Protein Family IF09034
Metagenome
Isolate
1199
Members
639
Samples
665
Scaffolds
561.45
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_026570|Ga0466702_026570_614_2557
- Length
- 647 aa
- Sequence
- MTNTLRINENMLYESDEAADTVAHELWHAYQHERAENPHSPKDFHYQAGFDNYIRPSDDLLLTREVCIVHSSIICYHIHHNEQGGTSFMQYTGAEIVIKCLKEQGVDTVFGFPGGSILNVYDALYKHSEEIKHILTSHEQGAAHAADGYARATGRVGVCLATSGPGATNLVTGIATAYMDSVPLVAITCNVFLPLLGKDSFQEVDITGVTIPITKHNFIVKDVKKLAPTIRKAFEIAGSGRPGPVLIDITKDVTAALCDYQEVVPTKIELPTTYSQTDLDTAIAMIEEAKKPFIYLGGGAIISEASAEVREFALKIDAPVCDTLRGKGAFDGGSDYYTGMVGMHGTKASNLGISDCDLLIALGARFSDRVVGNVKKFASHAKVLHIDIDPAEINKNVLATASIIGDLKDVLSKLNKALKQQDHAEWVAHIKELKEKYPLNYNHEQLSCPFVIEEICRLTKGEAIITTDVGQHQMWAAQYYKYTQPRTFLTSGGLGTMGYGLGASIGAKTGRPEKICVNIGGDGCFRMNMNELATASRYNIPIIQVIINNHVLGMVRQWQTLFYEKRYSQTVLHDKVDFVTVSQGLGCEAYRVTEKEEFAPGFAKALAHDCPVVIECVIPEDDKVFPMVPAGAPISEVFDEIDYIKNK
Sample Types
Isolate
44.5%
Metagenome
55.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.0%
Apidae
29.5%
Termitidae
6.4%
Blattidae
5.8%
Chrysomelidae
3.7%
Formicidae
2.7%
Drosophilidae
2.6%
Kalotermitidae
2.4%
Elmidae
2.4%
Anthocoridae
2.1%
Culicidae
1.1%
Tenebrionidae
1.0%
Calliphoridae
1.0%
Curculionidae
0.8%
Armadillidiidae
0.8%
Rhinotermitidae
0.8%
Termopsidae
0.6%
Palinuridae
0.5%
Passalidae
0.5%
Talitridae
0.5%
Cerambycidae
0.5%
Tephritidae
0.5%
Pentatomidae
0.3%
Plutellidae
0.3%
Penaeidae
0.3%
Noctuidae
0.3%
Majidae
0.3%
Daphniidae
0.2%
Hodotermitidae
0.2%
Carabidae
0.2%
Rhopalidae
0.2%
Crambidae
0.2%
Blaberidae
0.2%
Euphausiidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Nephropidae
0.2%
Kiwaidae
0.2%
Pediculidae
0.2%
Artemiidae
0.2%
Pteromalidae
0.2%
Taxonomy
Archaea
7
Bacteria
1,136
Eukaryota
0
Viruses
1
Unclassified
55
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 5 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 6 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 7 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 8 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 9 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 10 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 11 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 12 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 13 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 14 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 15 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 16 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 17 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 18 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 19 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 20 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 21 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 22 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 23 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 24 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 25 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 26 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 27 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 28 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 29 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 30 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 31 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 32 | 2999135777 | Enterobacteriaceae endosymbiont of Donacia tomentosa DtomSym | Isolate | Chrysomelidae |
| 33 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 34 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 35 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 36 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 37 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 38 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 39 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 40 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 46 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 47 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 48 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 49 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 50 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 51 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 52 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 53 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 54 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 55 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 56 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 57 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 58 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 59 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 60 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 61 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 62 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 63 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 64 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 65 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 66 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 67 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 68 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 69 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 70 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 71 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 72 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 73 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 74 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 75 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 76 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 77 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 78 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 79 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 80 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 81 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 82 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 83 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 84 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 85 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 86 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 87 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 88 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 89 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 90 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 91 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 92 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 93 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 94 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 95 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 96 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 97 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 98 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 99 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 100 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 101 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 102 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 103 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 104 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 105 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 106 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 107 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 108 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 109 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 110 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 111 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 112 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 113 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 114 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 115 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 116 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 117 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 118 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 119 | 2998830186 | Enterobacteriaceae endosymbiont of Plateumaris pusilla PpusSym | Isolate | Chrysomelidae |
| 120 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 121 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 122 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 123 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 124 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 125 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 126 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 127 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 128 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 129 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 130 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 131 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 132 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 133 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 134 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 135 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 136 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 137 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 138 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 139 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 140 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 141 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 142 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 143 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 144 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 145 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 146 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 147 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 148 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 