Protein Family IF01154
Metagenome
Isolate
660
Members
335
Samples
400
Scaffolds
391
Avg Length
Representative Sequence
- ID
- 3300005071|Ga0068302_10064484|Ga0068302_100644843
- Length
- 433 aa
- Sequence
- MIPRGVGNKLHRRTVYGEMICTVFKNSFQNGGQAEKEKKMSREVVIVSATRTAVGTYGGTLKDTSAVTLGGIVIKEALARAGVDPQSVDEVLFGNVLQGGLGQNVARQAAIAGGIPKEVPSMTLNKVCGSGLRVVSLAAQIIKAGDADIIVAGGTENMSQAGYVAPKVRWGARMGDTQLIDQMVHDGLTDAFNNYHMGITAENIVEEWKLTREQLDAFAASSQQKAEAAIAGGKFKDEIVPVEIPQRKGDPVVFDTDEFPRAGVTAEGLGKLKPAFKKDGAVTAANASGLNDSAAAVVVMSKEKADELGLTPLVKIVSYASAGVAPEIMGIGPVPASKKALDKAGLKVSDLDLIEANEAFAAQSVAVCQDLGFDPAKVNVNGGAIAIGHPIGASGCRILVTLLYEMKRRDSKYGLATLCIGGGQGTTLVVEK*
Sample Types
Isolate
39.4%
Metagenome
60.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
24.6%
Unclassified
23.4%
Termitidae
9.3%
Elmidae
5.0%
Culicidae
4.4%
Kalotermitidae
4.4%
Curculionidae
4.0%
Formicidae
3.4%
Tenebrionidae
2.5%
Ixodidae
1.6%
Drosophilidae
1.6%
Armadillidiidae
1.6%
Argasidae
1.2%
Muscidae
1.2%
Calliphoridae
1.2%
Termopsidae
1.2%
Cambaridae
0.9%
Rhinotermitidae
0.9%
Cerambycidae
0.6%
Passalidae
0.6%
Tephritidae
0.6%
Anthocoridae
0.6%
Scarabaeidae
0.6%
Siricidae
0.3%
Crambidae
0.3%
Rhopalidae
0.3%
Hydrophilidae
0.3%
Pentatomidae
0.3%
Plutellidae
0.3%
Carabidae
0.3%
Stratiomyidae
0.3%
Gomphidae
0.3%
Thomisidae
0.3%
Hodotermitidae
0.3%
Trigoniulidae
0.3%
Alydidae
0.3%
Euphausiidae
0.3%
Taxonomy
Archaea
0
Bacteria
626
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 2 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 3 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 4 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 5 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 6 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 7 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 8 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 9 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 10 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 11 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 12 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 13 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 14 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 15 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 16 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 17 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 18 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 21 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 22 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 23 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 24 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 25 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 26 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 27 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 28 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 29 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 30 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 31 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 32 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 33 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 34 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 37 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 38 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 39 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 40 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 41 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 42 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 43 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 44 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 45 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 46 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 47 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 48 | 2848878685 | Borrelia miyamotoi CA17-2241 | Isolate | Ixodidae |
| 49 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 50 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 51 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 52 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 53 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 54 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 55 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 56 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 57 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 58 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 59 | 2718218422 | Borrelia miyamotoi CT13-2396 | Isolate | Ixodidae |
| 60 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 61 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 62 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 63 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 64 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 65 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 66 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 69 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 70 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 71 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 72 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 73 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 74 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 75 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 76 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 77 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 78 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 79 