Protein Family IF01876

Metagenome Metatranscriptome Isolate
634 Members
255 Samples
493 Scaffolds
117.43 Avg Length

🧬 Representative Sequence

ID
3300007188|Ga0103264_1018684|Ga0103264_10186841
Length
138 aa
Sequence
MARVKRGVTGHAKHKKTLKQARGFYGRRKNTIRAAMAAVDRAKQYAYRDRKNRKRTFRALWIQRINAAVREHGLSYGRFIDGLTKAGIEVDRKLLSDLAIHQPEAFAALVQSARQALDYLKQTTPGAYEGAVKQADS*

πŸ“Š Sample Types

Isolate 22.2%
Metagenome 76.7%
MAG 0.0%
Metatranscriptome 1.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Apidae 17.6%
Unclassified 15.5%
Termitidae 15.1%
Formicidae 10.2%
Drosophilidae 9.0%
Elmidae 5.7%
Kalotermitidae 5.7%
Culicidae 4.5%
Armadillidiidae 2.4%
Aleyrodidae 2.0%
Termopsidae 1.6%
Psyllidae 1.2%
Rhinotermitidae 1.2%
Nephropidae 1.2%
Blattidae 1.2%
Tenebrionidae 0.8%
Passalidae 0.8%
Daphniidae 0.8%
Cerambycidae 0.4%
Cambaridae 0.4%
Muscidae 0.4%
Kiwaidae 0.4%
Aphelinidae 0.4%
Curculionidae 0.4%
Thomisidae 0.4%
Hodotermitidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 472
Eukaryota 0
Viruses 0
Unclassified 162

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
2 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
3 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
4 2837008993 Oecophyllibacter saccharovorans Ta1 Isolate Formicidae
5 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
6 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
7 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
8 2515154046 Candidatus Portiera aleyrodidarum Isolate Aleyrodidae
9 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
10 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
11 2518285589 Candidatus Portiera aleyrodidarum TV (unscreened) Isolate Aleyrodidae
12 8067594896 Gluconobacter kondonii Dm-18 Isolate Drosophilidae
13 8068953321 Bartonella apihabitans M0190 Isolate Apidae
14 8074748739 Commensalibacter sp. W8133 Isolate Apidae
15 8100531325 Gluconobacter sp. Dm-73 Isolate Drosophilidae
16 3300060777 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
17 644736336 Candidatus Liberibacter asiaticus psy62 Isolate Psyllidae
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
20 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
21 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
22 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
23 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
24 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
25 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
26 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
31 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
32 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
33 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
34 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
35 2785510743 Apibacter sp. ESL0404 Isolate Apidae
36 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
37 2512047025 Candidatus Portiera aleyrodidarum Isolate Aleyrodidae
38 2518645538 Candidatus Portiera aleyrodidarum BT-QVLC Isolate Aleyrodidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 8073624232 Bartonella sp. W8151 Isolate Apidae
42 8074884171 Commensalibacter sp. M0355 Isolate Apidae
43 8100534375 Gluconobacter sp. Dm-74 Isolate Drosophilidae
44 2987037630 Oecophyllibacter saccharovorans Ha5 Isolate Formicidae
45 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
48 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
49 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
52 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
53 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
54 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
55 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
56 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
59 2834038347 Gluconobacter sp. DsW_058 Isolate Drosophilidae
60 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
61 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
62 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
63 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
64 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
65 2517093038 Candidatus Portiera aleyrodidarum BT-B Isolate Aleyrodidae
66 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
67 2751185858 Bartonella apis BBC0122 Isolate Apidae
68 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
69 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
70 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
71 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
72 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
73 8073619611 Bartonella apis B10834G6 Isolate Apidae
74 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
75 8074750600 Commensalibacter sp. W8163 Isolate Apidae
76 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
77 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
78 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
