Protein Family IF10573
Metagenome
Isolate
773
Members
624
Samples
257
Scaffolds
472.89
Avg Length
Representative Sequence
- ID
- 3300056856|Ga0562375_0015|Ga0562375_0015_1020384_1022012
- Length
- 542 aa
- Sequence
- MEPMGFIFLLEKRKKADYRLCFTWIKEMIENKSNKSNYFVFISSILRYNGVDYKGILMNFFSKTVGGYKMTKQQFGVVGMAVMGKNLALNIESRGYSVALFNRTGSKTTAVVEEHPDKNFKATYTIEEFVDSIEKPRRIMLMVQAGFATDATIQELLPHLDKGDILIDGGNTFFKDTIRRNEELANSGINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGAGHYVKMVHNGIEYGDMQLIAESYDLMKNILGLSVDEMADIFKEWNKGELDSYLVEITADILTRKDDEGTGQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKDERVKASQVLGKPEVTPYQGDKQELVEKIREALYFSKIMSYAQGFAQLRVASEEYAWDLPFGEIAKIWRAGCIIRAQFLQKITDAYDKNPAIENLLLDEYFTDITKKYQQSVRDVVSLAIQAGVPVPTFASAIAYYDSYRSDRLPANLIQAQRDYFGAHTYQRVDKEGTYHYSWYHEE
Sample Types
Isolate
66.8%
Metagenome
33.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
18.6%
Coreidae
13.6%
Unclassified
13.5%
Drosophilidae
7.5%
Aphididae
5.3%
Termitidae
4.1%
Anthocoridae
3.6%
Formicidae
3.2%
Kalotermitidae
2.6%
Tenebrionidae
2.4%
Blattidae
2.4%
Muscidae
2.2%
Curculionidae
1.7%
Scarabaeidae
1.7%
Halictidae
1.5%
Calliphoridae
1.5%
Culicidae
1.5%
Elmidae
1.2%
Tephritidae
0.9%
Cerambycidae
0.9%
Armadillidiidae
0.7%
Rhinotermitidae
0.7%
Termopsidae
0.7%
Aleyrodidae
0.5%
Pteromalidae
0.5%
Cicadellidae
0.3%
Passalidae
0.3%
Plutellidae
0.3%
Berytidae
0.3%
Pentatomidae
0.3%
Sarcophagidae
0.3%
Largidae
0.3%
Dytiscidae
0.3%
Libellulidae
0.2%
Rhopalidae
0.2%
Hydrophilidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Eresidae
0.2%
Siricidae
0.2%
Triozidae
0.2%
Crambidae
0.2%
Penaeidae
0.2%
Ceratophyllidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Gomphidae
0.2%
Nephropidae
0.2%
Aphalaridae
0.2%
Daphniidae
0.2%
Aphrophoridae
0.2%
Vespidae
0.2%
Hormaphididae
0.2%
Bombycidae
0.2%
Hodotermitidae
0.2%
Alydidae
0.2%
Noctuidae
0.2%
Cixiidae
0.2%
Rhaphidophoridae
0.2%
Taxonomy
Archaea
0
Bacteria
741
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 2 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 3 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 4 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 5 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 6 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 7 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 8 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 9 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 10 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 11 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 12 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 13 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 14 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 15 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 16 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 17 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 18 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 19 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 20 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 21 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 22 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 23 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 24 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 25 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 26 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 27 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 28 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 29 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 30 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 31 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 32 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 33 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 34 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 35 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 36 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 37 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 38 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 39 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 40 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 41 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 42 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 43 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 46 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 47 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 49 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 50 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 51 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 52 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 53 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 54 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 55 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 56 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 57 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 58 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 59 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 60 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 61 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 62 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 63 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 64 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 65 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 66 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 67 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 68 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 69 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 70 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 76 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 77 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 78 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 79 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 80 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 81 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 82 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 83 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 84 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 85 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 86 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 87 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 88 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 89 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 90 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 91 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 92 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 93 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 94 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 95 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 96 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 97 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 98 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 99 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 100 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 101 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 102 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 103 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 104 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 105 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 106 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 107 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 108 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 109 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 110 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 111 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 112 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 113 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 114 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 115 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 116 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 117 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 118 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 119 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 120 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 121 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 122 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 123 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 124 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 125 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 126 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 127 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 128 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 129 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 130 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 131 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 132 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 133 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 134 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 135 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 136 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 137 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 138 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 139 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 140 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 141 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 142 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 143 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 144 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 145 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 146 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 147 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 148 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 149 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 150 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 151 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 152 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 153 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 154 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 155 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 156 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 157 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 158 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 159 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 160 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 161 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 162 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 163 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 164 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 165 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 166 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 167 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 168 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 169 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 170 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 171 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 172 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 173 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 174 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 175 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 176 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 177 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 178 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 179 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 180 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 181 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 182 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 183 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 184 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 185 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 186 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 187 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 188 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 189 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 190 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 191 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 192 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 193 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 194 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 195 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 196 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 197 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 198 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 199 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 200 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 201 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 202 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 203 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 204 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 205 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 206 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 207 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 208 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 209 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 210 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 211 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 212 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 213 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 214 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 215 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 216 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 217 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 218 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 219 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 220 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 221 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 222 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 223 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 224 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 225 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 226 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 227 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 228 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 229 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 230 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 231 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 232 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 233 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 234 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 235 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 236 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 237 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 238 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 239 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 240 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 241 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 242 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 243 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 244 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 245 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 246 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 247 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 248 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 249 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 250 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 251 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 252 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 253 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 254 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 255 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 256 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 257 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 258 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 259 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 260 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 261 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 