Protein Family IF10890
Metagenome
Isolate
402
Members
311
Samples
183
Scaffolds
107.81
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2528768159|2529056978|
- Length
- 116 aa
- Sequence
- VSVETFSIDQVVSVTPAAAEHFQRQLDKKQASAIRISLKESGCTGFMYVIDEVEAGEAEDVLITLGNSVTLYVDTKHLSAIQGTVVDYVTQGLNKNLVLNNPNVKDACGCGESFSV
Sample Types
Isolate
54.5%
Metagenome
45.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
28.2%
Coreidae
15.0%
Unclassified
12.3%
Termitidae
7.6%
Drosophilidae
5.6%
Anthocoridae
4.3%
Kalotermitidae
4.3%
Formicidae
3.7%
Culicidae
3.3%
Elmidae
3.0%
Curculionidae
2.3%
Termopsidae
1.3%
Armadillidiidae
1.0%
Rhinotermitidae
1.0%
Passalidae
1.0%
Cerambycidae
1.0%
Largidae
0.7%
Pteromalidae
0.7%
Aphididae
0.7%
Scarabaeidae
0.3%
Siricidae
0.3%
Hydrophilidae
0.3%
Gryllidae
0.3%
Alydidae
0.3%
Crambidae
0.3%
Tenebrionidae
0.3%
Daphniidae
0.3%
Aleyrodidae
0.3%
Taxonomy
Archaea
0
Bacteria
379
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 2 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 3 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 4 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 5 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 6 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 7 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 8 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 9 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 10 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 11 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 12 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 13 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 14 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 15 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 16 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 17 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 18 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 19 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 20 | 2958255616 | Serratia marcescens TM | Isolate | |
| 21 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 22 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 25 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 26 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 27 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 30 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 31 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 32 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 33 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 34 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 35 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 36 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 37 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 38 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 47 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 48 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 49 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 50 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 51 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 52 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 53 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 54 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 55 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 56 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 57 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 58 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 59 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 60 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 61 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 62 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 63 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 64 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 65 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 66 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 67 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 68 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 69 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 70 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 71 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 72 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 73 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 74 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 75 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 76 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 77 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 78 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 79 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 80 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 81 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 82 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 85 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 86 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 87 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 88 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 89 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 90 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 91 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 92 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 93 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 94 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 95 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 96 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 97 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 98 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 99 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 100 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 101 