79 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
80 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
81 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
82 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
83 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
84 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
85 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
86 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
87 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
88 2841330038 Sulfitobacter sp. D7 Isolate
89 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
90 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
91 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
92 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
93 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
94 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
95 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
96 2718218026 Phaeobacter porticola P97 Isolate Unclassified
97 2820148564 Unclassified Proteobacteria Emb289P1bin36 Isolate Unclassified
98 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
99 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
100 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
101 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
102 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
103 8067585538 Gluconobacter kondonii Dm-68 Isolate Drosophilidae
104 8068950955 Bartonella apihabitans W8097 Isolate Apidae
105 8073621894 Bartonella apis W8099 Isolate Apidae
106 8074743123 Commensalibacter melissae M0402 Isolate Apidae
107 8063680480 Candidatus Liberibacter asiaticus CoFLP Isolate Psyllidae
108 3002401049 Gluconobacter sp. Dm-62 Isolate Drosophilidae
109 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
110 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
111 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
112 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
113 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
114 3300007763 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut Metagenome Drosophilidae
115 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
116 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
117 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
118 2832372155 Apibacter adventoris wkB301 Isolate Apidae
119 2843073756 Oecophyllibacter saccharovorans Jb2 Isolate Formicidae
120 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
121 2864836148 Arcicella rosea S00070 Isolate Elmidae
122 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
123 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
124 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
125 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
126 2751185853 Bartonella apis BBC0178 Isolate Apidae
127 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
128 2816332302 Candidatus Liberibacter asiaticus YCPsy Isolate Psyllidae
129 8067591850 Gluconobacter kondonii Dm-47 Isolate Drosophilidae
130 8068944069 Bartonella choladocola W8125 Isolate Apidae
131 8068955631 Bartonella apihabitans M0280 Isolate Apidae
132 8073628750 Bartonella sp. W8167 Isolate Apidae
133 8074737057 Commensalibacter sp. M0357 Isolate Apidae
134 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
135 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
136 8074876897 Commensalibacter sp. M0266 Isolate Apidae
137 8100528075 Gluconobacter sp. Dm-44 Isolate Drosophilidae
138 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
139 3300003131 Encarsia pergandiella symbiont microbial communities from Weslaco, Texas Metagenome Aphelinidae
140 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
141 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
142 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
143 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
144 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
145 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
146 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
147 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
148 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
149 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
150 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
151 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
152 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
153 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
154 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
155 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
156 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
157 2751185856 Bartonella apis BBC0244 Isolate Apidae
158 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
159 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
160 2820098966 Unclassified Proteobacteria Lab288P1bin49 Isolate Unclassified
