | Bacteria | 7161 |
| 184 | JGI24705J35276_12238402 | 3300002504 | Bacteria | 21130 |
| 185 | CVPL010W_10006341 | 3300002931 | Bacteria | 12189 |
| 186 | Ga0068305_10067880 | 3300005083 | Bacteria | 14614 |
| 187 | Ga0102735_1001631 | 3300007080 | Bacteria | 3707 |
| 188 | Ga0102734_1000015 | 3300007129 | Bacteria | 53950 |
| 189 | Ga0102738_1000211 | 3300007141 | Bacteria | 12348 |
| 190 | Ga0102738_1001851 | 3300007141 | Unclassified | 3225 |
| 191 | Ga0104040_1002413 | 3300007149 | Bacteria | 2845 |
| 192 | Ga0104019_1002853 | 3300007150 | Bacteria | 3288 |
| 193 | Ga0103267_1000026 | 3300007190 | Bacteria | 57778 |
| 194 | Ga0103267_1007484 | 3300007190 | Unclassified | 5128 |
| 195 | Ga0123353_10150719 | 3300010167 | Bacteria | 3713 |
| 196 | Ga0123353_10756986 | 3300010167 | Bacteria | 1351 |
| 197 | Ga0123354_10000374 | 3300010882 | Bacteria | 42593 |
| 198 | Ga0466710_133064 | 3300042613 | Bacteria | 70935 |
| 199 | Ga0466715_569877 | 3300042616 | Bacteria | 5890 |
| 200 | Ga0466718_067451 | 3300042617 | Bacteria | 4304 |
| 201 | Ga0466726_198709 | 3300042619 | Bacteria | 8763 |
| 202 | Ga0466707_012449 | 3300042601 | Bacteria | 24675 |
| 203 | Ga0466713_129565 | 3300042602 | Bacteria | 15582 |
| 204 | Ga0466717_046499 | 3300042604 | Bacteria | 2014 |
| 205 | Ga0466717_151403 | 3300042604 | Bacteria | 8199 |
| 206 | Ga0466717_209614 | 3300042604 | Bacteria | 12662 |
| 207 | Ga0466722_100076 | 3300042609 | Bacteria | 5124 |
| 208 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 209 | Ga0466697_213423 | 3300042611 | Bacteria | 4913 |
| 210 | Ga0466705_060808 | 3300042612 | Bacteria | 5019 |
| 211 | Ga0466705_104530 | 3300042612 | Bacteria | 16828 |
| 212 | Ga0466705_270454 | 3300042612 | Bacteria | 4921 |
| 213 | Ga0466734_130652 | 3300042623 | Bacteria | 1952 |
| 214 | Ga0466730_030710 | 3300042625 | Unclassified | 5742 |
| 215 | Ga0466730_045914 | 3300042625 | Bacteria | 132698 |
| 216 | Ga0466724_18019 | 3300042649 | Unclassified | 5308 |
| 217 | Ga0466725_068914 | 3300042654 | Bacteria | 4732 |
| 218 | Ga0160447_100214 | 3300012849 | Unclassified | 32855 |
| 219 | Ga0160434_100304 | 3300012850 | Bacteria | 17125 |
| 220 | Ga0466692_190209 | 3300042591 | Bacteria | 13472 |
| 221 | Ga0466694_328948 | 3300042594 | Bacteria | 7193 |
| 222 | Ga0466696_484948 | 3300042596 | Bacteria | 1818 |
| 223 | FGTW_contig13225 | 2065487013 | Unclassified | 28919 |
| 224 | gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 | 2189573031 | Bacteria | 78604 |
| 225 | HBC_ctgsDRAFT_1016558 | 3300000333 | Bacteria | 1792 |
| 226 | WW0001_100293 | 3300002732 | Bacteria | 110843 |
| 227 | Ga0068302_10011546 | 3300005071 | Bacteria | 4095 |
| 228 | Ga0103263_100135 | 3300007042 | Bacteria | 12785 |
| 229 | Ga0102736_1000051 | 3300007052 | Bacteria | 111370 |
| 230 | Ga0102739_1000090 | 3300007095 | Bacteria | 25869 |
| 231 | Ga0102739_1000714 | 3300007095 | Bacteria | 6154 |
| 232 | Ga0104049_1131563 | 3300007103 | Bacteria | 2317 |
| 233 | Ga0102737_1000223 | 3300007142 | Unclassified | 19249 |
| 234 | Ga0103264_1000312 | 3300007188 | Bacteria | 26656 |
| 235 | Ga0103264_1001770 | 3300007188 | Bacteria | 21232 |