149 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 150 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 151 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 152 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 153 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 154 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 155 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 156 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 157 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 158 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 159 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 160 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 161 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 162 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 163 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 164 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 165 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 166 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 167 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 168 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 169 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 170 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 171 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 172 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 173 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 174 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 175 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 176 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 177 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 178 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 179 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 180 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 181 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 182 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 183 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 184 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 185 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 186 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 187 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 188 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 189 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 190 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 191 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 192 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 193 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 194 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 195 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 196 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 197 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 198 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 199 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 200 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 201 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 202 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 203 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 204 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 205 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 206 | 2998833461 | Enterobacteriaceae endosymbiont of Donacia marginata DmarSym | Isolate | Chrysomelidae |
| 207 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 208 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 209 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 210 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 211 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 212 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 213 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 214 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 215 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 216 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 217 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 218 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 219 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 220 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 221 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 222 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 223 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 224 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 225 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 226 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 227 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 228 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 229 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 230 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 231 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 232 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 233 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 234 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 235 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 236 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 237 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 238 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 239 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 240 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 241 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 242 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 243 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 244 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 245 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 246 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 247 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 248 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 249 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 250 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 251 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 252 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 253 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 254 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 255 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 256 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 257 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 258 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 259 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 260 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 261 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 262 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 263 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 264 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 265 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 266 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 267 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 268 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 269 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 270 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 271 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 272 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 273 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 274 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 275 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 276 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 277 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 278 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 279 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 280 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 281 | 2998834370 | Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym | Isolate | Chrysomelidae |
| 282 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 283 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 284 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 285 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 286 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 287 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 288 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 289 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 290 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 291 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 292 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 293 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 294 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 295 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 296 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 297 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 298 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 299 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 300 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 301 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 302 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 303 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 304 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 305 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 306 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 307 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 308 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 309 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 310 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 311 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 312 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 313 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 314 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 315 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 316 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 