161 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
162 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
163 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
164 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
165 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
166 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
167 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
168 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
169 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
170 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
171 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
172 8067588748 Gluconobacter kondonii Dm-42 Isolate Drosophilidae
173 8073617375 Bartonella apis W8098 Isolate Apidae
174 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
175 3002394112 Gluconobacter sp. Gdi Isolate Drosophilidae
176 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
177 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
178 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
179 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
180 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
181 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
182 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
183 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
184 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
185 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
186 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
187 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
188 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
189 2832298047 Apibacter sp. wkB309 Isolate Apidae
190 2839192570 Gluconobacter sp. DsW_056 Isolate Drosophilidae
191 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
192 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
193 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
194 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
195 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
196 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
197 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
198 8073626464 Bartonella apis W8152 Isolate Apidae
199 8074832014 Commensalibacter melissae M0391 Isolate Apidae
200 8074875073 Commensalibacter sp. M0265 Isolate Apidae
201 8074878724 Commensalibacter sp. M0267 Isolate Apidae
202 8074880551 Commensalibacter sp. M0268 Isolate Apidae
203 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
204 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
205 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
206 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
207 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
208 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
209 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
210 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
211 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
212 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
213 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
214 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
215 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
216 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
217 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
218 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
219 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
220 2832343623 Apibacter adventoris wkB180 Isolate Apidae
221 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
222 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
223 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
224 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
225 2882250448 Bizionia sp. APA-3 Isolate
226 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
227 2556921669 Shinella sp. DD12 Isolate Daphniidae
228 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
229 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
230 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
231 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
232 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
233 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
234 8067579126 Gluconobacter kondonii Dm-16 Isolate Drosophilidae
235 8067581993 Gluconobacter kondonii Dm-54 Isolate Drosophilidae
236 8068946563 Bartonella apihabitans M0187 Isolate Apidae
237 8074882376 Commensalibacter sp. M0270 Isolate Apidae
238 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
239 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
240 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
241 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
242 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
243 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
244 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
245 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