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 80 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 81 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 82 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 83 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 84 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 85 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 86 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 87 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 88 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 89 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 90 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 91 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 92 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 93 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 94 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 95 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 96 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 97 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 98 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 99 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 100 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 101 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 102 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 103 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 104 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 105 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 106 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 107 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 108 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 109 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 110 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 111 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 112 | 2565956565 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 113 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 114 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 115 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 116 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 117 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 118 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 119 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 120 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 121 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 122 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 123 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 124 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 125 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 126 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 127 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 128 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 129 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 130 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 131 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 132 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 133 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 134 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 135 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 136 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 137 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 138 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 139 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 140 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 141 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 142 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 143 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 144 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 145 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 146 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 147 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 148 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 149 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 150 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 151 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 152 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 153 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 154 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 155 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 156 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 157 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 158 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 159 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 160 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 161 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 162 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 163 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 164 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 165 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 166 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 167 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 168 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 169 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 170 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 171 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 172 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 173 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 174 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 175 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 176 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 177 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 178 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 179 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 180 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 181 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 182 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 183 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 184 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 185 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 186 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 187 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 188 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 189 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 190 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 191 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 192 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 193 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 194 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 195 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 196 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 197 | 2775507261 | Borrelia turicatae 91E135 | Isolate | Argasidae |
| 198 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 199 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 200 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 201 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 202 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 203 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 204 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 205 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 206 | 3002462131 | Borrelia sp. A-FGy1 | Isolate | Ixodidae |
| 207 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 208 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 209 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 210 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 211 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 212 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 213 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 214 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 215 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 216 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 217 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 218 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 219 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 220 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 221 | 8114010755 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 222 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 223 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 224 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 225 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 226 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 227 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 228 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 229 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 230 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 231 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 232 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 233 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 234 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 235 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 236 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 237 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 238 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 239 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 240 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 241 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 242 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 243 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 244 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 245 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 246 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 247 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 248 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 249 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 250 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 251 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 252 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 253 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 254 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 255 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 256 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 257 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 258 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 259 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 260 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 261 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 262 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 263 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 264 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 265 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 266 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 267 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 268 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 269 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 270 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 271 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 272 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 273 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 274 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 275 | 2545555866 | Borrelia coriaceae ATCC 43381 | Isolate | Argasidae |