317 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 318 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 319 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 320 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 321 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 322 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 323 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 324 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 325 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 326 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 327 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 328 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 329 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 330 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 331 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 332 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 333 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 334 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 335 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 336 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 337 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 338 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 339 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 340 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 341 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 342 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 343 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 344 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 345 | 2684622742 | Methanobrevibacter curvatus DSM11111 | Isolate | Unclassified |
| 346 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 347 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 348 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 349 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 350 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 351 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 352 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 353 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 354 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 355 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 356 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 357 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 358 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 359 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 360 | 2999135268 | Enterobacteriaceae endosymbiont of Plateumaris sericea PserSym | Isolate | Chrysomelidae |
| 361 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 362 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 363 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 364 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 365 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 366 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 367 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 368 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 369 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 370 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 371 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 372 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 373 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 374 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 375 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 376 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 377 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 378 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 379 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 380 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 381 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 382 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 383 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 384 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 385 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 386 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 387 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 388 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 389 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 390 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 391 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 392 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 393 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 394 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 395 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 396 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 397 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 398 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 399 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 400 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 401 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 402 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 403 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 404 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 405 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 406 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 407 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 408 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 409 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 410 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 411 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 412 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 413 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 414 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 415 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 416 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 417 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 418 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 419 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 420 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 421 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 422 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 423 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 424 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 425 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 426 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 427 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 428 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 429 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 430 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 431 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 432 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 433 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 434 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 435 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 436 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 437 | 2998827396 | Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym | Isolate | Chrysomelidae |
| 438 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 439 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 440 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 441 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 442 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 443 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 444 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 445 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 446 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 447 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 448 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 449 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 450 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 451 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 452 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 453 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 454 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 455 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 456 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 457 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 458 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 459 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 460 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 461 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 462 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 463 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 464 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 465 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 466 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 467 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 468 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 469 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 470 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 471 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 472 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 473 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 474 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 475 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 476 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 477 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 478 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 479 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 480 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 481 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 482 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 483 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 484 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 485 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 486 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 487 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 488 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 489 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 490 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 491 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 492 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 493 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 494 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 495 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 496 | 2684622743 | Methanobrevibacter cuticularis DSM11139 | Isolate | Unclassified |