246 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
247 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
248 3300021222 Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA Metatranscriptome
249 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
250 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
251 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
252 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
253 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
254 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
255 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_310025 3300042612 Unclassified 6013
2 Ga0466732_409889 3300042656 Unclassified 4872
3 Ga0466733_123446 3300042659 Bacteria 50285
4 Ga0466733_125464 3300042659 Bacteria 11645
5 Ga0466733_208754 3300042659 Bacteria 18747
6 IMNBL1DRAFT_c0026727 3300000062 Bacteria 2185
7 IMNBL1DRAFT_c0066935 3300000062 Bacteria 1052
8 JGI24698J34947_10214712 3300002449 Unclassified 743
9 JGI24698J34947_10235843 3300002449 Unclassified 692
10 JGI24702J35022_10303016 3300002462 Bacteria 943
11 JGI24705J35276_11565699 3300002504 Unclassified 579
12 CVPL010W_10001263 3300002931 Bacteria 49318
13 CVPL010L_1000500 3300002932 Unclassified 9473
14 CVPL005L_10001721 3300002938 Unclassified 25257
15 Ga0102736_1009439 3300007052 Bacteria 1132
16 Ga0123357_10001672 3300009784 Bacteria 23842
17 Ga0123355_11009745 3300009826 Unclassified 882
18 Ga0123355_11870052 3300009826 Unclassified 563
19 Ga0123356_10005971 3300010049 Bacteria 12359
20 Ga0123356_10970518 3300010049 Unclassified 1020
21 Ga0123356_11733658 3300010049 Bacteria 775
22 Ga0123353_10017614 3300010167 Bacteria 10513
23 Ga0123353_10759116 3300010167 Bacteria 1348
24 Ga0123353_10907367 3300010167 Unclassified 1198
25 Ga0123353_11847582 3300010167 Unclassified 748
26 Ga0123353_13339332 3300010167 Bacteria 511
27 Ga0123354_10152845 3300010882 Bacteria 2786
28 Ga0160471_114414 3300012812 Bacteria 790
29 Ga0466711_089981 3300042615 Bacteria 7482
30 Ga0466715_636150 3300042616 Bacteria 6714
31 Ga0466726_072948 3300042619 Bacteria 1761
32 Ga0466728_289221 3300042620 Bacteria 14211
33 Ga0466709_062901 3300042648 Bacteria 45932
34 Ga0466709_169180 3300042648 Bacteria 45156
35 Ga0466708_415768 3300042652 Bacteria 11732
36 Ga0160472_100450 3300012839 Bacteria 29515
37 Ga0223677_1006094 3300021239 Unclassified 577
38 Ga0255572_1000003 3300026175 Bacteria 262489
39 Ga0309903_100013 3300029809 Bacteria 41975
40 Ga0466690_148584 3300042590 Bacteria 6067
41 Ga0466690_196912 3300042590 Bacteria 20732
42 Ga0466690_381631 3300042590 Unclassified 5786
43 Ga0466690_400038 3300042590 Bacteria 5155
44 Ga0466691_029420 3300042593 Bacteria 25628
45 Ga0466696_141025 3300042596 Bacteria 7823
46 Ga0466701_054311 3300042598 Bacteria 18356
47 Ga0466706_050641 3300042599 Bacteria 28814
48 Ga0466700_306800 3300042600 Bacteria 3356
49 Ga0466713_025378 3300042602 Bacteria 40984
50 Ga0466714_005494 3300042603 Bacteria 3900
51 Ga0466714_024743 3300042603 Bacteria 1312
52 Ga0466714_063458 3300042603 Unclassified 3634
53 Ga0466714_078588 3300042603 Bacteria 41151
54 Ga0466714_108484 3300042603 Bacteria 20162
55 Ga0466714_113826 3300042603 Bacteria 5218
56 Ga0466714_115946 3300042603 Bacteria 9489
57 Ga0466714_169375 3300042603 Bacteria 2020
58 Ga0466717_206358 3300042604 Bacteria 4264
59 Ga0466716_108377 3300042605 Bacteria 17952
60 Ga0466719_486176 3300042606 Unclassified 1773
61 Ga0466698_232625 3300042610 Bacteria 24344
62 Ga0466698_482579 3300042610 Bacteria 1120
63 Ga0466733_104255 3300042659 Bacteria 1708
64 Ga0466733_186866 3300042659 Bacteria 153934
65 JGI24705J35276_11900406 3300002504 Unclassified 751
66 JGI24699J35502_10459999 3300002509 Bacteria 594
67 CVPL010W_10003885 3300002931 Bacteria 16958
68 Ga0068302_10032908 3300005071 Unclassified 3578
69 Ga0072940_1212868 3300005200 Bacteria 1294
70 Ga0103263_100909 3300007042 Unclassified 3952
71 Ga0103264_1000027 3300007188 Bacteria 89570
72 Ga0123357_10136510 3300009784 Bacteria 3031
73 Ga0123355_10446203 3300009826 Unclassified 1634
74 Ga0123355_11162331 3300009826 Unclassified 793
75 Ga0123356_10244920 3300010049 Unclassified 1866
76 Ga0123356_10461199 3300010049 Bacteria 1420
77 Ga0123356_10731127 3300010049 Bacteria 1159
78 Ga0123353_10000490 3300010167 Bacteria 48867
79 Ga0123354_10419942 3300010882 Unclassified 1112
80 Ga0466710_205907 3300042613 Bacteria 1150
81 Ga0466711_117108 3300042615 Bacteria 4471
82 Ga0466711_145131 3300042615 Bacteria 39663
83 Ga0466715_348432 3300042616 Unclassified 1068
84 Ga0466723_075676 3300042618 Unclassified 4914
85 Ga0466728_082257 3300042620 Bacteria 106309
86 Ga0466728_199563 3300042620 Unclassified 2707
87 Ga0466728_395128 3300042620 Bacteria 5350
88 Ga0466731_008519 3300042622 Unclassified 2210
89 Ga0466731_309755 3300042622 Unclassified 4858
90 Ga0466735_122223 3300042624 Bacteria 2275
91 Ga0466703_021693 3300042636 Unclassified 7598