| 276 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 277 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 278 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 279 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 280 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 281 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 282 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 283 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 284 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 285 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 286 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 287 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 288 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 289 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 290 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 291 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 292 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 293 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 294 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 295 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 296 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 297 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 298 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 299 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 300 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 301 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 302 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 303 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 304 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 305 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 306 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 307 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 308 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 309 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 310 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 311 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 312 | 2881226535 | Candidatus Borreliella tachyglossi Bc-F10-1268 | Isolate | Ixodidae |
| 313 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 314 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 315 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 316 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 317 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 318 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 319 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 320 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 321 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 322 | 3300005315 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 2 gut | Metagenome | Drosophilidae |
| 323 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 324 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 325 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 326 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 327 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 328 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 329 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 330 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 331 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 332 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 333 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 334 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 335 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_094412 | 3300042612 | Bacteria | 2801 |
| 2 | Ga0466705_141548 | 3300042612 | Bacteria | 3155 |
| 3 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 4 | DPOL_contig08424 | 2035918003 | Unclassified | 11472 |
| 5 | FGTW_contig03371 | 2065487013 | Unclassified | 1797 |
| 6 | FGTW_contig18184 | 2065487013 | Bacteria | 4270 |
| 7 | IMNBL1DRAFT_c0000909 | 3300000062 | Bacteria | 22952 |
| 8 | HBC_ctgsDRAFT_1005019 | 3300000333 | Bacteria | 3084 |
| 9 | Ga0072941_1163470 | 3300005201 | Bacteria | 10328 |
| 10 | Ga0074315_1029229 | 3300005315 | Bacteria | 2416 |
| 11 | Ga0102740_1001205 | 3300007140 | Bacteria | 7550 |
| 12 | Ga0466730_103221 | 3300042625 | Bacteria | 88398 |
| 13 | Ga0466703_039011 | 3300042636 | Bacteria | 1787 |
| 14 | Ga0466703_080703 | 3300042636 | Bacteria | 12657 |
| 15 | Ga0466724_05154 | 3300042649 | Bacteria | 62980 |
| 16 | Ga0466724_08822 | 3300042649 | Bacteria | 22902 |
| 17 | Ga0466724_48954 | 3300042649 | Bacteria | 99638 |
| 18 | Ga0466724_67640 | 3300042649 | Bacteria | 18956 |
| 19 | Ga0466708_087100 | 3300042652 | Bacteria | 8823 |
| 20 | Ga0466708_321438 | 3300042652 | Bacteria | 10541 |
| 21 | Ga0466708_334123 | 3300042652 | Bacteria | 55617 |
| 22 | Ga0466725_413618 | 3300042654 | Bacteria | 2612 |
| 23 | Ga0466727_325195 | 3300042655 | Bacteria | 3574 |
| 24 | Ga0466705_418570 | 3300042612 | Bacteria | 32865 |
| 25 | Ga0466711_043561 | 3300042615 | Bacteria | 18282 |
| 26 | Ga0466711_222219 | 3300042615 | Bacteria | 7528 |
| 27 | Ga0466711_287434 | 3300042615 | Bacteria | 4796 |
| 28 | Ga0466726_472853 | 3300042619 | Bacteria | 6474 |