| 497 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 498 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 499 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 500 | 2820032565 | Unclassified Saccharibacteria Th196P3bin19 | Isolate | Unclassified |
| 501 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 502 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 503 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 504 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 505 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 506 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 507 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 508 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 509 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 510 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 511 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 512 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 513 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 514 | 3300000459 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 | Metagenome | Apidae |
| 515 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 516 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 517 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 518 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 519 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 520 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 521 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 522 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 523 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 524 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 525 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 526 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 527 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 528 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 529 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 530 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 531 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 532 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 533 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 534 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 535 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 536 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 537 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 538 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 539 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 540 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 541 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 542 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 543 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 544 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 545 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 546 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 547 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 548 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 549 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 550 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 551 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 552 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 553 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 554 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 555 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 556 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 557 | 2958255616 | Serratia marcescens TM | Isolate | |
| 558 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 559 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 560 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 561 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 562 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 563 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 564 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 565 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 566 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 567 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 568 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 569 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 570 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 571 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 572 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 573 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 574 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 575 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 576 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 577 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 578 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 579 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 580 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 581 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 582 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 583 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 584 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 585 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 586 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 587 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 588 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 589 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 590 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 591 | 2820403592 | Unclassified Firmicutes Lab288P4bin93 | Isolate | Unclassified |
| 592 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 593 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 594 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 595 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 596 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 597 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 598 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 599 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 600 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 601 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 602 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 603 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 604 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 605 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 606 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 607 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 608 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 609 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 610 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 611 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 612 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 613 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 614 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 615 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 616 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 617 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 618 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 619 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 620 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 621 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 622 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 623 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 624 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 625 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 626 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 627 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 628 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 629 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 630 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 631 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 632 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 633 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 634 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 635 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 636 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 637 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 638 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 639 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_270069 | 3300042611 | Bacteria | 3697 |
| 2 | Ga0466705_012126 | 3300042612 | Bacteria | 7557 |
| 3 | Ga0466705_168022 | 3300042612 | Bacteria | 5291 |
| 4 | Ga0466733_190032 | 3300042659 | Bacteria | 3059 |
| 5 | Ga0530661_001098 | 3300056564 | Bacteria | 15338 |
| 6 | Ga0466705_397101 | 3300042612 | Bacteria | 24789 |
| 7 | Ga0466712_022012 | 3300042614 | Bacteria | 3979 |
| 8 | Ga0466712_065522 | 3300042614 | Bacteria | 16335 |
| 9 | Ga0466711_192684 | 3300042615 | Bacteria | 6047 |
| 10 | Ga0466711_284872 | 3300042615 | Bacteria | 3033 |
| 11 | Ga0466715_040060 | 3300042616 | Bacteria | 4387 |
| 12 | Ga0466723_093365 | 3300042618 | Bacteria | 4770 |