92 Ga0466704_183540 3300042643 Bacteria 1469
93 Ga0466725_007978 3300042654 Bacteria 1265
94 Ga0466725_097650 3300042654 Bacteria 4206
95 Ga0466727_162580 3300042655 Bacteria 9266
96 Ga0466727_247564 3300042655 Bacteria 21966
97 Ga0160458_104714 3300012832 Bacteria 1647
98 Ga0160472_100004 3300012839 Bacteria 753687
99 Ga0160448_106013 3300012854 Bacteria 3086
100 Ga0160435_1028834 3300012857 Unclassified 894
101 Ga0255809_1041172 3300022820 Unclassified 502
102 Ga0466690_182011 3300042590 Unclassified 5226
103 Ga0466690_256340 3300042590 Bacteria 5461
104 Ga0466692_171932 3300042591 Bacteria 367168
105 Ga0466691_040690 3300042593 Bacteria 3743
106 Ga0466694_112202 3300042594 Unclassified 1848
107 Ga0466694_376172 3300042594 Unclassified 4858
108 Ga0466696_177908 3300042596 Bacteria 11253
109 Ga0466701_049065 3300042598 Bacteria 2323
110 Ga0466706_279696 3300042599 Unclassified 3231
111 Ga0466700_479238 3300042600 Bacteria 20513
112 Ga0466713_010317 3300042602 Bacteria 8281
113 Ga0466713_030788 3300042602 Bacteria 1352
114 Ga0466714_163829 3300042603 Bacteria 2797
115 Ga0466719_211047 3300042606 Unclassified 3348
116 Ga0466719_214496 3300042606 Unclassified 4626
117 Ga0466722_176003 3300042609 Bacteria 44911
118 Ga0466697_000635 3300042611 Bacteria 14006
119 Ga0466705_056392 3300042612 Bacteria 28280
120 Ga0466732_253018 3300042656 Unclassified 2627
121 IMNBL1DRAFT_c0009089 3300000062 Bacteria 4970
122 HBC_ctgsDRAFT_1001018 3300000333 Unclassified 6099
123 JGI24702J35022_10005614 3300002462 Unclassified 7317
124 JGI24702J35022_10006618 3300002462 Unclassified 6690
125 JGI24705J35276_12219918 3300002504 Unclassified 2234
126 JGI24696J40584_12954552 3300002834 Unclassified 2658
127 JGI24696J40584_12955105 3300002834 Bacteria 2763
128 CVPL010W_10000233 3300002931 Bacteria 52424
129 CVPL005L_10011724 3300002938 Bacteria 6742
130 Ga0102736_1010464 3300007052 Bacteria 1586
131 Ga0102739_1030780 3300007095 Unclassified 715
132 Ga0103264_1000081 3300007188 Bacteria 56731
133 Ga0103264_1000166 3300007188 Bacteria 38393
134 Ga0103264_1000270 3300007188 Bacteria 28372
135 Ga0123357_10005386 3300009784 Bacteria 15311
136 Ga0123355_10856257 3300009826 Bacteria 999
137 Ga0123355_11102504 3300009826 Unclassified 825
138 Ga0123356_10509489 3300010049 Unclassified 1360
139 Ga0123356_10997715 3300010049 Bacteria 1007
140 Ga0123356_11353279 3300010049 Unclassified 874
141 Ga0123353_10045675 3300010167 Bacteria 6954
142 Ga0123353_11258904 3300010167 Bacteria 965
143 Ga0123353_11415520 3300010167 Unclassified 892
144 Ga0123354_10127392 3300010882 Bacteria 3241
145 Ga0466711_319118 3300042615 Bacteria 3959
146 Ga0466711_402154 3300042615 Bacteria 17656
147 Ga0466715_154331 3300042616 Bacteria 6031
148 Ga0466715_376733 3300042616 Bacteria 17373
149 Ga0466726_013143 3300042619 Bacteria 12145
150 Ga0466729_192010 3300042621 Bacteria 1796
151 Ga0466729_220935 3300042621 Bacteria 5071
152 Ga0466734_037895 3300042623 Bacteria 1031
153 Ga0466735_063781 3300042624 Bacteria 2689
154 Ga0466724_09429 3300042649 Bacteria 389876
155 Ga0466708_160115 3300042652 Unclassified 10381
156 Ga0466725_460307 3300042654 Unclassified 2905
157 Ga0466727_307144 3300042655 Bacteria 1661
158 Ga0160457_1000022 3300012858 Bacteria 339795
159 Ga0160457_1001554 3300012858 Bacteria 6147
160 Ga0466656_020616 3300042550 Unclassified 1036
161 Ga0466656_380573 3300042550 Unclassified 2783
162 Ga0466657_351789 3300042582 Bacteria 55510
163 Ga0466690_183549 3300042590 Unclassified 3276
164 Ga0466693_439873 3300042592 Bacteria 186295
165 Ga0466696_481607 3300042596 Bacteria 13935
166 Ga0466699_154582 3300042597 Unclassified 1376
167 Ga0466706_134819 3300042599 Bacteria 9924
168 Ga0466707_129170 3300042601 Bacteria 5791
169 Ga0466713_062852 3300042602 Bacteria 4436
170 Ga0466713_089366 3300042602 Bacteria 9909
171 Ga0466713_127795 3300042602 Bacteria 20441
172 Ga0466714_026831 3300042603 Unclassified 7575
173 Ga0466714_044318 3300042603 Bacteria 3064
174 Ga0466714_163141 3300042603 Unclassified 1478
175 Ga0466716_137613 3300042605 Bacteria 2664
176 Ga0466719_001354 3300042606 Unclassified 1035
177 Ga0466721_195668 3300042608 Bacteria 2838
178 Ga0466705_045540 3300042612 Bacteria 2100
179 Ga0466733_000042 3300042659 Unclassified 3056
180 Ga0466733_059911 3300042659 Bacteria 27822
181 Ga0466733_186975 3300042659 Bacteria 14055
182 Ga0530661_012763 3300056564 Bacteria 2343
183 IMNBL1DRAFT_c0007253 3300000062 Bacteria 5869
184 JGI24698J34947_10233748 3300002449 Unclassified 697
185 JGI24702J35022_10001803 3300002462 Unclassified 13195
186 JGI24702J35022_10013016 3300002462 Unclassified 4613
187 JGI24702J35022_11004367 3300002462 Unclassified 519
188 Ga0127649_101303 3300009460 Bacteria 65750
189 Ga0123357_10000007 3300009784 Bacteria 257289
190 Ga0123357_10058721 3300009784 Bacteria 5164
191 Ga0123357_10392526 3300009784 Bacteria 1273
192 Ga0123355_10702331 3300009826 Unclassified 1161