| 236 | Ga0123356_10419745 | 3300010049 | Bacteria | 1480 |
| 237 | Ga0123353_10302735 | 3300010167 | Bacteria | 2439 |
| 238 | Ga0160466_100031 | 3300012809 | Bacteria | 230279 |
| 239 | Ga0466711_410337 | 3300042615 | Bacteria | 2264 |
| 240 | Ga0466715_041158 | 3300042616 | Bacteria | 3515 |
| 241 | Ga0466715_373577 | 3300042616 | Bacteria | 6509 |
| 242 | Ga0466715_609945 | 3300042616 | Bacteria | 50733 |
| 243 | Ga0466728_098662 | 3300042620 | Bacteria | 18809 |
| 244 | Ga0466729_049384 | 3300042621 | Bacteria | 40603 |
| 245 | Ga0466701_098447 | 3300042598 | Bacteria | 82442 |
| 246 | Ga0466717_173597 | 3300042604 | Bacteria | 1569 |
| 247 | Ga0466716_033799 | 3300042605 | Unclassified | 9200 |
| 248 | Ga0466719_151487 | 3300042606 | Unclassified | 13478 |
| 249 | Ga0466722_078040 | 3300042609 | Bacteria | 19258 |
| 250 | Ga0466729_226152 | 3300042621 | Bacteria | 57974 |
| 251 | Ga0466734_034261 | 3300042623 | Bacteria | 15895 |
| 252 | Ga0466734_039636 | 3300042623 | Bacteria | 2177 |
| 253 | Ga0466734_132786 | 3300042623 | Bacteria | 18612 |
| 254 | Ga0466734_133793 | 3300042623 | Bacteria | 5585 |
| 255 | Ga0466730_008815 | 3300042625 | Bacteria | 5002 |
| 256 | Ga0466709_414394 | 3300042648 | Bacteria | 47739 |
| 257 | Ga0466724_33561 | 3300042649 | Bacteria | 205596 |
| 258 | Ga0160472_100105 | 3300012839 | Bacteria | 135252 |
| 259 | Ga0160444_100623 | 3300012841 | Bacteria | 12336 |
| 260 | Ga0265387_1000172 | 3300024582 | Bacteria | 11728 |
| 261 | Ga0466657_151426 | 3300042582 | Bacteria | 5961 |
| 262 | Ga0466657_249994 | 3300042582 | Bacteria | 28084 |
| 263 | Ga0466690_406807 | 3300042590 | Bacteria | 11318 |
| 264 | gam1t_NODE_536914_length=8508_GC=35_9_Contigs=8 | 2189573031 | Unclassified | 8578 |
| 265 | SCG598O02_12457 | 3300000460 | Unclassified | 11692 |
| 266 | JGI24702J35022_10000558 | 3300002462 | Bacteria | 22534 |
| 267 | CVPL005W_1000296 | 3300002934 | Bacteria | 24709 |
| 268 | Ga0063521_1000003 | 3300003973 | Bacteria | 326101 |
| 269 | Ga0072941_1249357 | 3300005201 | Bacteria | 3290 |
| 270 | Ga0074278_151107 | 3300005721 | Bacteria | 2605 |
| 271 | Ga0104042_1119470 | 3300007130 | Bacteria | 3793 |
| 272 | Ga0102740_1000004 | 3300007140 | Unclassified | 66575 |
| 273 | Ga0102738_1001491 | 3300007141 | Unclassified | 3639 |
| 274 | Ga0102737_1000561 | 3300007142 | Bacteria | 11958 |
| 275 | Ga0103264_1000004 | 3300007188 | Bacteria | 153563 |
| 276 | Ga0103264_1000967 | 3300007188 | Bacteria | 12874 |
| 277 | Ga0103264_1016777 | 3300007188 | Bacteria | 3586 |
| 278 | Ga0105553_1115254 | 3300007767 | Bacteria | 3438 |
| 279 | Ga0127657_100025 | 3300009457 | Bacteria | 16621 |
| 280 | Ga0123357_10160330 | 3300009784 | Bacteria | 2698 |
| 281 | Ga0160471_101223 | 3300012812 | Bacteria | 5389 |
| 282 | Ga0466710_032288 | 3300042613 | Bacteria | 10505 |
| 283 | Ga0466712_008653 | 3300042614 | Bacteria | 13744 |
| 284 | Ga0466718_143671 | 3300042617 | Bacteria | 1786 |
| 285 | Ga0466726_265131 | 3300042619 | Bacteria | 25324 |
| 286 | Ga0466701_019515 | 3300042598 | Bacteria | 190398 |
| 287 | Ga0466706_085445 | 3300042599 | Unclassified | 1851 |
| 288 | Ga0466706_186334 | 3300042599 | Bacteria | 3424 |