| 13 | Ga0466726_034469 | 3300042619 | Bacteria | 4772 |
| 14 | Ga0466729_070951 | 3300042621 | Bacteria | 9633 |
| 15 | Ga0160469_100012 | 3300012824 | Bacteria | 446228 |
| 16 | Ga0160433_100703 | 3300012846 | Bacteria | 12804 |
| 17 | Ga0264413_138207 | 3300024493 | Bacteria | 11225 |
| 18 | Ga0247290_00072 | 3300035364 | Unclassified | 34469 |
| 19 | Ga0466657_269802 | 3300042582 | Bacteria | 5044 |
| 20 | Ga0466690_062633 | 3300042590 | Bacteria | 13417 |
| 21 | Ga0466690_291738 | 3300042590 | Bacteria | 3079 |
| 22 | Ga0466690_339203 | 3300042590 | Bacteria | 2542 |
| 23 | Ga0466690_345283 | 3300042590 | Bacteria | 15147 |
| 24 | Ga0466693_130558 | 3300042592 | Bacteria | 2886 |
| 25 | Ga0466691_061768 | 3300042593 | Bacteria | 11547 |
| 26 | Ga0466691_147933 | 3300042593 | Bacteria | 31792 |
| 27 | Ga0466694_088741 | 3300042594 | Bacteria | 10468 |
| 28 | Ga0466696_161726 | 3300042596 | Bacteria | 1979 |
| 29 | Ga0466696_289622 | 3300042596 | Bacteria | 7847 |
| 30 | FGTW_contig33196 | 2065487013 | Unclassified | 1797 |
| 31 | gam1t_NODE_477884_length=11913_GC=40_8_Contigs=5 | 2189573031 | Bacteria | 11953 |
| 32 | AustNasuHG_c1000535 | 3300000089 | Bacteria | 13342 |
| 33 | AustNasuHG_c1001401 | 3300000089 | Bacteria | 8638 |
| 34 | SCG598O11_12225 | 3300000471 | Bacteria | 128113 |
| 35 | JGI24698J34947_10005823 | 3300002449 | Bacteria | 6758 |
| 36 | JGI24698J34947_10031730 | 3300002449 | Bacteria | 2779 |
| 37 | JGI24695J34938_10007735 | 3300002450 | Bacteria | 6230 |
| 38 | JGI24695J34938_10021630 | 3300002450 | Unclassified | 3142 |
| 39 | JGI24702J35022_10000006 | 3300002462 | Bacteria | 88368 |
| 40 | Ga0063521_1001952 | 3300003973 | Bacteria | 5242 |
| 41 | Ga0072940_1145919 | 3300005200 | Bacteria | 2486 |
| 42 | Ga0103263_100054 | 3300007042 | Bacteria | 31632 |
| 43 | Ga0103260_1000038 | 3300007139 | Bacteria | 42722 |
| 44 | Ga0102738_1000049 | 3300007141 | Bacteria | 51177 |
| 45 | Ga0123357_10000031 | 3300009784 | Bacteria | 116101 |
| 46 | Ga0466706_073586 | 3300042599 | Bacteria | 52445 |
| 47 | Ga0466706_115059 | 3300042599 | Bacteria | 12640 |
| 48 | Ga0466706_186078 | 3300042599 | Bacteria | 13472 |
| 49 | Ga0466706_229406 | 3300042599 | Bacteria | 2961 |
| 50 | Ga0466707_015731 | 3300042601 | Bacteria | 5103 |
| 51 | Ga0466707_315773 | 3300042601 | Bacteria | 18568 |
| 52 | Ga0466713_057398 | 3300042602 | Bacteria | 69724 |
| 53 | Ga0466713_065760 | 3300042602 | Bacteria | 26828 |
| 54 | Ga0466713_067944 | 3300042602 | Bacteria | 8297 |
| 55 | Ga0466713_136311 | 3300042602 | Bacteria | 5360 |
| 56 | Ga0466717_159921 | 3300042604 | Bacteria | 32517 |
| 57 | Ga0466719_222571 | 3300042606 | Bacteria | 23489 |
| 58 | Ga0466719_570494 | 3300042606 | Bacteria | 19560 |
| 59 | Ga0466721_120073 | 3300042608 | Bacteria | 87856 |
| 60 | Ga0466722_261497 | 3300042609 | Bacteria | 3825 |
| 61 | Ga0466729_306195 | 3300042621 | Bacteria | 2231 |
| 62 | Ga0466730_033303 | 3300042625 | Unclassified | 29084 |
| 63 | Ga0466730_068278 | 3300042625 | Unclassified | 5026 |
| 64 | Ga0466703_085867 | 3300042636 | Bacteria | 27085 |
| 65 | Ga0466703_423002 | 3300042636 | Bacteria | 3161 |
| 66 | Ga0466704_161729 | 3300042643 | Bacteria | 19165 |
| 67 | Ga0466704_278665 | 3300042643 | Unclassified | 4130 |
| 68 | Ga0466704_408214 | 3300042643 | Bacteria | 16666 |
| 69 | Ga0466709_301116 | 3300042648 | Bacteria | 5113 |
| 70 | Ga0466724_21553 | 3300042649 | Bacteria | 31785 |
| 71 | Ga0466724_23460 | 3300042649 | Bacteria | 8172 |
| 72 | Ga0466724_48887 | 3300042649 | Bacteria | 71042 |
| 73 | Ga0466708_042290 | 3300042652 | Bacteria | 5438 |
| 74 | Ga0466708_105992 | 3300042652 | Bacteria | 7487 |
| 75 | Ga0466708_116322 | 3300042652 | Bacteria | 7549 |
| 76 | Ga0466708_407221 | 3300042652 | Bacteria | 24446 |
| 77 | Ga0466727_056463 | 3300042655 | Bacteria | 29607 |
| 78 | Ga0123355_10001124 | 3300009826 | Bacteria | 37032 |
| 79 | Ga0123355_10001246 | 3300009826 | Bacteria | 35499 |
| 80 | Ga0123355_10010567 | 3300009826 | Bacteria | 14169 |
| 81 | Ga0123355_10084822 | 3300009826 | Unclassified | 5043 |
| 82 | Ga0123355_10292849 | 3300009826 | Bacteria | 2231 |
| 83 | Ga0123356_10000057 | 3300010049 | Bacteria | 118961 |
| 84 | Ga0123356_10007484 | 3300010049 | Bacteria | 10893 |
| 85 | Ga0123356_10058471 | 3300010049 | Bacteria | 3595 |
| 86 | Ga0123356_10112405 | 3300010049 | Bacteria | 2634 |
| 87 | Ga0123353_10002487 | 3300010167 | Bacteria | 22942 |
| 88 | Ga0123353_10004902 | 3300010167 | Bacteria | 17414 |
| 89 | Ga0123353_10036774 | 3300010167 | Bacteria | 7672 |
| 90 | Ga0123353_10185545 | 3300010167 | Bacteria | 3289 |
| 91 | Ga0123353_10215701 | 3300010167 | Bacteria | 3006 |
| 92 | Ga0123353_10287573 | 3300010167 | Bacteria | 2519 |
| 93 | Ga0466705_255873 | 3300042612 | Bacteria | 7464 |
| 94 | Ga0466705_314620 | 3300042612 | Bacteria | 5409 |
| 95 | Ga0466705_502774 | 3300042612 | Bacteria | 3270 |
| 96 | Ga0466712_121309 | 3300042614 | Bacteria | 3553 |
| 97 | Ga0466712_149819 | 3300042614 | Bacteria | 10786 |
| 98 | Ga0466712_313455 | 3300042614 | Bacteria | 3228 |
| 99 | Ga0466711_032203 | 3300042615 | Bacteria | 19663 |
| 100 | Ga0466715_016648 | 3300042616 | Bacteria | 53064 |
| 101 | Ga0466715_065732 | 3300042616 | Unclassified | 24420 |
| 102 | Ga0466715_101742 | 3300042616 | Bacteria | 40354 |
| 103 | Ga0466715_323607 | 3300042616 | Bacteria | 11682 |
| 104 | Ga0466718_003209 | 3300042617 | Bacteria | 10047 |
| 105 | Ga0466718_090188 | 3300042617 | Bacteria | 5603 |
| 106 | Ga0466723_336440 | 3300042618 | Bacteria | 8455 |
| 107 | Ga0466726_233537 | 3300042619 | Bacteria | 6174 |
| 108 | Ga0160467_100532 | 3300012829 | Unclassified | 35499 |
| 109 | Ga0264413_113192 | 3300024493 | Bacteria | 5807 |
| 110 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 111 | Ga0415639_020064 | 3300038395 | Bacteria | 13689 |
| 112 | Ga0456237_0004338 | 3300041968 | Bacteria | 2284 |
| 113 | Ga0466690_011221 | 3300042590 | Bacteria | 11667 |
| 114 | Ga0466690_222074 | 3300042590 | Unclassified | 2883 |
| 115 | Ga0466692_029194 | 3300042591 | Bacteria | 54799 |
| 116 | Ga0466692_174039 | 3300042591 | Bacteria | 10129 |
| 117 | Ga0466693_257741 | 3300042592 | Bacteria | 2215 |
| 118 | Ga0466691_080632 | 3300042593 | Bacteria | 11894 |
| 119 | Ga0466696_446560 | 3300042596 | Bacteria | 3891 |
| 120 | IMNBGM34_c000668 | 3300000036 | Bacteria | 8337 |
| 121 | IMNBL1DRAFT_c0000028 | 3300000062 | Bacteria | 135353 |
| 122 | IMNBL1DRAFT_c0002537 | 3300000062 | Bacteria | 12616 |
| 123 | SCG598C04_13200 | 3300000459 | Bacteria | 84043 |
| 124 | JGI24698J34947_10006537 | 3300002449 | Bacteria | 6398 |
| 125 | JGI24698J34947_10007475 | 3300002449 | Bacteria | 6005 |
| 126 | JGI24698J34947_10011051 | 3300002449 | Unclassified | 4953 |
| 127 | JGI24698J34947_10013441 | 3300002449 | Unclassified | 4471 |
| 128 | JGI24705J35276_12231701 | 3300002504 | Bacteria | 4033 |
| 129 | JGI24696J40584_12956018 | 3300002834 | Bacteria | 2990 |
| 130 | CVPL005W_1000769 | 3300002934 | Unclassified | 11058 |
| 131 | Ga0068302_10022793 | 3300005071 | Unclassified | 3354 |
| 132 | Ga0072941_1003386 | 3300005201 | Bacteria | 11543 |
| 133 | Ga0074302_1033027 | 3300005316 | Bacteria | 4224 |
| 134 | Ga0074278_148838 | 3300005721 | Bacteria | 11953 |
| 135 | Ga0103266_1000917 | 3300007067 | Bacteria | 5319 |
| 136 | Ga0105524_100747 | 3300007733 | Bacteria | 9990 |
| 137 | Ga0105524_100843 | 3300007733 | Bacteria | 13808 |
| 138 | Ga0466707_388739 | 3300042601 | Unclassified | 2818 |
| 139 | Ga0466714_008624 | 3300042603 | Bacteria | 11730 |
| 140 | Ga0466716_193096 | 3300042605 | Bacteria | 1884 |
| 141 | Ga0466719_231800 | 3300042606 | Bacteria | 56539 |
| 142 | Ga0466721_146479 | 3300042608 | Bacteria | 28178 |
| 143 | Ga0466722_024979 | 3300042609 | Bacteria | 5202 |
| 144 | Ga0466722_030208 | 3300042609 | Unclassified | 18056 |
| 145 | Ga0466722_144439 | 3300042609 | Bacteria | 11012 |
| 146 | Ga0466735_226569 | 3300042624 | Archaea | 16361 |
| 147 | Ga0466730_003771 | 3300042625 | Bacteria | 18302 |
| 148 | Ga0466730_009578 | 3300042625 | Bacteria | 63640 |
| 149 | Ga0466730_027264 | 3300042625 | Bacteria | 5368 |
| 150 | Ga0466730_097032 | 3300042625 | Bacteria | 6377 |
| 151 | Ga0466702_026570 | 3300042635 | Bacteria | 2685 |
| 152 | Ga0466702_090049 | 3300042635 | Bacteria | 6688 |
| 153 | Ga0466703_131850 | 3300042636 | Bacteria | 12631 |
| 154 | Ga0466703_397603 | 3300042636 | Bacteria | 8031 |
| 155 | Ga0466704_195638 | 3300042643 | Bacteria | 16191 |
| 156 | Ga0466709_044265 | 3300042648 | Bacteria | 27868 |
| 157 | Ga0466724_64623 | 3300042649 | Bacteria | 1837 |
| 158 | Ga0466708_284488 | 3300042652 | Bacteria | 2576 |
| 159 | Ga0466708_306754 | 3300042652 | Bacteria | 12221 |
| 160 | Ga0466708_374515 | 3300042652 | Bacteria | 2977 |
| 161 | Ga0123357_10120848 | 3300009784 | Bacteria | 3300 |
| 162 | Ga0123355_10002373 | 3300009826 | Bacteria | 26626 |
| 163 | Ga0123355_10061265 | 3300009826 | Bacteria | 6076 |
| 164 | Ga0123356_10015492 | 3300010049 | Bacteria | 7306 |
| 165 | Ga0123356_10025478 | 3300010049 | Bacteria | 5559 |
| 166 | Ga0123353_10023152 | 3300010167 | Bacteria | 9396 |
| 167 | Ga0123353_10102102 | 3300010167 | Bacteria | 4623 |
| 168 | Ga0123353_10283182 | 3300010167 | Bacteria | 2544 |
| 169 | Ga0160465_101758 | 3300012803 | Bacteria | 5691 |
| 170 | Ga0160466_100377 | 3300012809 | Bacteria | 25553 |
| 171 | Ga0466705_085756 | 3300042612 | Bacteria | 2484 |
| 172 | Ga0466705_181782 | 3300042612 | Bacteria | 6309 |
| 173 | Ga0466733_023073 | 3300042659 | Bacteria | 12017 |
| 174 | Ga0466733_118280 | 3300042659 | Bacteria | 5635 |
| 175 | Ga0466705_474207 | 3300042612 | Bacteria | 4829 |
| 176 | Ga0466712_083494 | 3300042614 | Bacteria | 7302 |
| 177 | Ga0466712_142141 | 3300042614 | Bacteria | 3582 |