193 Ga0123355_10716057 3300009826 Unclassified 1144
194 Ga0123355_10956146 3300009826 Unclassified 919
195 Ga0123356_10035306 3300010049 Bacteria 4672
196 Ga0123356_10036025 3300010049 Unclassified 4620
197 Ga0123356_10332451 3300010049 Unclassified 1637
198 Ga0123356_13335945 3300010049 Unclassified 558
199 Ga0123353_10269871 3300010167 Bacteria 2622
200 Ga0123353_10511915 3300010167 Bacteria 1745
201 Ga0123353_10595827 3300010167 Bacteria 1581
202 Ga0123353_11591249 3300010167 Unclassified 826
203 Ga0123353_12574597 3300010167 Bacteria 603
204 Ga0123353_12972927 3300010167 Unclassified 550
205 Ga0123354_10291651 3300010882 Bacteria 1562
206 Ga0123354_10300234 3300010882 Unclassified 1520
207 Ga0466710_099940 3300042613 Bacteria 1293
208 Ga0466715_101234 3300042616 Bacteria 3501
209 Ga0466723_051722 3300042618 Unclassified 7452
210 Ga0466723_101055 3300042618 Bacteria 4541
211 Ga0466723_182390 3300042618 Bacteria 3889
212 Ga0466723_289793 3300042618 Bacteria 6264
213 Ga0466726_077805 3300042619 Bacteria 15528
214 Ga0466726_251769 3300042619 Bacteria 6687
215 Ga0466726_312631 3300042619 Bacteria 9664
216 Ga0466728_095934 3300042620 Unclassified 4045
217 Ga0466728_176057 3300042620 Bacteria 14282
218 Ga0466728_404526 3300042620 Unclassified 2396
219 Ga0466703_122128 3300042636 Bacteria 7487
220 Ga0466703_276653 3300042636 Bacteria 5771
221 Ga0466703_287852 3300042636 Unclassified 11417
222 Ga0466703_418593 3300042636 Bacteria 4356
223 Ga0466704_121841 3300042643 Bacteria 12540
224 Ga0466724_47761 3300042649 Bacteria 163277
225 Ga0466708_175756 3300042652 Bacteria 21252
226 Ga0466725_211762 3300042654 Bacteria 62408
227 Ga0466727_041923 3300042655 Bacteria 21720
228 Ga0466727_069849 3300042655 Unclassified 1958
229 Ga0160455_100649 3300012837 Unclassified 14918
230 Ga0223687_123079 3300021217 Bacteria 605
231 Ga0223683_1026940 3300021245 Bacteria 548
232 Ga0255809_1029343 3300022820 Unclassified 682
233 Ga0264413_150757 3300024493 Bacteria 1196
234 Ga0466657_157937 3300042582 Bacteria 13245
235 Ga0466657_377582 3300042582 Unclassified 2210
236 Ga0466690_163337 3300042590 Unclassified 5542
237 Ga0466699_160747 3300042597 Bacteria 1600
238 Ga0466701_037243 3300042598 Bacteria 5153
239 Ga0466706_188194 3300042599 Bacteria 37930
240 Ga0466706_242809 3300042599 Bacteria 8617
241 Ga0466713_104006 3300042602 Bacteria 1299
242 Ga0466714_058160 3300042603 Bacteria 1481
243 Ga0466717_005361 3300042604 Unclassified 1949
244 Ga0466716_184887 3300042605 Unclassified 1341
245 Ga0466722_169591 3300042609 Bacteria 6808
246 Ga0466722_263459 3300042609 Bacteria 1210
247 Ga0466697_002351 3300042611 Unclassified 1071
248 Ga0466732_005715 3300042656 Bacteria 91596
249 Ga0466732_337544 3300042656 Bacteria 6394
250 IMNBL1DRAFT_c0033513 3300000062 Bacteria 1838
251 HBC_ctgsDRAFT_1116592 3300000333 Bacteria 607
252 JGI24702J35022_10007650 3300002462 Bacteria 6175
253 JGI24702J35022_10062668 3300002462 Unclassified 1992
254 JGI24705J35276_11828290 3300002504 Unclassified 701
255 JGI24705J35276_12073545 3300002504 Unclassified 958
256 CVPL010L_1000004 3300002932 Bacteria 122747
257 Ga0052165_100010 3300003131 Bacteria 20162
258 Ga0063521_1000464 3300003973 Bacteria 20104
259 Ga0068302_10674021 3300005071 Bacteria 539
260 Ga0103266_1000060 3300007067 Bacteria 67164
261 Ga0102734_1000333 3300007129 Bacteria 14132
262 Ga0102737_1007977 3300007142 Unclassified 1897
263 Ga0105004_1071240 3300007763 Bacteria 6925
264 Ga0123357_10505602 3300009784 Bacteria 1000
265 Ga0123355_10076527 3300009826 Unclassified 5352
266 Ga0123356_10156521 3300010049 Bacteria 2270
267 Ga0123356_12291576 3300010049 Unclassified 675
268 Ga0123356_13804920 3300010049 Bacteria 521
269 Ga0123353_10149945 3300010167 Bacteria 3724
270 Ga0123353_10651052 3300010167 Unclassified 1491
271 Ga0123353_11100494 3300010167 Unclassified 1055
272 Ga0123353_12103559 3300010167 Bacteria 687
273 Ga0123353_12559905 3300010167 Bacteria 605
274 Ga0123354_10115975 3300010882 Bacteria 3497
275 Ga0123354_10417675 3300010882 Unclassified 1118
276 Ga0466715_165590 3300042616 Unclassified 3605
277 Ga0466715_411282 3300042616 Bacteria 7095
278 Ga0466723_018855 3300042618 Bacteria 15901
279 Ga0466734_004940 3300042623 Unclassified 1043
280 Ga0466734_032852 3300042623 Bacteria 2634
281 Ga0466734_062471 3300042623 Bacteria 1708
282 Ga0466703_031968 3300042636 Bacteria 28293
283 Ga0466703_120828 3300042636 Unclassified 3922
284 Ga0466704_524158 3300042643 Bacteria 6041
285 Ga0466709_165161 3300042648 Bacteria 19220
286 Ga0466709_192258 3300042648 Bacteria 165099
287 Ga0265387_1018691 3300024582 Unclassified 1016
288 Ga0316159_10028 3300030930 Bacteria 37800
289 Ga0466692_195075 3300042591 Bacteria 15006
290 Ga0466693_109461 3300042592 Bacteria 182600
291 Ga0466691_038469 3300042593 Bacteria 5074
292 Ga0466691_052313 3300042593 Bacteria 16873
293 Ga0466694_071777 3300042594 Unclassified 2267