| 289 | Ga0466707_411798 | 3300042601 | Bacteria | 89808 |
| 290 | Ga0466713_102357 | 3300042602 | Bacteria | 3742 |
| 291 | Ga0466719_019682 | 3300042606 | Bacteria | 17887 |
| 292 | Ga0466722_115714 | 3300042609 | Bacteria | 4168 |
| 293 | Ga0466722_221950 | 3300042609 | Bacteria | 4012 |
| 294 | Ga0466733_046970 | 3300042659 | Bacteria | 4662 |
| 295 | Ga0466733_123366 | 3300042659 | Bacteria | 14693 |
| 296 | Ga0466705_015477 | 3300042612 | Bacteria | 11893 |
| 297 | Ga0466705_115422 | 3300042612 | Bacteria | 8718 |
| 298 | Ga0466705_319190 | 3300042612 | Bacteria | 2114 |
| 299 | Ga0466734_014030 | 3300042623 | Bacteria | 15802 |
| 300 | Ga0466734_019715 | 3300042623 | Bacteria | 2011 |
| 301 | Ga0466703_115599 | 3300042636 | Unclassified | 7269 |
| 302 | Ga0466703_430886 | 3300042636 | Bacteria | 17829 |
| 303 | Ga0466704_491544 | 3300042643 | Bacteria | 3604 |
| 304 | Ga0466724_23364 | 3300042649 | Bacteria | 87381 |
| 305 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 306 | Ga0466724_43743 | 3300042649 | Bacteria | 83563 |
| 307 | Ga0466708_095669 | 3300042652 | Bacteria | 8438 |
| 308 | Ga0466708_230436 | 3300042652 | Bacteria | 15813 |
| 309 | Ga0466708_414270 | 3300042652 | Bacteria | 15581 |
| 310 | Ga0466725_076164 | 3300042654 | Bacteria | 10381 |
| 311 | Ga0466725_230125 | 3300042654 | Bacteria | 55475 |
| 312 | Ga0466725_349819 | 3300042654 | Bacteria | 13361 |
| 313 | Ga0466727_097908 | 3300042655 | Bacteria | 5909 |
| 314 | Ga0160440_100156 | 3300012815 | Bacteria | 62914 |
| 315 | Ga0160469_100108 | 3300012824 | Bacteria | 126782 |
| 316 | Ga0160467_100028 | 3300012829 | Unclassified | 269267 |
| 317 | Ga0160446_100067 | 3300012835 | Bacteria | 107057 |
| 318 | Ga0160433_101216 | 3300012846 | Bacteria | 7643 |
| 319 | Ga0160435_1001292 | 3300012857 | Bacteria | 6466 |
| 320 | Ga0160436_1002075 | 3300012861 | Unclassified | 5242 |
| 321 | Ga0415639_259372 | 3300038395 | Bacteria | 2281 |
| 322 | Ga0466694_342464 | 3300042594 | Bacteria | 2938 |
| 323 | DPOL_contig17549 | 2035918003 | Unclassified | 1824 |
| 324 | IMNBL1DRAFT_c0002880 | 3300000062 | Bacteria | 11535 |
| 325 | HBC_ctgsDRAFT_1001470 | 3300000333 | Bacteria | 5157 |
| 326 | JGI24705J35276_12238703 | 3300002504 | Bacteria | 39951 |
| 327 | CVPL010L_1000051 | 3300002932 | Bacteria | 128613 |
| 328 | CVPL005L_10011635 | 3300002938 | Unclassified | 6797 |
| 329 | Ga0074278_111699 | 3300005721 | Unclassified | 8578 |
| 330 | Ga0102736_1001489 | 3300007052 | Bacteria | 4095 |
| 331 | Ga0102738_1000068 | 3300007141 | Bacteria | 73178 |
| 332 | Ga0102738_1000468 | 3300007141 | Unclassified | 6860 |
| 333 | Ga0102737_1000474 | 3300007142 | Bacteria | 22011 |
| 334 | Ga0104019_1193487 | 3300007150 | Bacteria | 1443 |
| 335 | Ga0103264_1009855 | 3300007188 | Unclassified | 14075 |
| 336 | Ga0123354_10030901 | 3300010882 | Bacteria | 8406 |
| 337 | Ga0466711_287617 | 3300042615 | Bacteria | 5803 |
| 338 | Ga0466715_253438 | 3300042616 | Bacteria | 2609 |
| 339 | Ga0466723_123689 | 3300042618 | Bacteria | 19530 |
| 340 | Ga0466701_038404 | 3300042598 | Bacteria | 3328 |
| 341 | Ga0466707_239291 | 3300042601 | Bacteria | 4461 |
| 342 | Ga0466713_074776 | 3300042602 | Bacteria | 1189 |