| 29 | Ga0466706_284941 | 3300042599 | Bacteria | 4541 |
| 30 | Ga0466700_277583 | 3300042600 | Bacteria | 21734 |
| 31 | Ga0466707_084633 | 3300042601 | Bacteria | 11793 |
| 32 | Ga0466713_044186 | 3300042602 | Bacteria | 91853 |
| 33 | Ga0466722_070812 | 3300042609 | Bacteria | 3143 |
| 34 | Ga0123355_10145982 | 3300009826 | Bacteria | 3607 |
| 35 | Ga0123355_10576136 | 3300009826 | Bacteria | 1348 |
| 36 | Ga0123353_10013692 | 3300010167 | Bacteria | 11631 |
| 37 | Ga0123353_10034053 | 3300010167 | Bacteria | 7942 |
| 38 | Ga0160467_100682 | 3300012829 | Bacteria | 25744 |
| 39 | Ga0160446_100107 | 3300012835 | Bacteria | 76250 |
| 40 | Ga0160433_100023 | 3300012846 | Bacteria | 189127 |
| 41 | Ga0160447_109487 | 3300012849 | Bacteria | 2228 |
| 42 | Ga0466690_088845 | 3300042590 | Bacteria | 3146 |
| 43 | Ga0466692_149267 | 3300042591 | Bacteria | 15418 |
| 44 | Ga0466691_067134 | 3300042593 | Bacteria | 8321 |
| 45 | Ga0466696_235173 | 3300042596 | Bacteria | 1334 |
| 46 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 47 | Ga0562379_0255 | 3300056790 | Bacteria | 140685 |
| 48 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 49 | DPO_contig08869 | 2032320009 | Unclassified | 11533 |
| 50 | IMNBL1DRAFT_c0006823 | 3300000062 | Bacteria | 6149 |
| 51 | JGI24705J35276_12234620 | 3300002504 | Unclassified | 5680 |
| 52 | CVPL010L_1000076 | 3300002932 | Bacteria | 58362 |
| 53 | Ga0063521_1000012 | 3300003973 | Bacteria | 168466 |
| 54 | Ga0102738_1003451 | 3300007141 | Bacteria | 2296 |
| 55 | Ga0466729_317290 | 3300042621 | Bacteria | 3803 |
| 56 | Ga0466734_163004 | 3300042623 | Bacteria | 8228 |
| 57 | Ga0466730_000933 | 3300042625 | Bacteria | 11385 |
| 58 | Ga0466703_029093 | 3300042636 | Bacteria | 5492 |
| 59 | Ga0466703_083791 | 3300042636 | Bacteria | 2315 |
| 60 | Ga0466703_098698 | 3300042636 | Bacteria | 8709 |
| 61 | Ga0466703_193117 | 3300042636 | Bacteria | 4977 |
| 62 | Ga0466703_400306 | 3300042636 | Bacteria | 2018 |
| 63 | Ga0466704_396870 | 3300042643 | Unclassified | 3138 |
| 64 | Ga0466704_420608 | 3300042643 | Bacteria | 38946 |
| 65 | Ga0466708_304581 | 3300042652 | Bacteria | 18361 |
| 66 | Ga0466725_023112 | 3300042654 | Bacteria | 48186 |
| 67 | Ga0466725_237207 | 3300042654 | Bacteria | 13204 |
| 68 | Ga0466727_016125 | 3300042655 | Bacteria | 5069 |
| 69 | Ga0466727_147798 | 3300042655 | Bacteria | 20785 |
| 70 | Ga0466727_240498 | 3300042655 | Bacteria | 2341 |
| 71 | Ga0466715_091584 | 3300042616 | Bacteria | 17765 |
| 72 | Ga0466726_477593 | 3300042619 | Bacteria | 8212 |
| 73 | Ga0466729_094923 | 3300042621 | Bacteria | 10202 |
| 74 | Ga0466729_165037 | 3300042621 | Bacteria | 1413 |
| 75 | Ga0466701_044500 | 3300042598 | Bacteria | 25528 |
| 76 | Ga0466707_061535 | 3300042601 | Unclassified | 2284 |
| 77 | Ga0466707_229841 | 3300042601 | Bacteria | 40348 |
| 78 | Ga0466707_258653 | 3300042601 | Bacteria | 2458 |
| 79 | Ga0466707_263736 | 3300042601 | Bacteria | 90817 |
| 80 | Ga0466707_328934 | 3300042601 | Bacteria | 13026 |
| 81 | Ga0466707_409147 | 3300042601 | Bacteria | 3905 |
| 82 | Ga0466713_142248 | 3300042602 | Bacteria | 5189 |
| 83 | Ga0466717_193898 | 3300042604 | Bacteria | 6412 |
| 84 | Ga0466719_147601 | 3300042606 | Bacteria | 2578 |
| 85 | Ga0466719_225057 | 3300042606 | Bacteria | 11880 |
| 86 | Ga0466722_189243 | 3300042609 | Bacteria | 4605 |
| 87 | Ga0123353_10083604 | 3300010167 | Bacteria | 5137 |
| 88 | Ga0123353_10095544 | 3300010167 | Bacteria | 4788 |
| 89 | Ga0160466_100403 | 3300012809 | Bacteria | 24023 |
| 90 | Ga0160471_100010 | 3300012812 | Bacteria | 479061 |
| 91 | Ga0160471_100241 | 3300012812 | Bacteria | 18719 |
| 92 | Ga0160432_100420 | 3300012818 | Bacteria | 29461 |
| 93 | Ga0160433_100357 | 3300012846 | Bacteria | 26972 |
| 94 | Ga0160447_101772 | 3300012849 | Bacteria | 8095 |
| 95 | Ga0160447_101882 | 3300012849 | Bacteria | 7795 |
| 96 | Ga0160436_1002551 | 3300012861 | Bacteria | 4598 |
| 97 | Ga0247289_0154 | 3300035363 | Bacteria | 17547 |
| 98 | Ga0415639_141097 | 3300038395 | Bacteria | 2574 |
| 99 | Ga0466656_261784 | 3300042550 | Bacteria | 2775 |
| 100 | Ga0466692_082938 | 3300042591 | Bacteria | 40592 |
| 101 | Ga0466692_100990 | 3300042591 | Bacteria | 5529 |
| 102 | Ga0466693_318479 | 3300042592 | Bacteria | 2693 |
| 103 | Ga0466697_065893 | 3300042611 | Bacteria | 2624 |
| 104 | Ga0466705_101556 | 3300042612 | Bacteria | 14881 |
| 105 | Ga0562378_0316 | 3300056814 | Bacteria | 99291 |
| 106 | Ga0562374_0350 | 3300057007 | Unclassified | 85859 |
| 107 | CVPL010W_10002461 | 3300002931 | Bacteria | 49114 |
| 108 | Ga0466734_030973 | 3300042623 | Bacteria | 8502 |
| 109 | Ga0466734_057207 | 3300042623 | Bacteria | 1606 |
| 110 | Ga0466735_130053 | 3300042624 | Bacteria | 5694 |
| 111 | Ga0466730_038558 | 3300042625 | Bacteria | 566435 |
| 112 | Ga0466703_313997 | 3300042636 | Bacteria | 3237 |
| 113 | Ga0466704_042758 | 3300042643 | Bacteria | 3806 |
| 114 | Ga0466704_050705 | 3300042643 | Bacteria | 60540 |
| 115 | Ga0466724_58595 | 3300042649 | Bacteria | 137649 |
| 116 | Ga0466708_355351 | 3300042652 | Bacteria | 19169 |
| 117 | Ga0466711_226202 | 3300042615 | Bacteria | 2843 |
| 118 | Ga0466711_342379 | 3300042615 | Bacteria | 5573 |
| 119 | Ga0466715_045696 | 3300042616 | Bacteria | 28220 |
| 120 | Ga0466715_151863 | 3300042616 | Bacteria | 14009 |
| 121 | Ga0466726_036695 | 3300042619 | Bacteria | 2182 |
| 122 | Ga0466726_305044 | 3300042619 | Bacteria | 2561 |
| 123 | Ga0466726_404360 | 3300042619 | Bacteria | 5474 |
| 124 | Ga0466728_142409 | 3300042620 | Bacteria | 22134 |