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 102 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 103 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 104 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 105 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 106 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 107 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 108 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 109 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 110 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 111 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 112 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 113 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 114 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 115 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 116 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 117 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 118 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 119 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 120 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 121 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 122 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 123 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 124 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 125 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 126 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 127 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 128 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 129 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 130 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 131 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 132 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 133 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 134 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 135 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 136 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 137 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 138 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 139 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 140 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 141 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 142 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 143 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 144 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 145 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 146 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 147 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 148 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 149 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 150 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 151 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 152 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 153 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 154 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 155 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 156 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 157 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 158 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 159 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 160 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 161 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 162 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 163 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 164 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 165 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 166 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 167 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 168 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 169 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 170 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 171 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 172 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 173 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 174 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 175 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 176 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 177 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 178 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 179 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 180 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 181 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 182 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 183 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 184 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 185 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 186 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 187 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 188 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 189 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 190 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 191 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 192 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 193 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 194 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 195 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 196 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 197 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 198 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 199 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 200 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 201 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 202 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 203 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 204 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 205 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 206 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 207 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 208 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 209 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 210 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 211 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 212 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 213 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 214 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 215 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 216 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 217 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 218 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 219 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 220 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 221 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 222 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 223 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 224 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 225 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 226 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 227 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 228 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 229 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 230 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 231 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 232 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 233 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 234 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 235 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 236 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 237 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 238 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 239 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 240 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 241 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 242 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 243 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 244 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 245 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 246 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 247 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 248 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 249 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 250 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 251 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 252 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 253 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 254 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 255 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 256 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 257 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 258 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 259 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 260 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 261 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 262 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 263 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 264 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 265 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 266 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 267 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 268 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 269 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 270 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 271 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 272 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 273 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 274 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 275 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 276 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 277 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 278 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 279 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 280 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 281 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 282 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 283 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 284 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 285 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 286 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 287 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 288 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 289 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 290 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 291 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 292 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 293 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 294 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 295 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 296 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 297 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 298 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 299 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 300 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 301 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 302 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 303 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 304 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 305 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 306 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 307 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 308 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 309 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 310 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 311 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBGM34_c000160 | 3300000036 | Bacteria | 19919 |