| 178 | Ga0466711_017310 | 3300042615 | Bacteria | 22709 |
| 179 | Ga0466723_133710 | 3300042618 | Bacteria | 5228 |
| 180 | Ga0466723_301337 | 3300042618 | Bacteria | 2688 |
| 181 | Ga0466726_286493 | 3300042619 | Bacteria | 10263 |
| 182 | Ga0160452_100124 | 3300012834 | Bacteria | 95396 |
| 183 | Ga0160447_101724 | 3300012849 | Bacteria | 8251 |
| 184 | Ga0415639_001908 | 3300038395 | Bacteria | 37051 |
| 185 | Ga0415639_057658 | 3300038395 | Bacteria | 5933 |
| 186 | Ga0415639_108053 | 3300038395 | Bacteria | 2139 |
| 187 | Ga0456237_0001700 | 3300041968 | Bacteria | 3528 |
| 188 | Ga0466691_074392 | 3300042593 | Bacteria | 6356 |
| 189 | 2227358568 | 2225789004 | Bacteria | 28273 |
| 190 | IMNBL1DRAFT_c0011288 | 3300000062 | Unclassified | 4187 |
| 191 | IMNBL1DRAFT_c0021222 | 3300000062 | Bacteria | 2605 |
| 192 | SCG598I20_11296 | 3300000473 | Unclassified | 7502 |
| 193 | SCG598L16_135184 | 3300000490 | Unclassified | 3525 |
| 194 | JGI24698J34947_10024256 | 3300002449 | Bacteria | 3240 |
| 195 | JGI24695J34938_10048503 | 3300002450 | Bacteria | 1870 |
| 196 | JGI24705J35276_12235548 | 3300002504 | Bacteria | 6661 |
| 197 | CVPL010W_10000358 | 3300002931 | Bacteria | 69524 |
| 198 | Ga0068302_10009657 | 3300005071 | Bacteria | 15376 |
| 199 | Ga0068305_10008099 | 3300005083 | Bacteria | 232741 |
| 200 | Ga0072940_1015742 | 3300005200 | Bacteria | 9587 |
| 201 | Ga0103265_1000023 | 3300007068 | Bacteria | 32322 |
| 202 | Ga0102739_1000516 | 3300007095 | Unclassified | 7698 |
| 203 | Ga0102737_1000019 | 3300007142 | Bacteria | 94188 |
| 204 | Ga0105524_105811 | 3300007733 | Unclassified | 3902 |
| 205 | Ga0466706_044356 | 3300042599 | Bacteria | 9833 |
| 206 | Ga0466706_109732 | 3300042599 | Bacteria | 15971 |
| 207 | Ga0466700_272703 | 3300042600 | Bacteria | 8616 |
| 208 | Ga0466707_165411 | 3300042601 | Bacteria | 10096 |
| 209 | Ga0466707_312066 | 3300042601 | Bacteria | 13362 |
| 210 | Ga0466707_326632 | 3300042601 | Bacteria | 20421 |
| 211 | Ga0466707_411028 | 3300042601 | Bacteria | 21137 |
| 212 | Ga0466713_005191 | 3300042602 | Bacteria | 74507 |
| 213 | Ga0466713_049663 | 3300042602 | Unclassified | 9482 |
| 214 | Ga0466714_032106 | 3300042603 | Bacteria | 34187 |
| 215 | Ga0466716_316496 | 3300042605 | Bacteria | 4125 |
| 216 | Ga0466719_009841 | 3300042606 | Bacteria | 3404 |
| 217 | Ga0466719_199155 | 3300042606 | Bacteria | 3587 |
| 218 | Ga0466719_238654 | 3300042606 | Unclassified | 33780 |
| 219 | Ga0466719_303954 | 3300042606 | Bacteria | 16248 |
| 220 | Ga0466719_350825 | 3300042606 | Bacteria | 5277 |
| 221 | Ga0466720_070922 | 3300042607 | Bacteria | 12927 |
| 222 | Ga0466722_149032 | 3300042609 | Bacteria | 8948 |
| 223 | Ga0466735_106976 | 3300042624 | Bacteria | 5846 |
| 224 | Ga0466730_057327 | 3300042625 | Bacteria | 3147 |
| 225 | Ga0466730_059748 | 3300042625 | Unclassified | 5964 |
| 226 | Ga0466703_393525 | 3300042636 | Bacteria | 72819 |
| 227 | Ga0466704_120879 | 3300042643 | Bacteria | 3336 |
| 228 | Ga0466704_251309 | 3300042643 | Bacteria | 9605 |
| 229 | Ga0466724_38282 | 3300042649 | Bacteria | 53742 |
| 230 | Ga0466708_049403 | 3300042652 | Bacteria | 6724 |
| 231 | Ga0466708_199463 | 3300042652 | Bacteria | 45588 |
| 232 | Ga0466708_252856 | 3300042652 | Bacteria | 26099 |
| 233 | Ga0466708_445985 | 3300042652 | Bacteria | 17770 |
| 234 | Ga0123355_10004396 | 3300009826 | Bacteria | 20493 |
| 235 | Ga0123355_10021707 | 3300009826 | Bacteria | 10281 |
| 236 | Ga0123355_10264705 | 3300009826 | Bacteria | 2399 |
| 237 | Ga0123356_10000009 | 3300010049 | Bacteria | 226788 |
| 238 | Ga0123356_10027661 | 3300010049 | Bacteria | 5312 |
| 239 | Ga0123356_10028668 | 3300010049 | Bacteria | 5216 |
| 240 | Ga0123356_10078204 | 3300010049 | Bacteria | 3122 |
| 241 | Ga0123353_10000686 | 3300010167 | Bacteria | 41372 |
| 242 | Ga0123353_10210735 | 3300010167 | Bacteria | 3048 |
| 243 | Ga0123353_10217330 | 3300010167 | Bacteria | 2993 |
| 244 | Ga0123353_10323323 | 3300010167 | Bacteria | 2340 |
| 245 | Ga0123354_10006907 | 3300010882 | Bacteria | 16951 |
| 246 | Ga0123354_10017624 | 3300010882 | Bacteria | 11189 |
| 247 | Ga0123354_10060624 | 3300010882 | Bacteria | 5594 |
| 248 | Ga0466705_198493 | 3300042612 | Bacteria | 8546 |
| 249 | Ga0466733_126831 | 3300042659 | Bacteria | 26107 |
| 250 | Ga0466733_149052 | 3300042659 | Bacteria | 16557 |
| 251 | Ga0466705_422422 | 3300042612 | Bacteria | 4301 |
| 252 | Ga0466712_286800 | 3300042614 | Bacteria | 1778 |
| 253 | Ga0466711_187397 | 3300042615 | Bacteria | 23281 |
| 254 | Ga0466711_297904 | 3300042615 | Bacteria | 2014 |
| 255 | Ga0466715_065948 | 3300042616 | Archaea | 9039 |
| 256 | Ga0466715_634618 | 3300042616 | Bacteria | 11511 |
| 257 | Ga0466718_050424 | 3300042617 | Bacteria | 2301 |
| 258 | Ga0466723_359846 | 3300042618 | Bacteria | 6199 |
| 259 | Ga0466726_178879 | 3300042619 | Bacteria | 7110 |
| 260 | Ga0466728_074536 | 3300042620 | Bacteria | 9199 |
| 261 | Ga0466729_078084 | 3300042621 | Bacteria | 31159 |
| 262 | Ga0157631_101096 | 3300013007 | Bacteria | 8957 |
| 263 | Ga0247289_0154 | 3300035363 | Bacteria | 17547 |
| 264 | Ga0415639_001036 | 3300038395 | Bacteria | 8164 |
| 265 | Ga0415639_090603 | 3300038395 | Bacteria | 8514 |
| 266 | Ga0466690_171294 | 3300042590 | Bacteria | 3335 |
| 267 | Ga0466691_103852 | 3300042593 | Bacteria | 17581 |
| 268 | Ga0466691_137562 | 3300042593 | Bacteria | 5594 |
| 269 | 2227080775 | 2225789004 | Bacteria | 185106 |
| 270 | IMNBL1DRAFT_c0020203 | 3300000062 | Bacteria | 2704 |
| 271 | AustNasuHG_c1014417 | 3300000089 | Bacteria | 2689 |
| 272 | HBC_ctgsDRAFT_1001027 | 3300000333 | Bacteria | 6076 |
| 273 | SCG598O02_12513 | 3300000460 | Bacteria | 160606 |
| 274 | SCG598P17_12873 | 3300000461 | Bacteria | 45991 |
| 275 | SCG598I22_12459 | 3300000462 | Unclassified | 30128 |
| 276 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 277 | JGI24698J34947_10012057 | 3300002449 | Bacteria | 4744 |
| 278 | JGI24698J34947_10040295 | 3300002449 | Bacteria | 2413 |
| 279 | JGI24695J34938_10023815 | 3300002450 | Bacteria | 2947 |
| 280 | JGI24695J34938_10042329 | 3300002450 | Bacteria | 2039 |
| 281 | JGI24702J35022_10056149 | 3300002462 | Bacteria | 2101 |
| 282 | JGI24700J35501_10930883 | 3300002508 | Bacteria | 33786 |
| 283 | Ga0068302_10020875 | 3300005071 | Bacteria | 4801 |
| 284 | Ga0068305_10049459 | 3300005083 | Unclassified | 2770 |
| 285 | Ga0074188_1000348 | 3300005318 | Bacteria | 14634 |
| 286 | Ga0074278_152073 | 3300005721 | Unclassified | 9300 |
| 287 | Ga0102740_1000028 | 3300007140 | Bacteria | 33359 |
| 288 | Ga0104019_1189712 | 3300007150 | Bacteria | 5970 |
| 289 | Ga0466706_055508 | 3300042599 | Bacteria | 3413 |
| 290 | Ga0466706_116693 | 3300042599 | Bacteria | 75484 |
| 291 | Ga0466706_125192 | 3300042599 | Bacteria | 14180 |
| 292 | Ga0466706_250114 | 3300042599 | Bacteria | 3582 |
| 293 | Ga0466706_266231 | 3300042599 | Bacteria | 12761 |
| 294 | Ga0466707_043962 | 3300042601 | Bacteria | 14876 |
| 295 | Ga0466707_062955 | 3300042601 | Bacteria | 2547 |
| 296 | Ga0466707_096100 | 3300042601 | Bacteria | 163276 |
| 297 | Ga0466707_367017 | 3300042601 | Bacteria | 14742 |
| 298 | Ga0466713_026458 | 3300042602 | Bacteria | 39956 |
| 299 | Ga0466713_059310 | 3300042602 | Unclassified | 93154 |
| 300 | Ga0466713_091700 | 3300042602 | Bacteria | 8249 |
| 301 | Ga0466714_072433 | 3300042603 | Bacteria | 3935 |
| 302 | Ga0466716_028955 | 3300042605 | Bacteria | 2561 |
| 303 | Ga0466716_315680 | 3300042605 | Bacteria | 9600 |
| 304 | Ga0466716_484314 | 3300042605 | Bacteria | 4520 |
| 305 | Ga0466719_051467 | 3300042606 | Bacteria | 24618 |
| 306 | Ga0466720_094435 | 3300042607 | Bacteria | 70325 |
| 307 | Ga0466722_042792 | 3300042609 | Bacteria | 8014 |
| 308 | Ga0466722_266970 | 3300042609 | Bacteria | 4941 |
| 309 | Ga0466698_069884 | 3300042610 | Bacteria | 10764 |
| 310 | Ga0466729_246891 | 3300042621 | Bacteria | 5195 |
| 311 | Ga0466704_144061 | 3300042643 | Bacteria | 4285 |
| 312 | Ga0466704_287958 | 3300042643 | Bacteria | 40699 |
| 313 | Ga0466704_356072 | 3300042643 | Bacteria | 3352 |
| 314 | Ga0466724_60992 | 3300042649 | Bacteria | 15429 |
| 315 | Ga0466727_034734 | 3300042655 | Bacteria | 2768 |
| 316 | Ga0466727_136832 | 3300042655 | Bacteria | 7205 |
| 317 | Ga0123357_10084944 | 3300009784 | Bacteria | 4146 |
| 318 | Ga0123357_10098909 | 3300009784 | Bacteria | 3769 |
| 319 | Ga0123355_10000334 | 3300009826 | Bacteria | 61015 |
| 320 | Ga0123355_10005113 | 3300009826 | Bacteria | 19132 |
| 321 | Ga0123356_10003185 | 3300010049 | Bacteria | 17241 |
| 322 | Ga0123356_10010078 | 3300010049 | Archaea | 9294 |
| 323 | Ga0123356_10014172 | 3300010049 | Bacteria | 7668 |
| 324 | Ga0123356_10015197 | 3300010049 | Bacteria | 7380 |
| 325 | Ga0123353_10006209 | 3300010167 | Bacteria | 15876 |
| 326 | Ga0123353_10006506 | 3300010167 | Bacteria | 15564 |
| 327 | Ga0123353_10024966 | 3300010167 | Bacteria | 9092 |
| 328 | Ga0123353_10061297 | 3300010167 | Bacteria | 6033 |
| 329 | Ga0123353_10088389 | 3300010167 | Bacteria | 4990 |
| 330 | Ga0123353_10116115 | 3300010167 | Bacteria | 4307 |
| 331 | Ga0123353_10247035 | 3300010167 | Bacteria | 2767 |
| 332 | Ga0123353_10330034 | 3300010167 | Bacteria | 2310 |
| 333 | Ga0123354_10111577 | 3300010882 | Bacteria | 3606 |
| 334 | Ga0160464_100041 | 3300012805 | Bacteria | 162660 |
| 335 | Ga0466705_003036 | 3300042612 | Bacteria | 5920 |
| 336 | Ga0466705_102190 | 3300042612 | Bacteria | 15306 |
| 337 | Ga0466705_149799 | 3300042612 | Bacteria | 2023 |
| 338 | Ga0466705_165679 | 3300042612 | Bacteria | 33826 |
| 339 | Ga0466733_076193 | 3300042659 | Bacteria | 4567 |
| 340 | Ga0466733_193354 | 3300042659 | Bacteria | 4958 |
| 341 | Ga0466711_264784 | 3300042615 | Bacteria | 3424 |
| 342 | Ga0466715_022697 | 3300042616 | Bacteria | 4708 |
| 343 | Ga0466715_038155 | 3300042616 | Bacteria | 27739 |