| 125 | Ga0466707_033862 | 3300042601 | Bacteria | 8744 |
| 126 | Ga0466707_334795 | 3300042601 | Bacteria | 6579 |
| 127 | Ga0466713_117968 | 3300042602 | Bacteria | 408806 |
| 128 | Ga0466713_138693 | 3300042602 | Bacteria | 2045 |
| 129 | Ga0123357_10024313 | 3300009784 | Bacteria | 8153 |
| 130 | Ga0123355_10000231 | 3300009826 | Bacteria | 71111 |
| 131 | Ga0123355_10008344 | 3300009826 | Bacteria | 15662 |
| 132 | Ga0123355_10097506 | 3300009826 | Bacteria | 4639 |
| 133 | Ga0123355_10301286 | 3300009826 | Bacteria | 2185 |
| 134 | Ga0123356_10012563 | 3300010049 | Bacteria | 8212 |
| 135 | Ga0123356_10031266 | 3300010049 | Bacteria | 4982 |
| 136 | Ga0123353_10054141 | 3300010167 | Bacteria | 6415 |
| 137 | Ga0123354_10138993 | 3300010882 | Unclassified | 3018 |
| 138 | Ga0160466_100239 | 3300012809 | Bacteria | 37706 |
| 139 | Ga0160444_100548 | 3300012841 | Bacteria | 14741 |
| 140 | Ga0160433_100006 | 3300012846 | Bacteria | 359584 |
| 141 | Ga0160445_101414 | 3300012847 | Unclassified | 6886 |
| 142 | Ga0415639_171985 | 3300038395 | Bacteria | 1670 |
| 143 | Ga0466657_389974 | 3300042582 | Bacteria | 1751 |
| 144 | Ga0466690_387388 | 3300042590 | Bacteria | 1717 |
| 145 | Ga0466692_149264 | 3300042591 | Bacteria | 2254 |
| 146 | Ga0466696_303383 | 3300042596 | Unclassified | 3717 |
| 147 | Ga0466696_500373 | 3300042596 | Bacteria | 2528 |
| 148 | Ga0466701_005914 | 3300042598 | Bacteria | 55661 |
| 149 | Ga0466705_287935 | 3300042612 | Bacteria | 50109 |
| 150 | Ga0466733_196545 | 3300042659 | Bacteria | 2227 |
| 151 | Ga0530661_000097 | 3300056564 | Bacteria | 82157 |
| 152 | FGTW_contig30955 | 2065487013 | Unclassified | 3870 |
| 153 | FGTW_contig31430 | 2065487013 | Unclassified | 4370 |
| 154 | gam1t_NODE_426675_length=5610_GC=34_3_Contigs=1 | 2189573031 | Unclassified | 5610 |
| 155 | IMNBL1DRAFT_c0001018 | 3300000062 | Bacteria | 21663 |
| 156 | Ga0072940_1005619 | 3300005200 | Bacteria | 22448 |
| 157 | Ga0103260_1001107 | 3300007139 | Bacteria | 4920 |
| 158 | Ga0466729_247004 | 3300042621 | Bacteria | 1883 |
| 159 | Ga0466731_215589 | 3300042622 | Bacteria | 2285 |
| 160 | Ga0466730_001217 | 3300042625 | Unclassified | 2525 |
| 161 | Ga0466730_079264 | 3300042625 | Bacteria | 2903 |
| 162 | Ga0466703_233185 | 3300042636 | Bacteria | 3954 |
| 163 | Ga0466703_355013 | 3300042636 | Bacteria | 6267 |
| 164 | Ga0466704_129909 | 3300042643 | Bacteria | 3040 |
| 165 | Ga0466708_393856 | 3300042652 | Bacteria | 96483 |
| 166 | Ga0466725_070186 | 3300042654 | Bacteria | 19309 |
| 167 | Ga0466705_403011 | 3300042612 | Bacteria | 2531 |
| 168 | Ga0466705_447122 | 3300042612 | Bacteria | 2077 |
| 169 | Ga0466705_492159 | 3300042612 | Bacteria | 18817 |
| 170 | Ga0466723_053236 | 3300042618 | Bacteria | 7502 |
| 171 | Ga0466723_085677 | 3300042618 | Bacteria | 4799 |
| 172 | Ga0466726_177150 | 3300042619 | Bacteria | 13566 |
| 173 | Ga0466729_147795 | 3300042621 | Bacteria | 3154 |
| 174 | Ga0466707_105269 | 3300042601 | Bacteria | 5015 |
| 175 | Ga0466707_174564 | 3300042601 | Bacteria | 5721 |
| 176 | Ga0466707_263928 | 3300042601 | Bacteria | 68163 |
| 177 | Ga0466719_146236 | 3300042606 | Bacteria | 6901 |
| 178 | Ga0123357_10061097 | 3300009784 | Bacteria | 5051 |
| 179 | Ga0123355_10002528 | 3300009826 | Bacteria | 25906 |
| 180 | Ga0123355_10136605 | 3300009826 | Bacteria | 3764 |
| 181 | Ga0123355_10214727 | 3300009826 | Bacteria | 2780 |
| 182 | Ga0123356_10238930 | 3300010049 | Bacteria | 1886 |
| 183 | Ga0123353_10168274 | 3300010167 | Bacteria | 3481 |
| 184 | Ga0160467_101357 | 3300012829 | Bacteria | 10085 |
| 185 | Ga0160455_100006 | 3300012837 | Bacteria | 631412 |
| 186 | Ga0160460_102875 | 3300012845 | Unclassified | 3451 |
| 187 | Ga0160433_102537 | 3300012846 | Bacteria | 3846 |
| 188 | Ga0160445_100298 | 3300012847 | Bacteria | 31023 |
| 189 | Ga0160448_106036 | 3300012854 | Unclassified | 3079 |
| 190 | Ga0415639_208168 | 3300038395 | Bacteria | 1989 |
| 191 | Ga0466690_144493 | 3300042590 | Bacteria | 2714 |
| 192 | Ga0466690_337544 | 3300042590 | Bacteria | 2908 |
| 193 | Ga0466691_216528 | 3300042593 | Bacteria | 2705 |
| 194 | Ga0466696_505241 | 3300042596 | Bacteria | 13190 |
| 195 | Ga0562379_0697 | 3300056790 | Unclassified | 56937 |
| 196 | Ga0562376_0034 | 3300056857 | Unclassified | 349238 |
| 197 | Ga0562374_2516 | 3300057007 | Bacteria | 15599 |
| 198 | SWWA_contig00946__length_53450___numreads_2577 | 2100351016 | Bacteria | 53450 |
| 199 | SCG598I22_12464 | 3300000462 | Bacteria | 16251 |
| 200 | Ga0102736_1000258 | 3300007052 | Bacteria | 11818 |
| 201 | Ga0104041_1000577 | 3300007106 | Bacteria | 3259 |
| 202 | Ga0102737_1003375 | 3300007142 | Unclassified | 4196 |
| 203 | Ga0466730_067308 | 3300042625 | Unclassified | 3138 |
| 204 | Ga0466703_039529 | 3300042636 | Bacteria | 19304 |
| 205 | Ga0466704_383021 | 3300042643 | Unclassified | 23707 |
| 206 | Ga0466724_22329 | 3300042649 | Bacteria | 153198 |
| 207 | Ga0466724_68833 | 3300042649 | Bacteria | 26543 |
| 208 | Ga0466711_005794 | 3300042615 | Bacteria | 4398 |
| 209 | Ga0466715_379483 | 3300042616 | Bacteria | 7548 |
| 210 | Ga0466715_403106 | 3300042616 | Bacteria | 9679 |
| 211 | Ga0466726_024627 | 3300042619 | Bacteria | 2233 |
| 212 | Ga0466728_097662 | 3300042620 | Bacteria | 15221 |
| 213 | Ga0466701_019405 | 3300042598 | Bacteria | 47076 |
| 214 | Ga0466700_342131 | 3300042600 | Bacteria | 1678 |
| 215 | Ga0466707_002362 | 3300042601 | Bacteria | 1399 |
| 216 | Ga0466707_083973 | 3300042601 | Bacteria | 2809 |