| 2 | SCG598B02_13230 | 3300000472 | Bacteria | 22295 |
| 3 | JGI24705J35276_11896467 | 3300002504 | Unclassified | 748 |
| 4 | Ga0063521_1000022 | 3300003973 | Bacteria | 133586 |
| 5 | Ga0063521_1000226 | 3300003973 | Bacteria | 39609 |
| 6 | Ga0074278_119410 | 3300005721 | Bacteria | 7251 |
| 7 | Ga0104040_1154023 | 3300007149 | Bacteria | 1064 |
| 8 | Ga0160435_1007728 | 3300012857 | Bacteria | 2336 |
| 9 | Ga0466657_298882 | 3300042582 | Bacteria | 2126 |
| 10 | Ga0466692_164140 | 3300042591 | Bacteria | 27972 |
| 11 | Ga0466695_085108 | 3300042595 | Bacteria | 4932 |
| 12 | Ga0123357_10013022 | 3300009784 | Bacteria | 10757 |
| 13 | Ga0123353_10424719 | 3300010167 | Bacteria | 1968 |
| 14 | Ga0466717_199535 | 3300042604 | Bacteria | 1609 |
| 15 | Ga0466722_125017 | 3300042609 | Bacteria | 8332 |
| 16 | Ga0466710_216779 | 3300042613 | Bacteria | 69189 |
| 17 | Ga0466715_090204 | 3300042616 | Bacteria | 2452 |
| 18 | Ga0466723_191382 | 3300042618 | Bacteria | 5080 |
| 19 | Ga0466709_149475 | 3300042648 | Bacteria | 22351 |
| 20 | Ga0466709_292068 | 3300042648 | Bacteria | 4363 |
| 21 | Ga0466724_00951 | 3300042649 | Unclassified | 13465 |
| 22 | Ga0466724_67524 | 3300042649 | Unclassified | 3240 |
| 23 | Ga0466727_264624 | 3300042655 | Unclassified | 1817 |
| 24 | gam1t_NODE_706302_length=8047_GC=34_4_Contigs=7 | 2189573031 | Unclassified | 8107 |
| 25 | JGI24696J40584_12865312 | 3300002834 | Bacteria | 1026 |
| 26 | CVPL005L_10029503 | 3300002938 | Bacteria | 1910 |
| 27 | Ga0104042_1000299 | 3300007130 | Bacteria | 6271 |
| 28 | Ga0103264_1000608 | 3300007188 | Bacteria | 21307 |
| 29 | Ga0105005_1021223 | 3300007505 | Bacteria | 3076 |
| 30 | Ga0160467_100306 | 3300012829 | Bacteria | 56222 |
| 31 | Ga0160455_107487 | 3300012837 | Bacteria | 1064 |
| 32 | Ga0160472_107709 | 3300012839 | Unclassified | 1495 |
| 33 | Ga0466657_056541 | 3300042582 | Bacteria | 144917 |
| 34 | Ga0466657_347985 | 3300042582 | Bacteria | 2007 |
| 35 | Ga0123356_10057624 | 3300010049 | Bacteria | 3621 |
| 36 | Ga0466705_425848 | 3300042612 | Bacteria | 3541 |
| 37 | Ga0466711_271943 | 3300042615 | Bacteria | 42179 |
| 38 | Ga0466715_104379 | 3300042616 | Bacteria | 2066 |
| 39 | Ga0466726_163499 | 3300042619 | Bacteria | 5816 |
| 40 | Ga0466726_265652 | 3300042619 | Bacteria | 10922 |
| 41 | Ga0466734_046476 | 3300042623 | Bacteria | 5741 |
| 42 | Ga0466734_064326 | 3300042623 | Bacteria | 27618 |
| 43 | Ga0466735_082032 | 3300042624 | Unclassified | 1095 |
| 44 | Ga0466724_22286 | 3300042649 | Bacteria | 91157 |
| 45 | AglaG_GDN60OX02H6E3Q | 2084038013 | Bacteria | 514 |
| 46 | SWWA_contig31715__length_13211___numreads_921 | 2100351016 | Bacteria | 13211 |
| 47 | HBC_ctgsDRAFT_1024605 | 3300000333 | Bacteria | 1476 |
| 48 | JGI24705J35276_12230362 | 3300002504 | Bacteria | 3610 |
| 49 | Ga0068302_10035708 | 3300005071 | Bacteria | 5316 |
| 50 | Ga0160472_104747 | 3300012839 | Bacteria | 2318 |
| 51 | Ga0466657_020832 | 3300042582 | Bacteria | 13341 |
| 52 | Ga0466692_074031 | 3300042591 | Bacteria | 11935 |
| 53 | Ga0466692_116079 | 3300042591 | Bacteria | 32659 |
| 54 | Ga0466691_161760 | 3300042593 | Unclassified | 1410 |
| 55 | Ga0466700_329134 | 3300042600 | Bacteria | 4200 |
| 56 | Ga0466713_064608 | 3300042602 | Bacteria | 5360 |
| 57 | Ga0466716_475286 | 3300042605 | Bacteria | 2774 |
| 58 | Ga0466719_094994 | 3300042606 | Bacteria | 21344 |
| 59 | Ga0466710_372432 | 3300042613 | Bacteria | 3537 |
| 60 | Ga0466718_099896 | 3300042617 | Bacteria | 4381 |
| 61 | Ga0466729_292779 | 3300042621 | Bacteria | 6126 |
| 62 | Ga0466734_088888 | 3300042623 | Bacteria | 18155 |
| 63 | Ga0466703_067715 | 3300042636 | Bacteria | 13737 |
| 64 | Ga0466704_043595 | 3300042643 | Bacteria | 28096 |
| 65 | Ga0466704_065065 | 3300042643 | Bacteria | 13675 |
| 66 | Ga0466708_118706 | 3300042652 | Bacteria | 8497 |
| 67 | Ga0466725_129448 | 3300042654 | Bacteria | 92830 |
| 68 | Ga0466705_171973 | 3300042612 | Bacteria | 113809 |
| 69 | DPOL_contig01645 | 2035918003 | Bacteria | 21598 |
| 70 | IMNBL1DRAFT_c0006501 | 3300000062 | Bacteria | 6373 |
| 71 | SCG598I20_12754 | 3300000473 | Unclassified | 19561 |
| 72 | Meta3P_1000101 | 3300002464 | Bacteria | 42193 |
| 73 | JGI24705J35276_12228343 | 3300002504 | Unclassified | 3167 |
| 74 | Ga0104041_1001831 | 3300007106 | Bacteria | 2439 |
| 75 | Ga0102734_1000550 | 3300007129 | Bacteria | 10557 |
| 76 | Ga0104019_1194673 | 3300007150 | Bacteria | 1301 |
| 77 | Ga0160431_114131 | 3300012828 | Unclassified | 904 |
| 78 | Ga0160452_100049 | 3300012834 | Bacteria | 165578 |
| 79 | Ga0160447_100739 | 3300012849 | Bacteria | 14117 |
| 80 | Ga0160436_1014847 | 3300012861 | Unclassified | 1588 |
| 81 | Ga0316159_12095 | 3300030930 | Bacteria | 5550 |
| 82 | Ga0466656_270432 | 3300042550 | Bacteria | 1303 |
| 83 | Ga0466707_085767 | 3300042601 | Bacteria | 92057 |
| 84 | Ga0466715_008882 | 3300042616 | Bacteria | 5778 |
| 85 | Ga0466734_041042 | 3300042623 | Bacteria | 1253 |
| 86 | Ga0466703_352860 | 3300042636 | Bacteria | 6055 |
| 87 | Ga0466703_421896 | 3300042636 | Bacteria | 1318 |
| 88 | Ga0466709_010553 | 3300042648 | Bacteria | 13046 |
| 89 | Ga0466725_069031 | 3300042654 | Bacteria | 10014 |