| 343 | Ga0466719_023398 | 3300042606 | Unclassified | 4956 |
| 344 | Ga0466719_421552 | 3300042606 | Bacteria | 5124 |
| 345 | Ga0562378_0898 | 3300056814 | Bacteria | 38721 |
| 346 | Ga0466697_273732 | 3300042611 | Bacteria | 2451 |
| 347 | Ga0466734_173740 | 3300042623 | Bacteria | 3106 |
| 348 | Ga0466730_009020 | 3300042625 | Bacteria | 218991 |
| 349 | Ga0466703_338574 | 3300042636 | Unclassified | 1876 |
| 350 | Ga0466709_411005 | 3300042648 | Bacteria | 41852 |
| 351 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 352 | Ga0466724_52261 | 3300042649 | Unclassified | 6678 |
| 353 | Ga0466725_066591 | 3300042654 | Bacteria | 3539 |
| 354 | Ga0160459_100016 | 3300012831 | Bacteria | 400301 |
| 355 | Ga0160460_100022 | 3300012845 | Bacteria | 343535 |
| 356 | Ga0160460_100149 | 3300012845 | Bacteria | 80161 |
| 357 | Ga0160433_104930 | 3300012846 | Bacteria | 2074 |
| 358 | Ga0160435_1003560 | 3300012857 | Bacteria | 3668 |
| 359 | Ga0160435_1003565 | 3300012857 | Unclassified | 3666 |
| 360 | Ga0316159_10385 | 3300030930 | Bacteria | 6980 |
| 361 | Ga0466657_132826 | 3300042582 | Bacteria | 9786 |
| 362 | Ga0466657_275115 | 3300042582 | Bacteria | 43645 |
| 363 | Ga0466657_363169 | 3300042582 | Bacteria | 3031 |
| 364 | Ga0466692_101693 | 3300042591 | Bacteria | 3856 |
| 365 | Ga0466692_152893 | 3300042591 | Bacteria | 110459 |
| 366 | Ga0466691_065384 | 3300042593 | Bacteria | 40870 |
| 367 | Ga0466694_025318 | 3300042594 | Bacteria | 6720 |
| 368 | Ga0466695_309336 | 3300042595 | Unclassified | 1128 |
| 369 | gam1t_NODE_175054_length=40960_GC=33_1_Contigs=1 | 2189573031 | Bacteria | 40960 |
| 370 | gam1t_NODE_669739_length=8382_GC=35_6_Contigs=7 | 2189573031 | Unclassified | 8442 |
| 371 | SCG598P14_112522 | 3300000479 | Bacteria | 58389 |
| 372 | JGI24696J40584_12959678 | 3300002834 | Bacteria | 5457 |
| 373 | CVPL005L_10000085 | 3300002938 | Bacteria | 67603 |
| 374 | CVPL005L_10006564 | 3300002938 | Bacteria | 11443 |
| 375 | Ga0063521_1000096 | 3300003973 | Bacteria | 70488 |
| 376 | Ga0063521_1000293 | 3300003973 | Bacteria | 30834 |
| 377 | Ga0063521_1002214 | 3300003973 | Unclassified | 4853 |
| 378 | Ga0074278_107214 | 3300005721 | Bacteria | 40960 |
| 379 | Ga0074278_131681 | 3300005721 | Unclassified | 8647 |
| 380 | Ga0103266_1001541 | 3300007067 | Bacteria | 3884 |
| 381 | Ga0102735_1000009 | 3300007080 | Bacteria | 56509 |
| 382 | Ga0102735_1000377 | 3300007080 | Bacteria | 9918 |
| 383 | Ga0104041_1001861 | 3300007106 | Bacteria | 4476 |
| 384 | Ga0104048_1000792 | 3300007143 | Bacteria | 3293 |
| 385 | Ga0104147_1000259 | 3300007224 | Bacteria | 6380 |
| 386 | Ga0123353_10000172 | 3300010167 | Bacteria | 82002 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF17864 | AAA_lid_4 | RuvB AAA lid domain | 233 | 306 | 0.99 |
| PF05496 | RuvB_N | Holliday junction DNA helicase RuvB P-loop domain | 72 | 230 | 0.99 |
| PF05491 | RuvB_C | RuvB C-terminal winged helix domain | 309 | 377 | 0.96 |
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 107 | 227 | 0.95 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 106 | 224 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.