| 217 | Ga0466713_070513 | 3300042602 | Bacteria | 2172 |
| 218 | Ga0466719_010770 | 3300042606 | Bacteria | 16502 |
| 219 | Ga0466719_069979 | 3300042606 | Bacteria | 15553 |
| 220 | Ga0466719_505713 | 3300042606 | Bacteria | 1738 |
| 221 | Ga0466722_066611 | 3300042609 | Bacteria | 6610 |
| 222 | Ga0466722_103004 | 3300042609 | Bacteria | 3799 |
| 223 | Ga0123355_10029299 | 3300009826 | Bacteria | 8908 |
| 224 | Ga0123355_10201643 | 3300009826 | Bacteria | 2904 |
| 225 | Ga0123355_10308569 | 3300009826 | Bacteria | 2148 |
| 226 | Ga0123355_10499371 | 3300009826 | Bacteria | 1502 |
| 227 | Ga0123355_10535720 | 3300009826 | Bacteria | 1424 |
| 228 | Ga0123353_10000580 | 3300010167 | Bacteria | 44761 |
| 229 | Ga0123353_10411692 | 3300010167 | Bacteria | 2007 |
| 230 | Ga0160465_100205 | 3300012803 | Bacteria | 46995 |
| 231 | Ga0160465_106185 | 3300012803 | Bacteria | 1410 |
| 232 | Ga0160470_100002 | 3300012813 | Bacteria | 1115787 |
| 233 | Ga0160459_100530 | 3300012831 | Bacteria | 14289 |
| 234 | Ga0160458_100111 | 3300012832 | Bacteria | 83300 |
| 235 | Ga0160445_100050 | 3300012847 | Bacteria | 140514 |
| 236 | Ga0160430_104733 | 3300012852 | Bacteria | 3298 |
| 237 | Ga0466692_100731 | 3300042591 | Bacteria | 9707 |
| 238 | Ga0466692_152893 | 3300042591 | Bacteria | 110459 |
| 239 | Ga0466691_192145 | 3300042593 | Bacteria | 8098 |
| 240 | Ga0466705_160968 | 3300042612 | Unclassified | 1704 |
| 241 | Ga0466705_248336 | 3300042612 | Bacteria | 4355 |
| 242 | gam1t_NODE_23620_length=19122_GC=30_6_Contigs=7 | 2189573031 | Unclassified | 19182 |
| 243 | gam1t_NODE_270540_length=48566_GC=35_7_Contigs=1 | 2189573031 | Bacteria | 48566 |
| 244 | 2227444695 | 2225789004 | Bacteria | 5466 |
| 245 | SCG598O02_12427 | 3300000460 | Bacteria | 45474 |
| 246 | JGI24700J35501_10930917 | 3300002508 | Bacteria | 45149 |
| 247 | Ga0072941_1106747 | 3300005201 | Bacteria | 5179 |
| 248 | Ga0105005_1017512 | 3300007505 | Bacteria | 1961 |
| 249 | Ga0466730_047937 | 3300042625 | Bacteria | 3333 |
| 250 | Ga0466730_065573 | 3300042625 | Bacteria | 6999 |
| 251 | Ga0466703_079815 | 3300042636 | Bacteria | 3744 |
| 252 | Ga0466704_050426 | 3300042643 | Unclassified | 4259 |
| 253 | Ga0466709_388336 | 3300042648 | Bacteria | 45057 |
| 254 | Ga0466724_52018 | 3300042649 | Bacteria | 48709 |
| 255 | Ga0466708_019552 | 3300042652 | Bacteria | 13196 |
| 256 | Ga0466708_293264 | 3300042652 | Unclassified | 8564 |
| 257 | Ga0466708_397660 | 3300042652 | Bacteria | 18004 |
| 258 | Ga0466708_428046 | 3300042652 | Bacteria | 8224 |
| 259 | Ga0466705_409523 | 3300042612 | Bacteria | 2488 |
| 260 | Ga0466705_497809 | 3300042612 | Bacteria | 11359 |
| 261 | Ga0466705_520350 | 3300042612 | Bacteria | 2893 |
| 262 | Ga0466715_618207 | 3300042616 | Bacteria | 66197 |
| 263 | Ga0466723_138753 | 3300042618 | Bacteria | 3013 |
| 264 | Ga0466723_140313 | 3300042618 | Bacteria | 61055 |
| 265 | Ga0466723_305777 | 3300042618 | Bacteria | 5739 |
| 266 | Ga0466726_402616 | 3300042619 | Bacteria | 6983 |
| 267 | Ga0466707_004272 | 3300042601 | Bacteria | 5162 |
| 268 | Ga0466707_014389 | 3300042601 | Bacteria | 75654 |
| 269 | Ga0466713_038968 | 3300042602 | Bacteria | 11884 |
| 270 | Ga0466713_143957 | 3300042602 | Bacteria | 200019 |
| 271 | Ga0466716_306677 | 3300042605 | Bacteria | 3393 |
| 272 | Ga0466716_381806 | 3300042605 | Bacteria | 3919 |
| 273 | Ga0466719_321226 | 3300042606 | Bacteria | 3886 |
| 274 | Ga0466719_490931 | 3300042606 | Unclassified | 14760 |
| 275 | Ga0123355_10001386 | 3300009826 | Bacteria | 33785 |
| 276 | Ga0123355_10001786 | 3300009826 | Bacteria | 30152 |
| 277 | Ga0123355_10046320 | 3300009826 | Bacteria | 7073 |
| 278 | Ga0123355_10063194 | 3300009826 | Bacteria | 5971 |
| 279 | Ga0123353_10000260 | 3300010167 | Bacteria | 66938 |
| 280 | Ga0123353_10062186 | 3300010167 | Bacteria | 5988 |
| 281 | Ga0123353_10139889 | 3300010167 | Bacteria | 3878 |
| 282 | Ga0123353_10535209 | 3300010167 | Bacteria | 1695 |
| 283 | Ga0123354_10134717 | 3300010882 | Bacteria | 3096 |
| 284 | Ga0160470_101522 | 3300012813 | Unclassified | 5444 |
| 285 | Ga0160444_100092 | 3300012841 | Bacteria | 112857 |
| 286 | Ga0160444_104646 | 3300012841 | Bacteria | 1864 |
| 287 | Ga0160433_100045 | 3300012846 | Bacteria | 138664 |
| 288 | Ga0160447_103861 | 3300012849 | Unclassified | 4634 |
| 289 | Ga0264413_151019 | 3300024493 | Bacteria | 2577 |
| 290 | Ga0415639_152525 | 3300038395 | Bacteria | 1319 |
| 291 | Ga0466691_101247 | 3300042593 | Bacteria | 19348 |
| 292 | Ga0466694_128541 | 3300042594 | Bacteria | 1373 |
| 293 | Ga0466696_411041 | 3300042596 | Bacteria | 5739 |
| 294 | Ga0466705_217166 | 3300042612 | Bacteria | 1424 |
| 295 | Ga0466733_179369 | 3300042659 | Bacteria | 5515 |
| 296 | Ga0562379_0023 | 3300056790 | Bacteria | 882969 |
| 297 | Ga0562377_0005 | 3300056842 | Bacteria | 3519381 |
| 298 | DPO_contig01463 | 2032320009 | Bacteria | 11840 |
| 299 | DPOL_contig17044 | 2035918003 | Bacteria | 19735 |
| 300 | SPBB_contig00978 | 2044078006 | Bacteria | 221403 |
| 301 | SPBB_contig11566 | 2044078006 | Bacteria | 37707 |
| 302 | gam1t_NODE_212519_length=10701_GC=39_7_Contigs=1 | 2189573031 | Bacteria | 10701 |
| 303 | SCG598P14_112503 | 3300000479 | Bacteria | 101232 |
| 304 | Ga0074278_105790 | 3300005721 | Bacteria | 48566 |
| 305 | Ga0074278_154674 | 3300005721 | Unclassified | 5610 |
| 306 | Ga0103266_1000164 | 3300007067 | Bacteria | 19908 |
| 307 | Ga0103261_1003752 | 3300007083 | Bacteria | 2335 |
| 308 | Ga0466730_065485 | 3300042625 | Unclassified | 3849 |