| 90 | Ga0466697_098398 | 3300042611 | Bacteria | 1703 |
| 91 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 92 | gam1t_NODE_440637_length=36566_GC=34_9_Contigs=5 | 2189573031 | Bacteria | 36606 |
| 93 | gam1t_NODE_577128_length=11799_GC=34_3_Contigs=7 | 2189573031 | Bacteria | 11859 |
| 94 | Meta3P_1002495 | 3300002464 | Bacteria | 9296 |
| 95 | Ga0068305_10699071 | 3300005083 | Bacteria | 4329 |
| 96 | Ga0102736_1003043 | 3300007052 | Bacteria | 2525 |
| 97 | Ga0103266_1000086 | 3300007067 | Bacteria | 55538 |
| 98 | Ga0102734_1000407 | 3300007129 | Bacteria | 21095 |
| 99 | Ga0103264_1001582 | 3300007188 | Bacteria | 10060 |
| 100 | Ga0160430_102370 | 3300012852 | Bacteria | 6020 |
| 101 | Ga0160436_1026187 | 3300012861 | Unclassified | 1040 |
| 102 | Ga0466690_375554 | 3300042590 | Bacteria | 1254 |
| 103 | Ga0123357_10097125 | 3300009784 | Bacteria | 3813 |
| 104 | Ga0466701_016497 | 3300042598 | Bacteria | 251596 |
| 105 | Ga0466701_028925 | 3300042598 | Bacteria | 23880 |
| 106 | Ga0466717_160691 | 3300042604 | Bacteria | 4479 |
| 107 | Ga0466716_482012 | 3300042605 | Bacteria | 9781 |
| 108 | Ga0466719_360803 | 3300042606 | Bacteria | 1030 |
| 109 | Ga0466704_211644 | 3300042643 | Bacteria | 1001 |
| 110 | Ga0466704_444708 | 3300042643 | Bacteria | 1455 |
| 111 | Ga0466708_114657 | 3300042652 | Bacteria | 19666 |
| 112 | Ga0466705_264938 | 3300042612 | Bacteria | 25031 |
| 113 | DPO_contig08495 | 2032320009 | Unclassified | 18271 |
| 114 | SCG598I22_12493 | 3300000462 | Bacteria | 28263 |
| 115 | JGI24702J35022_10002074 | 3300002462 | Bacteria | 12355 |
| 116 | JGI24699J35502_10855674 | 3300002509 | Bacteria | 963 |
| 117 | Ga0103266_1003356 | 3300007067 | Bacteria | 4800 |
| 118 | Ga0123357_10000031 | 3300009784 | Bacteria | 116101 |
| 119 | Ga0160433_100085 | 3300012846 | Bacteria | 96359 |
| 120 | Ga0466690_026266 | 3300042590 | Bacteria | 36904 |
| 121 | Ga0466693_177467 | 3300042592 | Bacteria | 1044 |
| 122 | Ga0466696_503489 | 3300042596 | Bacteria | 13155 |
| 123 | Ga0466701_026761 | 3300042598 | Bacteria | 104248 |
| 124 | Ga0466717_181250 | 3300042604 | Bacteria | 4001 |
| 125 | Ga0466716_121422 | 3300042605 | Bacteria | 1384 |
| 126 | Ga0466719_021543 | 3300042606 | Bacteria | 3130 |
| 127 | Ga0466719_028817 | 3300042606 | Unclassified | 2030 |
| 128 | Ga0466722_084027 | 3300042609 | Bacteria | 7905 |
| 129 | Ga0466715_454559 | 3300042616 | Bacteria | 16983 |
| 130 | Ga0466723_131733 | 3300042618 | Bacteria | 10194 |
| 131 | Ga0466735_113950 | 3300042624 | Bacteria | 1682 |
| 132 | Ga0466730_067521 | 3300042625 | Bacteria | 9844 |
| 133 | Ga0466724_16224 | 3300042649 | Unclassified | 8171 |
| 134 | Ga0466708_403384 | 3300042652 | Bacteria | 1661 |
| 135 | Ga0466732_401926 | 3300042656 | Bacteria | 2941 |
| 136 | HBC_ctgsDRAFT_1000061 | 3300000333 | Bacteria | 27338 |
| 137 | JGI24702J35022_10091769 | 3300002462 | Bacteria | 1654 |
| 138 | Ga0102737_1001029 | 3300007142 | Unclassified | 8241 |
| 139 | Ga0127657_131936 | 3300009457 | Bacteria | 9249 |
| 140 | Ga0160446_101461 | 3300012835 | Unclassified | 5063 |
| 141 | Ga0123353_10001051 | 3300010167 | Bacteria | 33815 |
| 142 | Ga0466713_047875 | 3300042602 | Bacteria | 19469 |
| 143 | Ga0466717_253740 | 3300042604 | Bacteria | 2380 |
| 144 | Ga0466716_098325 | 3300042605 | Bacteria | 3497 |
| 145 | Ga0466719_056594 | 3300042606 | Bacteria | 1551 |
| 146 | Ga0466719_220409 | 3300042606 | Bacteria | 11848 |
| 147 | Ga0466719_492446 | 3300042606 | Bacteria | 10890 |
| 148 | Ga0466729_258353 | 3300042621 | Bacteria | 13515 |
| 149 | Ga0466703_112964 | 3300042636 | Bacteria | 58413 |
| 150 | Ga0466704_286087 | 3300042643 | Unclassified | 1699 |
| 151 | Ga0466704_427017 | 3300042643 | Bacteria | 3185 |
| 152 | Ga0466724_12482 | 3300042649 | Bacteria | 8190 |
| 153 | Ga0466708_209717 | 3300042652 | Bacteria | 9588 |
| 154 | Ga0466708_297033 | 3300042652 | Bacteria | 10000 |
| 155 | Ga0466725_161084 | 3300042654 | Bacteria | 30258 |
| 156 | Ga0466727_246557 | 3300042655 | Bacteria | 24853 |
| 157 | FGTW_contig30805 | 2065487013 | Unclassified | 9085 |
| 158 | 2227506702 | 2225789004 | Bacteria | 717 |
| 159 | Ga0072941_1486724 | 3300005201 | Bacteria | 2229 |
| 160 | Ga0103265_1002070 | 3300007068 | Unclassified | 3136 |
| 161 | Ga0102740_1007121 | 3300007140 | Unclassified | 1947 |
| 162 | Ga0103267_1000016 | 3300007190 | Bacteria | 94998 |
| 163 | Ga0103268_1000518 | 3300007192 | Bacteria | 11577 |
| 164 | Ga0160458_103262 | 3300012832 | Unclassified | 2073 |
| 165 | Ga0466656_375737 | 3300042550 | Bacteria | 1617 |
| 166 | Ga0466657_311087 | 3300042582 | Bacteria | 1152 |
| 167 | Ga0466690_276559 | 3300042590 | Bacteria | 11056 |
| 168 | Ga0466690_406079 | 3300042590 | Bacteria | 1454 |
| 169 | Ga0466696_247842 | 3300042596 | Bacteria | 3005 |
| 170 | Ga0123354_10338446 | 3300010882 | Bacteria | 1360 |
| 171 | Ga0466707_099821 | 3300042601 | Bacteria | 13848 |
| 172 | Ga0466707_128695 | 3300042601 | Bacteria | 21572 |
| 173 | Ga0466707_161587 | 3300042601 | Bacteria | 32712 |
| 174 | Ga0466710_053361 | 3300042613 | Bacteria | 30918 |
| 175 | Ga0466711_509254 | 3300042615 | Bacteria | 7963 |
| 176 | Ga0466715_094269 | 3300042616 | Bacteria | 25306 |
| 177 | Ga0466715_163300 | 3300042616 | Bacteria | 2453 |
| 178 | Ga0466718_145928 | 3300042617 | Bacteria | 1211 |
| 179 | Ga0466723_320203 | 3300042618 | Bacteria | 16804 |
| 180 | Ga0466726_211104 | 3300042619 | Bacteria | 1410 |
| 181 | Ga0466729_029026 | 3300042621 | Bacteria | 2243 |
| 182 | Ga0466724_48218 | 3300042649 | Bacteria | 14823 |
| 183 | Ga0466725_232841 | 3300042654 | Bacteria | 20285 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01521 | Fe-S_biosyn | Iron-sulphur cluster biosynthesis | 12 | 112 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.