| 344 | Ga0466715_520933 | 3300042616 | Bacteria | 7099 |
| 345 | Ga0466718_050371 | 3300042617 | Bacteria | 63846 |
| 346 | Ga0466723_052725 | 3300042618 | Bacteria | 10694 |
| 347 | Ga0466723_103917 | 3300042618 | Bacteria | 8308 |
| 348 | Ga0466723_119650 | 3300042618 | Bacteria | 7362 |
| 349 | Ga0466723_129009 | 3300042618 | Bacteria | 12957 |
| 350 | Ga0466723_296094 | 3300042618 | Bacteria | 3981 |
| 351 | Ga0466726_015342 | 3300042619 | Bacteria | 55672 |
| 352 | Ga0466726_017894 | 3300042619 | Bacteria | 11731 |
| 353 | Ga0466726_401105 | 3300042619 | Bacteria | 7181 |
| 354 | Ga0466729_037176 | 3300042621 | Bacteria | 3819 |
| 355 | Ga0264413_120404 | 3300024493 | Bacteria | 11956 |
| 356 | Ga0265387_1000005 | 3300024582 | Bacteria | 95017 |
| 357 | Ga0247290_00188 | 3300035364 | Bacteria | 18727 |
| 358 | Ga0466690_044435 | 3300042590 | Bacteria | 62131 |
| 359 | Ga0466690_271697 | 3300042590 | Bacteria | 12867 |
| 360 | Ga0466692_127369 | 3300042591 | Bacteria | 13782 |
| 361 | Ga0466692_188566 | 3300042591 | Bacteria | 7746 |
| 362 | Ga0466691_223404 | 3300042593 | Bacteria | 3734 |
| 363 | Ga0466696_230338 | 3300042596 | Bacteria | 7098 |
| 364 | 2227422488 | 2225789004 | Bacteria | 5610 |
| 365 | 2227480183 | 2225789004 | Bacteria | 78859 |
| 366 | IMNBL1DRAFT_c0008421 | 3300000062 | Bacteria | 5250 |
| 367 | JGI24695J34938_10004584 | 3300002450 | Bacteria | 9000 |
| 368 | Ga0068302_10054746 | 3300005071 | Bacteria | 11068 |
| 369 | Ga0072941_1103616 | 3300005201 | Bacteria | 3934 |
| 370 | Ga0074278_149906 | 3300005721 | Bacteria | 81751 |
| 371 | Ga0103261_1000040 | 3300007083 | Bacteria | 72548 |
| 372 | Ga0105553_1033781 | 3300007767 | Bacteria | 27509 |
| 373 | Ga0466701_100723 | 3300042598 | Bacteria | 11147 |
| 374 | Ga0466706_098480 | 3300042599 | Bacteria | 7529 |
| 375 | Ga0466706_259452 | 3300042599 | Bacteria | 4495 |
| 376 | Ga0466700_224312 | 3300042600 | Bacteria | 2873 |
| 377 | Ga0466707_067331 | 3300042601 | Bacteria | 7432 |
| 378 | Ga0466707_104847 | 3300042601 | Bacteria | 3728 |
| 379 | Ga0466707_134610 | 3300042601 | Bacteria | 6416 |
| 380 | Ga0466707_209132 | 3300042601 | Bacteria | 3545 |
| 381 | Ga0466713_104478 | 3300042602 | Bacteria | 40990 |
| 382 | Ga0466713_141568 | 3300042602 | Bacteria | 26077 |
| 383 | Ga0466714_034881 | 3300042603 | Bacteria | 4679 |
| 384 | Ga0466716_446467 | 3300042605 | Bacteria | 2966 |
| 385 | Ga0466719_384052 | 3300042606 | Bacteria | 21348 |
| 386 | Ga0466720_067758 | 3300042607 | Bacteria | 23423 |
| 387 | Ga0466722_024956 | 3300042609 | Bacteria | 18152 |
| 388 | Ga0466722_133110 | 3300042609 | Bacteria | 22544 |
| 389 | Ga0466698_489656 | 3300042610 | Bacteria | 8526 |
| 390 | Ga0466731_408671 | 3300042622 | Bacteria | 7301 |
| 391 | Ga0466730_018380 | 3300042625 | Unclassified | 10024 |
| 392 | Ga0466702_061050 | 3300042635 | Bacteria | 1914 |
| 393 | Ga0466703_015864 | 3300042636 | Bacteria | 23526 |
| 394 | Ga0466703_071712 | 3300042636 | Bacteria | 32890 |
| 395 | Ga0466703_104761 | 3300042636 | Bacteria | 6826 |
| 396 | Ga0466704_106898 | 3300042643 | Bacteria | 7908 |
| 397 | Ga0466709_143484 | 3300042648 | Bacteria | 162355 |
| 398 | Ga0466709_264934 | 3300042648 | Bacteria | 2070 |
| 399 | Ga0466724_26100 | 3300042649 | Unclassified | 3496 |
| 400 | Ga0466708_393856 | 3300042652 | Bacteria | 96483 |
| 401 | Ga0466727_121583 | 3300042655 | Archaea | 16587 |
| 402 | Ga0466727_244095 | 3300042655 | Bacteria | 19071 |
| 403 | Ga0466727_324069 | 3300042655 | Bacteria | 2817 |
| 404 | Ga0466727_332725 | 3300042655 | Bacteria | 2022 |
| 405 | Ga0123355_10002216 | 3300009826 | Bacteria | 27441 |
| 406 | Ga0123355_10015304 | 3300009826 | Bacteria | 12045 |
| 407 | Ga0123355_10017547 | 3300009826 | Bacteria | 11317 |
| 408 | Ga0123356_10055094 | 3300010049 | Bacteria | 3703 |
| 409 | Ga0123356_10098046 | 3300010049 | Bacteria | 2805 |
| 410 | Ga0123353_10000257 | 3300010167 | Bacteria | 67087 |
| 411 | Ga0123353_10003668 | 3300010167 | Bacteria | 19484 |
| 412 | Ga0123353_10020143 | 3300010167 | Bacteria | 9949 |
| 413 | Ga0123353_10023028 | 3300010167 | Bacteria | 9417 |
| 414 | Ga0123353_10030887 | 3300010167 | Bacteria | 8287 |
| 415 | Ga0123353_10239585 | 3300010167 | Bacteria | 2819 |
| 416 | Ga0123353_10312242 | 3300010167 | Bacteria | 2391 |
| 417 | Ga0123353_10353935 | 3300010167 | Bacteria | 2211 |
| 418 | Ga0123354_10261631 | 3300010882 | Bacteria | 1726 |
| 419 | Ga0466705_260599 | 3300042612 | Bacteria | 16449 |
| 420 | Ga0466733_182340 | 3300042659 | Bacteria | 2944 |
| 421 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 422 | Ga0466711_483122 | 3300042615 | Bacteria | 9836 |
| 423 | Ga0466715_016274 | 3300042616 | Bacteria | 8909 |
| 424 | Ga0466715_060537 | 3300042616 | Bacteria | 20392 |
| 425 | Ga0466715_122821 | 3300042616 | Bacteria | 43920 |
| 426 | Ga0466715_279158 | 3300042616 | Bacteria | 3524 |
| 427 | Ga0466718_074760 | 3300042617 | Bacteria | 5646 |
| 428 | Ga0466718_108547 | 3300042617 | Bacteria | 5284 |
| 429 | Ga0466718_126047 | 3300042617 | Unclassified | 2651 |
| 430 | Ga0466723_123180 | 3300042618 | Bacteria | 10950 |
| 431 | Ga0466729_019802 | 3300042621 | Bacteria | 2442 |
| 432 | Ga0160433_101326 | 3300012846 | Bacteria | 7092 |
| 433 | Ga0160445_100447 | 3300012847 | Bacteria | 21392 |
| 434 | Ga0415639_001258 | 3300038395 | Unclassified | 8486 |
| 435 | Ga0466692_070457 | 3300042591 | Bacteria | 14299 |
| 436 | Ga0466692_085715 | 3300042591 | Bacteria | 15333 |
| 437 | Ga0466693_257331 | 3300042592 | Bacteria | 6349 |
| 438 | Ga0466696_137087 | 3300042596 | Bacteria | 42498 |
| 439 | gam1t_NODE_334285_length=81741_GC=34_4_Contigs=2 | 2189573031 | Bacteria | 81751 |
| 440 | 2227507949 | 2225789004 | Bacteria | 70027 |
| 441 | IMNBL1DRAFT_c0000377 | 3300000062 | Bacteria | 38138 |
| 442 | JGI24698J34947_10004990 | 3300002449 | Bacteria | 7273 |
| 443 | JGI24695J34938_10009685 | 3300002450 | Bacteria | 5341 |
| 444 | JGI24695J34938_10032038 | 3300002450 | Bacteria | 2432 |
| 445 | JGI24702J35022_10023911 | 3300002462 | Bacteria | 3303 |
| 446 | CVPL010W_10000459 | 3300002931 | Unclassified | 42760 |
| 447 | CVPL010L_1002402 | 3300002932 | Unclassified | 4232 |
| 448 | Ga0063521_1000171 | 3300003973 | Bacteria | 48923 |
| 449 | Ga0068302_10133635 | 3300005071 | Unclassified | 4392 |
| 450 | Ga0072941_1431251 | 3300005201 | Bacteria | 3718 |
| 451 | Ga0102740_1000963 | 3300007140 | Unclassified | 7703 |
| 452 | Ga0102737_1002678 | 3300007142 | Unclassified | 4298 |
| 453 | Ga0105524_101901 | 3300007733 | Bacteria | 14117 |
| 454 | Ga0466706_130678 | 3300042599 | Bacteria | 70477 |
| 455 | Ga0466706_147407 | 3300042599 | Unclassified | 2506 |
| 456 | Ga0466706_173742 | 3300042599 | Bacteria | 7860 |
| 457 | Ga0466706_178620 | 3300042599 | Unclassified | 4544 |
| 458 | Ga0466706_220959 | 3300042599 | Bacteria | 6027 |
| 459 | Ga0466707_010467 | 3300042601 | Bacteria | 4192 |
| 460 | Ga0466707_198705 | 3300042601 | Bacteria | 50297 |
| 461 | Ga0466707_229164 | 3300042601 | Bacteria | 2092 |
| 462 | Ga0466707_358929 | 3300042601 | Bacteria | 32027 |
| 463 | Ga0466713_030982 | 3300042602 | Bacteria | 6547 |
| 464 | Ga0466713_035338 | 3300042602 | Bacteria | 4019 |
| 465 | Ga0466713_065581 | 3300042602 | Bacteria | 52137 |
| 466 | Ga0466713_103316 | 3300042602 | Bacteria | 5890 |
| 467 | Ga0466714_064743 | 3300042603 | Bacteria | 4103 |
| 468 | Ga0466716_242784 | 3300042605 | Bacteria | 10394 |
| 469 | Ga0466716_395986 | 3300042605 | Bacteria | 5743 |
| 470 | Ga0466722_094067 | 3300042609 | Bacteria | 5063 |
| 471 | Ga0466722_216918 | 3300042609 | Bacteria | 7010 |
| 472 | Ga0466697_035442 | 3300042611 | Bacteria | 3165 |
| 473 | Ga0466729_315976 | 3300042621 | Bacteria | 3525 |
| 474 | Ga0466730_023664 | 3300042625 | Unclassified | 3743 |
| 475 | Ga0466703_024134 | 3300042636 | Bacteria | 16317 |
| 476 | Ga0466703_197770 | 3300042636 | Bacteria | 6387 |
| 477 | Ga0466703_278253 | 3300042636 | Bacteria | 2081 |
| 478 | Ga0466703_346484 | 3300042636 | Bacteria | 2922 |
| 479 | Ga0466703_377963 | 3300042636 | Bacteria | 7428 |
| 480 | Ga0466703_398983 | 3300042636 | Bacteria | 1988 |
| 481 | Ga0466704_043214 | 3300042643 | Bacteria | 7679 |
| 482 | Ga0466704_448020 | 3300042643 | Bacteria | 64627 |
| 483 | Ga0466709_204281 | 3300042648 | Bacteria | 65501 |
| 484 | Ga0466724_18479 | 3300042649 | Unclassified | 65915 |
| 485 | Ga0466724_32676 | 3300042649 | Unclassified | 3192 |
| 486 | Ga0466727_134580 | 3300042655 | Bacteria | 29887 |
| 487 | Ga0123355_10005865 | 3300009826 | Bacteria | 18076 |
| 488 | Ga0123355_10035061 | 3300009826 | Bacteria | 8156 |
| 489 | Ga0123356_10024962 | 3300010049 | Bacteria | 5617 |
| 490 | Ga0123353_10040067 | 3300010167 | Bacteria | 7386 |
| 491 | Ga0123353_10207556 | 3300010167 | Bacteria | 3076 |
| 492 | Ga0123354_10000561 | 3300010882 | Bacteria | 38303 |
| 493 | Ga0123354_10139402 | 3300010882 | Unclassified | 3010 |
| 494 | Ga0466705_011264 | 3300042612 | Bacteria | 3393 |
| 495 | Ga0466705_015291 | 3300042612 | Bacteria | 23966 |
| 496 | Ga0466712_151840 | 3300042614 | Bacteria | 2584 |
| 497 | Ga0466711_005555 | 3300042615 | Bacteria | 7548 |
| 498 | Ga0466711_037616 | 3300042615 | Bacteria | 3642 |
| 499 | Ga0466711_136877 | 3300042615 | Bacteria | 36292 |
| 500 | Ga0466711_214204 | 3300042615 | Bacteria | 2672 |
| 501 | Ga0466711_292912 | 3300042615 | Bacteria | 104822 |
| 502 | Ga0466715_598265 | 3300042616 | Bacteria | 45969 |
| 503 | Ga0466718_101163 | 3300042617 | Bacteria | 2512 |
| 504 | Ga0466718_129158 | 3300042617 | Bacteria | 3071 |
| 505 | Ga0466723_017440 | 3300042618 | Bacteria | 24222 |
| 506 | Ga0466723_029948 | 3300042618 | Bacteria | 3028 |
| 507 | Ga0466726_039993 | 3300042619 | Bacteria | 6967 |
| 508 | Ga0466726_329482 | 3300042619 | Bacteria | 2259 |