| 309 | Ga0466703_023202 | 3300042636 | Bacteria | 12893 |
| 310 | Ga0466704_028320 | 3300042643 | Bacteria | 20609 |
| 311 | Ga0466725_025947 | 3300042654 | Bacteria | 6112 |
| 312 | Ga0466727_049398 | 3300042655 | Bacteria | 2103 |
| 313 | Ga0466712_070211 | 3300042614 | Bacteria | 14227 |
| 314 | Ga0466711_147120 | 3300042615 | Bacteria | 19147 |
| 315 | Ga0466711_168060 | 3300042615 | Bacteria | 9509 |
| 316 | Ga0466715_126384 | 3300042616 | Bacteria | 3039 |
| 317 | Ga0466715_409656 | 3300042616 | Bacteria | 4352 |
| 318 | Ga0466723_143972 | 3300042618 | Bacteria | 11229 |
| 319 | Ga0466728_041732 | 3300042620 | Bacteria | 4890 |
| 320 | Ga0466701_087199 | 3300042598 | Bacteria | 101525 |
| 321 | Ga0466707_122188 | 3300042601 | Bacteria | 3865 |
| 322 | Ga0466707_216371 | 3300042601 | Bacteria | 2583 |
| 323 | Ga0466719_152758 | 3300042606 | Bacteria | 4005 |
| 324 | Ga0466719_376028 | 3300042606 | Bacteria | 2605 |
| 325 | Ga0466722_039127 | 3300042609 | Bacteria | 1908 |
| 326 | Ga0123355_10001292 | 3300009826 | Bacteria | 34932 |
| 327 | Ga0123355_10125009 | 3300009826 | Bacteria | 3977 |
| 328 | Ga0123356_10141873 | 3300010049 | Bacteria | 2371 |
| 329 | Ga0123356_10245440 | 3300010049 | Unclassified | 1865 |
| 330 | Ga0123356_10441938 | 3300010049 | Bacteria | 1447 |
| 331 | Ga0123353_10017479 | 3300010167 | Bacteria | 10545 |
| 332 | Ga0123353_10048067 | 3300010167 | Bacteria | 6791 |
| 333 | Ga0123353_10148836 | 3300010167 | Bacteria | 3740 |
| 334 | Ga0123354_10187303 | 3300010882 | Bacteria | 2334 |
| 335 | Ga0160458_100892 | 3300012832 | Bacteria | 8089 |
| 336 | Ga0160435_1007801 | 3300012857 | Bacteria | 2324 |
| 337 | Ga0466657_034756 | 3300042582 | Bacteria | 2799 |
| 338 | Ga0466657_216185 | 3300042582 | Bacteria | 22362 |
| 339 | Ga0466692_115206 | 3300042591 | Bacteria | 8018 |
| 340 | Ga0466693_135270 | 3300042592 | Bacteria | 1851 |
| 341 | Ga0466693_185803 | 3300042592 | Bacteria | 1593 |
| 342 | Ga0466705_023284 | 3300042612 | Bacteria | 17070 |
| 343 | Ga0466705_111374 | 3300042612 | Bacteria | 3669 |
| 344 | Ga0562375_0011 | 3300056856 | Bacteria | 1302371 |
| 345 | Ga0562376_0370 | 3300056857 | Unclassified | 85806 |
| 346 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 347 | JGI24702J35022_10042530 | 3300002462 | Bacteria | 2419 |
| 348 | JGI24705J35276_12236870 | 3300002504 | Bacteria | 9138 |
| 349 | CVPL010L_1000090 | 3300002932 | Bacteria | 56201 |
| 350 | Ga0063521_1000309 | 3300003973 | Bacteria | 29845 |
| 351 | Ga0068302_10064484 | 3300005071 | Bacteria | 3764 |
| 352 | Ga0103264_1003573 | 3300007188 | Bacteria | 7638 |
| 353 | Ga0466729_273184 | 3300042621 | Bacteria | 1318 |
| 354 | Ga0466730_004769 | 3300042625 | Bacteria | 209482 |
| 355 | Ga0466730_067179 | 3300042625 | Bacteria | 3550 |
| 356 | Ga0466730_090977 | 3300042625 | Bacteria | 5960 |
| 357 | Ga0466730_095797 | 3300042625 | Bacteria | 4536 |
| 358 | Ga0466702_310756 | 3300042635 | Bacteria | 2957 |
| 359 | Ga0466703_018916 | 3300042636 | Bacteria | 1923 |
| 360 | Ga0466703_178256 | 3300042636 | Bacteria | 1672 |
| 361 | Ga0466703_279082 | 3300042636 | Bacteria | 2822 |
| 362 | Ga0466704_042731 | 3300042643 | Bacteria | 3894 |
| 363 | Ga0466704_199734 | 3300042643 | Bacteria | 11503 |
| 364 | Ga0466724_09404 | 3300042649 | Bacteria | 18405 |
| 365 | Ga0466708_142300 | 3300042652 | Bacteria | 3655 |
| 366 | Ga0466725_130787 | 3300042654 | Bacteria | 4130 |
| 367 | Ga0466725_366787 | 3300042654 | Bacteria | 11273 |
| 368 | Ga0466727_002090 | 3300042655 | Bacteria | 2839 |
| 369 | Ga0466711_421405 | 3300042615 | Bacteria | 23871 |
| 370 | Ga0466715_246552 | 3300042616 | Bacteria | 4070 |
| 371 | Ga0466715_551404 | 3300042616 | Bacteria | 1936 |
| 372 | Ga0466718_046931 | 3300042617 | Bacteria | 6914 |
| 373 | Ga0466718_130587 | 3300042617 | Bacteria | 1413 |
| 374 | Ga0466723_282192 | 3300042618 | Bacteria | 2512 |
| 375 | Ga0466726_018216 | 3300042619 | Bacteria | 9259 |
| 376 | Ga0466726_228905 | 3300042619 | Bacteria | 2696 |
| 377 | Ga0466701_102473 | 3300042598 | Bacteria | 8057 |
| 378 | Ga0466706_150017 | 3300042599 | Bacteria | 13625 |
| 379 | Ga0466707_088031 | 3300042601 | Bacteria | 2115 |
| 380 | Ga0466707_162748 | 3300042601 | Bacteria | 100519 |
| 381 | Ga0466719_069137 | 3300042606 | Bacteria | 5109 |
| 382 | Ga0466719_248701 | 3300042606 | Bacteria | 16648 |
| 383 | Ga0123355_10007355 | 3300009826 | Bacteria | 16492 |
| 384 | Ga0123355_10009264 | 3300009826 | Bacteria | 14949 |
| 385 | Ga0123355_10255162 | 3300009826 | Bacteria | 2462 |
| 386 | Ga0123356_10030905 | 3300010049 | Bacteria | 5011 |
| 387 | Ga0123356_10157438 | 3300010049 | Bacteria | 2264 |
| 388 | Ga0160452_100538 | 3300012834 | Bacteria | 23057 |
| 389 | Ga0160435_1000324 | 3300012857 | Unclassified | 19875 |
| 390 | Ga0160436_1002748 | 3300012861 | Unclassified | 4393 |
| 391 | Ga0265387_1000061 | 3300024582 | Bacteria | 33693 |
| 392 | Ga0265387_1000105 | 3300024582 | Bacteria | 19550 |
| 393 | Ga0247289_0310 | 3300035363 | Bacteria | 8515 |
| 394 | Ga0415639_081778 | 3300038395 | Bacteria | 4765 |
| 395 | Ga0466691_027982 | 3300042593 | Bacteria | 19416 |
| 396 | Ga0466691_110492 | 3300042593 | Bacteria | 6118 |
| 397 | Ga0466691_116582 | 3300042593 | Bacteria | 15504 |
| 398 | Ga0466696_183819 | 3300042596 | Bacteria | 20524 |
| 399 | Ga0466696_337053 | 3300042596 | Bacteria | 4007 |
| 400 | Ga0466696_471169 | 3300042596 | Bacteria | 3898 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02803 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.