294 Ga0466694_117566 3300042594 Bacteria 2008
295 Ga0466695_062450 3300042595 Bacteria 1541
296 Ga0466706_002466 3300042599 Bacteria 39380
297 Ga0466706_080441 3300042599 Bacteria 247551
298 Ga0466706_117973 3300042599 Bacteria 1365
299 Ga0466706_142051 3300042599 Bacteria 39569
300 Ga0466707_224027 3300042601 Bacteria 2405
301 Ga0466707_297878 3300042601 Bacteria 29546
302 Ga0466714_157821 3300042603 Bacteria 9563
303 Ga0466719_268013 3300042606 Bacteria 12719
304 Ga0466722_172519 3300042609 Bacteria 3764
305 Ga0466722_208670 3300042609 Bacteria 9951
306 Ga0466705_137022 3300042612 Unclassified 4333
307 Ga0466733_119239 3300042659 Bacteria 24180
308 AglaG_GDN60OX02FKEET 2084038013 Bacteria 515
309 IMNBL1DRAFT_c0008435 3300000062 Unclassified 5244
310 IMNBL1DRAFT_c0055834 3300000062 Bacteria 1214
311 Meta3P_1002985 3300002464 Bacteria 31909
312 WW0001_100604 3300002732 Unclassified 4581
313 Ga0103265_1008800 3300007068 Bacteria 1329
314 Ga0103267_1000113 3300007190 Bacteria 30309
315 Ga0123357_10107560 3300009784 Unclassified 3571
316 Ga0123356_10216746 3300010049 Unclassified 1968
317 Ga0123356_10792765 3300010049 Unclassified 1118
318 Ga0123356_11958107 3300010049 Unclassified 730
319 Ga0123353_10021295 3300010167 Bacteria 9727
320 Ga0123353_10287415 3300010167 Unclassified 2520
321 Ga0123353_10295016 3300010167 Bacteria 2479
322 Ga0123353_10378965 3300010167 Bacteria 2117
323 Ga0123354_10097407 3300010882 Bacteria 4008
324 Ga0123354_10318032 3300010882 Bacteria 1441
325 Ga0123354_10546219 3300010882 Bacteria 876
326 Ga0466715_117797 3300042616 Unclassified 11582
327 Ga0466715_371462 3300042616 Bacteria 29074
328 Ga0466728_071004 3300042620 Unclassified 9163
329 Ga0466729_008090 3300042621 Bacteria 6104
330 Ga0466704_217206 3300042643 Bacteria 87649
331 Ga0466724_09922 3300042649 Bacteria 1805
332 Ga0466724_31046 3300042649 Bacteria 1392
333 Ga0466708_132874 3300042652 Bacteria 15716
334 Ga0466708_183984 3300042652 Bacteria 148491
335 Ga0466708_228583 3300042652 Bacteria 25073
336 Ga0466708_381158 3300042652 Bacteria 6389
337 Ga0160433_100002 3300012846 Bacteria 625007
338 Ga0309901_1000019 3300028918 Bacteria 429099
339 Ga0309904_1000020 3300029810 Bacteria 23208
340 Ga0415639_145508 3300038395 Unclassified 1326
341 Ga0466657_330543 3300042582 Bacteria 2173
342 Ga0466693_101578 3300042592 Unclassified 3304
343 Ga0466691_012800 3300042593 Bacteria 55247
344 Ga0466696_048088 3300042596 Bacteria 9133
345 Ga0466701_052131 3300042598 Bacteria 6147
346 Ga0466701_055627 3300042598 Bacteria 218820
347 Ga0466706_132532 3300042599 Bacteria 1975
348 Ga0466714_009885 3300042603 Bacteria 4065
349 Ga0466714_074198 3300042603 Bacteria 829090
350 Ga0466717_026136 3300042604 Unclassified 1226
351 Ga0466717_049853 3300042604 Bacteria 2309
352 Ga0466717_208803 3300042604 Bacteria 1097
353 Ga0466716_049258 3300042605 Bacteria 9806
354 Ga0466716_475296 3300042605 Bacteria 9321
355 Ga0466719_502339 3300042606 Unclassified 2295
356 Ga0466698_272491 3300042610 Unclassified 2671
357 Ga0466697_106251 3300042611 Bacteria 2630
358 Ga0466697_183987 3300042611 Unclassified 2804
359 Ga0466732_426027 3300042656 Unclassified 1261
360 Ga0466733_095726 3300042659 Bacteria 5141
361 Ga0466733_164789 3300042659 Bacteria 2295
362 2227480167 2225789004 Bacteria 99470
363 2227556028 2225789004 Bacteria 2786
364 IMNBL1DRAFT_c0018465 3300000062 Bacteria 2899
365 IMNBL1DRAFT_c0124939 3300000062 Unclassified 674
366 JGI24705J35276_12034093 3300002504 Bacteria 893
367 Ga0072941_1041787 3300005201 Bacteria 7104
368 Ga0074278_109074 3300005721 Bacteria 58903
369 Ga0102736_1000056 3300007052 Bacteria 29275
370 Ga0103265_1000011 3300007068 Bacteria 44046
371 Ga0102735_1001386 3300007080 Unclassified 4182
372 Ga0103261_1012522 3300007083 Bacteria 1179
373 Ga0102734_1003400 3300007129 Bacteria 7551
374 Ga0104048_1002757 3300007143 Bacteria 2665
375 Ga0123357_10145017 3300009784 Unclassified 2904
376 Ga0123355_10115452 3300009826 Unclassified 4181
377 Ga0123356_10034698 3300010049 Bacteria 4714
378 Ga0123356_10092691 3300010049 Unclassified 2881
379 Ga0123356_10108959 3300010049 Unclassified 2672
380 Ga0123356_10237754 3300010049 Unclassified 1891
381 Ga0123356_11245630 3300010049 Unclassified 909
382 Ga0123356_11636274 3300010049 Bacteria 798
383 Ga0123356_12164636 3300010049 Bacteria 695
384 Ga0123356_12210457 3300010049 Bacteria 688
385 Ga0123353_10000002 3300010167 Bacteria 351672
386 Ga0123353_10044318 3300010167 Bacteria 7051
387 Ga0123353_10334526 3300010167 Bacteria 2290
388 Ga0123353_10480562 3300010167 Bacteria 1818
389 Ga0123353_10798813 3300010167 Unclassified 1303
390 Ga0123353_12460814 3300010167 Unclassified 621
391 Ga0123354_10291852 3300010882 Bacteria 1561
392 Ga0123354_10649249 3300010882 Unclassified 754
393 Ga0466710_418252 3300042613 Unclassified 1697
394 Ga0466711_222029 3300042615 Bacteria 12497
395 Ga0466711_410435 3300042615 Bacteria 5552