| 509 | Ga0264413_111415 | 3300024493 | Bacteria | 3711 |
| 510 | Ga0466692_012733 | 3300042591 | Bacteria | 27371 |
| 511 | Ga0466692_192832 | 3300042591 | Bacteria | 22537 |
| 512 | Ga0466691_197776 | 3300042593 | Bacteria | 3338 |
| 513 | Ga0466696_028567 | 3300042596 | Bacteria | 18694 |
| 514 | Ga0466696_403406 | 3300042596 | Bacteria | 2449 |
| 515 | Ga0466696_447376 | 3300042596 | Unclassified | 3913 |
| 516 | Ga0466701_001528 | 3300042598 | Bacteria | 84063 |
| 517 | FGTW_contig31075 | 2065487013 | Unclassified | 6489 |
| 518 | 2227480175 | 2225789004 | Bacteria | 87862 |
| 519 | 2227602391 | 2225789004 | Bacteria | 12475 |
| 520 | IMNBL1DRAFT_c0000553 | 3300000062 | Bacteria | 30418 |
| 521 | AustNasuHG_c1002433 | 3300000089 | Bacteria | 6728 |
| 522 | SCG598L16_135928 | 3300000490 | Bacteria | 56581 |
| 523 | JGI24698J34947_10000693 | 3300002449 | Bacteria | 16455 |
| 524 | JGI24695J34938_10002084 | 3300002450 | Bacteria | 15672 |
| 525 | JGI24702J35022_10000879 | 3300002462 | Bacteria | 18620 |
| 526 | JGI24703J35330_11748849 | 3300002501 | Bacteria | 49103 |
| 527 | JGI24700J35501_10929183 | 3300002508 | Bacteria | 8788 |
| 528 | Ga0068302_10430817 | 3300005071 | Bacteria | 3705 |
| 529 | Ga0072941_1249694 | 3300005201 | Bacteria | 3841 |
| 530 | Ga0103261_1000003 | 3300007083 | Bacteria | 108314 |
| 531 | Ga0102739_1000056 | 3300007095 | Bacteria | 31776 |
| 532 | Ga0102734_1000016 | 3300007129 | Bacteria | 66140 |
| 533 | Ga0103260_1000052 | 3300007139 | Bacteria | 33954 |
| 534 | Ga0105005_1092179 | 3300007505 | Unclassified | 2740 |
| 535 | Ga0105524_102088 | 3300007733 | Bacteria | 3088 |
| 536 | Ga0466701_018506 | 3300042598 | Bacteria | 62475 |
| 537 | Ga0466706_214540 | 3300042599 | Bacteria | 5478 |
| 538 | Ga0466713_050825 | 3300042602 | Bacteria | 5459 |
| 539 | Ga0466713_077576 | 3300042602 | Bacteria | 38989 |
| 540 | Ga0466713_079203 | 3300042602 | Bacteria | 36699 |
| 541 | Ga0466713_154161 | 3300042602 | Bacteria | 17986 |
| 542 | Ga0466714_031673 | 3300042603 | Bacteria | 4028 |
| 543 | Ga0466716_049744 | 3300042605 | Archaea | 12793 |
| 544 | Ga0466716_438426 | 3300042605 | Bacteria | 5637 |
| 545 | Ga0466716_539586 | 3300042605 | Bacteria | 6841 |
| 546 | Ga0466719_061421 | 3300042606 | Bacteria | 31098 |
| 547 | Ga0466719_192311 | 3300042606 | Bacteria | 4703 |
| 548 | Ga0466719_250975 | 3300042606 | Bacteria | 7364 |
| 549 | Ga0466729_272174 | 3300042621 | Bacteria | 94053 |
| 550 | Ga0466734_035955 | 3300042623 | Bacteria | 4038 |
| 551 | Ga0466730_009532 | 3300042625 | Bacteria | 24860 |
| 552 | Ga0466730_028202 | 3300042625 | Bacteria | 27984 |
| 553 | Ga0466730_102480 | 3300042625 | Bacteria | 16126 |
| 554 | Ga0466703_030139 | 3300042636 | Bacteria | 8567 |
| 555 | Ga0466703_090402 | 3300042636 | Bacteria | 8837 |
| 556 | Ga0466703_172410 | 3300042636 | Bacteria | 4659 |
| 557 | Ga0466704_070237 | 3300042643 | Bacteria | 14748 |
| 558 | Ga0466704_074771 | 3300042643 | Bacteria | 86016 |
| 559 | Ga0466704_204690 | 3300042643 | Bacteria | 17712 |
| 560 | Ga0466704_312182 | 3300042643 | Bacteria | 5222 |
| 561 | Ga0466704_523764 | 3300042643 | Bacteria | 6107 |
| 562 | Ga0466709_148109 | 3300042648 | Bacteria | 38961 |
| 563 | Ga0466709_414480 | 3300042648 | Bacteria | 13842 |
| 564 | Ga0466708_436988 | 3300042652 | Bacteria | 20419 |
| 565 | Ga0123357_10070922 | 3300009784 | Bacteria | 4623 |
| 566 | Ga0123357_10255983 | 3300009784 | Bacteria | 1861 |
| 567 | Ga0123355_10000608 | 3300009826 | Bacteria | 48311 |
| 568 | Ga0123355_10012667 | 3300009826 | Unclassified | 13074 |
| 569 | Ga0123355_10054261 | 3300009826 | Bacteria | 6494 |
| 570 | Ga0123355_10314347 | 3300009826 | Unclassified | 2119 |
| 571 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 572 | Ga0123356_10002699 | 3300010049 | Bacteria | 18847 |
| 573 | Ga0123356_10073052 | 3300010049 | Viruses | 3224 |
| 574 | Ga0123356_10175556 | 3300010049 | Bacteria | 2158 |
| 575 | Ga0123353_10008394 | 3300010167 | Bacteria | 14097 |
| 576 | Ga0123353_10016495 | 3300010167 | Bacteria | 10800 |
| 577 | Ga0123353_10025720 | 3300010167 | Bacteria | 8976 |
| 578 | Ga0123353_10169871 | 3300010167 | Bacteria | 3463 |
| 579 | Ga0123353_10202516 | 3300010167 | Bacteria | 3121 |
| 580 | Ga0123353_10209944 | 3300010167 | Bacteria | 3055 |
| 581 | Ga0123354_10037049 | 3300010882 | Bacteria | 7596 |
| 582 | Ga0123354_10040493 | 3300010882 | Bacteria | 7209 |
| 583 | Ga0123354_10103205 | 3300010882 | Bacteria | 3836 |
| 584 | Ga0160464_100168 | 3300012805 | Bacteria | 70349 |
| 585 | Ga0466705_092633 | 3300042612 | Bacteria | 28689 |
| 586 | Ga0466705_112593 | 3300042612 | Bacteria | 2998 |
| 587 | Ga0466705_482037 | 3300042612 | Bacteria | 5341 |
| 588 | Ga0466710_234973 | 3300042613 | Bacteria | 10476 |
| 589 | Ga0466710_262308 | 3300042613 | Bacteria | 12645 |
| 590 | Ga0466712_014331 | 3300042614 | Bacteria | 4432 |
| 591 | Ga0466711_055159 | 3300042615 | Bacteria | 2917 |
| 592 | Ga0466711_155887 | 3300042615 | Bacteria | 5758 |
| 593 | Ga0466715_052816 | 3300042616 | Bacteria | 13469 |
| 594 | Ga0466715_061904 | 3300042616 | Bacteria | 5695 |
| 595 | Ga0466715_071402 | 3300042616 | Bacteria | 12418 |
| 596 | Ga0466715_286894 | 3300042616 | Bacteria | 47078 |
| 597 | Ga0466715_518339 | 3300042616 | Bacteria | 8544 |
| 598 | Ga0466718_123153 | 3300042617 | Bacteria | 2057 |
| 599 | Ga0466723_043304 | 3300042618 | Bacteria | 13436 |
| 600 | Ga0466726_039366 | 3300042619 | Bacteria | 7280 |
| 601 | Ga0466726_106226 | 3300042619 | Bacteria | 7276 |
| 602 | Ga0466726_123576 | 3300042619 | Bacteria | 11277 |
| 603 | Ga0466728_096101 | 3300042620 | Bacteria | 10199 |
| 604 | Ga0466728_187790 | 3300042620 | Bacteria | 16332 |
| 605 | Ga0466728_471352 | 3300042620 | Bacteria | 4990 |
| 606 | Ga0160455_100678 | 3300012837 | Bacteria | 14510 |
| 607 | Ga0160433_102334 | 3300012846 | Bacteria | 4156 |
| 608 | Ga0160430_106183 | 3300012852 | Bacteria | 2601 |
| 609 | Ga0247289_0075 | 3300035363 | Unclassified | 28175 |
| 610 | Ga0247289_0237 | 3300035363 | Unclassified | 11129 |
| 611 | Ga0415639_065340 | 3300038395 | Bacteria | 5864 |
| 612 | Ga0466657_206082 | 3300042582 | Unclassified | 4621 |
| 613 | Ga0466691_055183 | 3300042593 | Bacteria | 4509 |
| 614 | Ga0466696_357546 | 3300042596 | Bacteria | 6650 |
| 615 | Ga0466696_380082 | 3300042596 | Bacteria | 11838 |
| 616 | Ga0466696_395214 | 3300042596 | Bacteria | 13046 |
| 617 | 2227225256 | 2225789004 | Bacteria | 7426 |
| 618 | IMNBL1DRAFT_c0012131 | 3300000062 | Bacteria | 3964 |
| 619 | JGI24698J34947_10018736 | 3300002449 | Bacteria | 3738 |
| 620 | JGI24698J34947_10033557 | 3300002449 | Unclassified | 2692 |
| 621 | JGI24702J35022_10013943 | 3300002462 | Bacteria | 4442 |
| 622 | JGI24700J35501_10929041 | 3300002508 | Bacteria | 8474 |
| 623 | JGI24696J40584_12951188 | 3300002834 | Bacteria | 2218 |
| 624 | CVPL010L_1000034 | 3300002932 | Bacteria | 46450 |
| 625 | Ga0068305_10068107 | 3300005083 | Bacteria | 3046 |
| 626 | Ga0074278_127931 | 3300005721 | Bacteria | 6159 |
| 627 | Ga0104042_1035397 | 3300007130 | Bacteria | 2386 |
| 628 | Ga0123357_10000292 | 3300009784 | Bacteria | 47972 |
| 629 | Ga0466706_045865 | 3300042599 | Bacteria | 4172 |
| 630 | Ga0466706_134636 | 3300042599 | Bacteria | 7537 |
| 631 | Ga0466707_073344 | 3300042601 | Bacteria | 10549 |
| 632 | Ga0466713_137650 | 3300042602 | Bacteria | 20025 |
| 633 | Ga0466716_125474 | 3300042605 | Bacteria | 40593 |
| 634 | Ga0466716_309138 | 3300042605 | Bacteria | 12347 |
| 635 | Ga0466719_228929 | 3300042606 | Unclassified | 4838 |
| 636 | Ga0466722_109264 | 3300042609 | Bacteria | 5970 |
| 637 | Ga0466722_139643 | 3300042609 | Bacteria | 25034 |
| 638 | Ga0466734_149586 | 3300042623 | Bacteria | 2443 |
| 639 | Ga0466735_046652 | 3300042624 | Bacteria | 18114 |
| 640 | Ga0466704_021896 | 3300042643 | Bacteria | 5231 |
| 641 | Ga0466704_368890 | 3300042643 | Unclassified | 9394 |
| 642 | Ga0466709_346992 | 3300042648 | Bacteria | 3575 |
| 643 | Ga0466724_34367 | 3300042649 | Unclassified | 29651 |
| 644 | Ga0466708_145397 | 3300042652 | Bacteria | 12672 |
| 645 | Ga0466708_233460 | 3300042652 | Bacteria | 79059 |
| 646 | Ga0466727_182559 | 3300042655 | Bacteria | 1899 |
| 647 | Ga0123357_10048246 | 3300009784 | Bacteria | 5771 |
| 648 | Ga0123355_10000365 | 3300009826 | Bacteria | 58534 |
| 649 | Ga0123355_10001000 | 3300009826 | Bacteria | 39240 |
| 650 | Ga0123355_10001567 | 3300009826 | Bacteria | 31924 |
| 651 | Ga0123355_10013008 | 3300009826 | Bacteria | 12925 |
| 652 | Ga0123355_10158637 | 3300009826 | Bacteria | 3415 |
| 653 | Ga0123356_10000105 | 3300010049 | Bacteria | 88897 |
| 654 | Ga0123356_10000661 | 3300010049 | Bacteria | 37965 |
| 655 | Ga0123356_10001257 | 3300010049 | Bacteria | 28049 |
| 656 | Ga0123356_10009927 | 3300010049 | Bacteria | 9374 |
| 657 | Ga0123356_10047318 | 3300010049 | Bacteria | 4002 |
| 658 | Ga0123356_10109561 | 3300010049 | Bacteria | 2665 |
| 659 | Ga0123356_10180886 | 3300010049 | Bacteria | 2130 |
| 660 | Ga0123353_10031140 | 3300010167 | Bacteria | 8256 |
| 661 | Ga0123353_10090116 | 3300010167 | Bacteria | 4938 |
| 662 | Ga0123353_10316325 | 3300010167 | Bacteria | 2372 |
| 663 | Ga0123353_10355381 | 3300010167 | Bacteria | 2205 |
| 664 | Ga0123353_10383022 | 3300010167 | Bacteria | 2102 |
| 665 | Ga0123354_10108961 | 3300010882 | Bacteria | 3674 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00205 | TPP_enzyme_M | Thiamine pyrophosphate enzyme, central domain | 280 | 414 | 0.99 |
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 468 | 616 | 0.99 |
| PF02776 | TPP_enzyme_N | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain | 92 | 207 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02776 | GO:0030976 | thiamine pyrophosphate binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.