396 Ga0466723_077027 3300042618 Bacteria 10260
397 Ga0466723_277057 3300042618 Unclassified 2686
398 Ga0466726_331300 3300042619 Unclassified 1218
399 Ga0466728_093166 3300042620 Bacteria 80427
400 Ga0466728_152777 3300042620 Unclassified 6956
401 Ga0466728_399272 3300042620 Bacteria 209367
402 Ga0466734_030594 3300042623 Bacteria 22089
403 Ga0466703_059053 3300042636 Bacteria 5617
404 Ga0466703_110878 3300042636 Bacteria 2669
405 Ga0466703_130526 3300042636 Bacteria 5845
406 Ga0466704_207886 3300042643 Bacteria 14092
407 Ga0466709_084610 3300042648 Bacteria 13859
408 Ga0466724_58610 3300042649 Bacteria 376410
409 Ga0160468_100026 3300012819 Bacteria 270033
410 Ga0160445_132553 3300012847 Bacteria 629
411 Ga0160448_120717 3300012854 Bacteria 1070
412 Ga0223678_1001617 3300021222 Bacteria 727
413 Ga0264413_128012 3300024493 Bacteria 7346
414 Ga0265387_1001475 3300024582 Unclassified 3450
415 Ga0265387_1038640 3300024582 Bacteria 809
416 Ga0309902_000009 3300028910 Bacteria 101841
417 Ga0466690_060607 3300042590 Unclassified 2246
418 Ga0466691_087879 3300042593 Bacteria 11574
419 Ga0466696_443545 3300042596 Unclassified 6085
420 Ga0466706_161384 3300042599 Bacteria 41570
421 Ga0466713_082461 3300042602 Bacteria 15773
422 Ga0466714_142977 3300042603 Unclassified 1191
423 Ga0466717_037676 3300042604 Unclassified 2142
424 Ga0466717_245369 3300042604 Bacteria 1741
425 Ga0466716_029249 3300042605 Unclassified 2403
426 Ga0466716_438524 3300042605 Bacteria 7482
427 Ga0466697_091886 3300042611 Unclassified 2996
428 Ga0466705_027153 3300042612 Bacteria 9480
429 Ga0466732_270034 3300042656 Bacteria 4368
430 Ga0466733_130547 3300042659 Unclassified 2918
431 Ga0466733_198403 3300042659 Bacteria 1986
432 Ga0590801_09552 3300060777 Bacteria 673
433 IMNBL1DRAFT_c0015335 3300000062 Bacteria 3328
434 IMNBL1DRAFT_c0020983 3300000062 Unclassified 2627
435 IMNBL1DRAFT_c0026389 3300000062 Unclassified 2206
436 JGI24698J34947_10233572 3300002449 Unclassified 697
437 JGI24702J35022_10676435 3300002462 Unclassified 641
438 JGI24705J35276_11462989 3300002504 Unclassified 545
439 JGI24705J35276_12056153 3300002504 Unclassified 927
440 JGI24705J35276_12084817 3300002504 Bacteria 981
441 JGI24705J35276_12090957 3300002504 Unclassified 995
442 JGI24705J35276_12234366 3300002504 Bacteria 5456
443 JGI24696J40584_12412073 3300002834 Bacteria 559
444 JGI24696J40584_12898656 3300002834 Bacteria 1171
445 CVPL005L_10016436 3300002938 Unclassified 4543
446 Ga0072941_1134067 3300005201 Bacteria 6588
447 Ga0102738_1000072 3300007141 Bacteria 40458
448 Ga0103264_1018684 3300007188 Bacteria 3382
449 Ga0103267_1047061 3300007190 Unclassified 1419
450 Ga0123357_10500578 3300009784 Unclassified 1009
451 Ga0123356_10044970 3300010049 Bacteria 4109
452 Ga0123356_10205204 3300010049 Unclassified 2014
453 Ga0123356_10363065 3300010049 Unclassified 1576
454 Ga0123356_11203735 3300010049 Unclassified 923
455 Ga0123356_13066991 3300010049 Unclassified 583
456 Ga0123353_12962037 3300010167 Unclassified 551
457 Ga0466710_022453 3300042613 Bacteria 25234
458 Ga0466710_044175 3300042613 Unclassified 1145
459 Ga0466712_083617 3300042614 Bacteria 3294
460 Ga0466715_411803 3300042616 Bacteria 24002
461 Ga0466718_028031 3300042617 Bacteria 1252
462 Ga0466723_120151 3300042618 Bacteria 33261
463 Ga0466728_065619 3300042620 Bacteria 98744
464 Ga0466728_207475 3300042620 Bacteria 3653
465 Ga0466728_279048 3300042620 Unclassified 3119
466 Ga0466734_124068 3300042623 Bacteria 1011
467 Ga0466735_031188 3300042624 Unclassified 7063
468 Ga0466703_021762 3300042636 Unclassified 1066
469 Ga0466704_617585 3300042643 Bacteria 11742
470 Ga0466727_001491 3300042655 Bacteria 3382
471 Ga0466727_204171 3300042655 Unclassified 1152
472 Ga0160456_103848 3300012820 Unclassified 2135
473 Ga0160472_100123 3300012839 Bacteria 122373
474 Ga0160447_134475 3300012849 Bacteria 630
475 Ga0157631_111115 3300013007 Bacteria 1276
476 Ga0415639_007901 3300038395 Unclassified 6228
477 Ga0466657_141441 3300042582 Bacteria 1538
478 Ga0466692_091832 3300042591 Bacteria 55079
479 Ga0466691_006564 3300042593 Bacteria 5194
480 Ga0466691_019370 3300042593 Unclassified 7975
481 Ga0466691_096111 3300042593 Bacteria 4137
482 Ga0466691_220517 3300042593 Bacteria 18441
483 Ga0466694_283409 3300042594 Bacteria 2392
484 Ga0466696_092398 3300042596 Bacteria 31103
485 Ga0466700_282045 3300042600 Unclassified 2694
486 Ga0466713_015624 3300042602 Bacteria 9258
487 Ga0466714_017911 3300042603 Bacteria 1491
488 Ga0466714_029945 3300042603 Bacteria 10098
489 Ga0466714_049043 3300042603 Bacteria 1256
490 Ga0466714_089055 3300042603 Bacteria 9374
491 Ga0466717_011477 3300042604 Unclassified 2005
492 Ga0466716_448839 3300042605 Bacteria 1404
493 Ga0466697_051642 3300042611 Bacteria 1408

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00453 Ribosomal_L20 Ribosomal protein L20 3 109 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.