262 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 263 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 264 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 265 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 266 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 267 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 268 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 269 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 270 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 271 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 272 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 273 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 274 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 275 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 276 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 277 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 278 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 279 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 280 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 281 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 282 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 283 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 284 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 285 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 286 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 287 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 288 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 289 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 290 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 291 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 292 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 293 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 294 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 295 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 296 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 297 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 298 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 299 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 300 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 301 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 302 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 303 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 304 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 305 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 306 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 307 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 308 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 309 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 310 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 311 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 312 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 313 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 314 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 315 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 316 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 317 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 318 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 319 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 320 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 321 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 322 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 323 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 324 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 325 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 326 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 327 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 328 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 329 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 330 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 331 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 332 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 333 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 334 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 335 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 336 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 337 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 338 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 339 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 340 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 341 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 342 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 343 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 344 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 345 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 346 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 347 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 348 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 349 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 350 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 351 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 352 | 2958255616 | Serratia marcescens TM | Isolate | |
| 353 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 354 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 355 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 356 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 357 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 358 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 359 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 360 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 361 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 362 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 363 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 364 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 365 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 366 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 367 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 368 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 369 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 370 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 371 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 372 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 373 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 374 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 375 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 376 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 377 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 378 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 379 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 380 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 381 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 382 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 383 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 384 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 385 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 386 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 387 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 388 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 389 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 390 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 391 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 392 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 393 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 394 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 395 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 396 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 397 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 398 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 399 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 400 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 401 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 402 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 403 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 404 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 405 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 406 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 407 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 408 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 409 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 410 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 411 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 412 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 413 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 414 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 415 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 416 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 417 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 418 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 419 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 420 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 421 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 422 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 423 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 424 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 425 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 426 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 427 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 428 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 429 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 430 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 431 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 432 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 433 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 434 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 435 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 436 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 437 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 438 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 439 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 440 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 441 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 442 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 443 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 444 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 445 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 446 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 447 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 448 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 449 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 450 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 451 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 452 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 453 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 454 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 455 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 456 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 457 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 458 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 459 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 460 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 461 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 462 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 463 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 464 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 465 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 466 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 467 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 468 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 469 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 470 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 471 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 472 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 473 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 474 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 475 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 476 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 477 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 478 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 479 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 480 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 481 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 482 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 483 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 484 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 485 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 486 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 487 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 488 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 489 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 490 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 491 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 492 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 493 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 494 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 495 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 496 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 497 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 498 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 499 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 500 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 501 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 502 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 503 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 504 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 505 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 506 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 507 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 508 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 509 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 510 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 511 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 512 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 513 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 514 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 515 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 516 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 517 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 518 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 519 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 520 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 521 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 522 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 523 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 524 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 525 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 526 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 527 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 528 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 529 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 530 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 531 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 532 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 533 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 534 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 535 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 536 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 537 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 538 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 539 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 540 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 541 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 542 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 543 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 544 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 545 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 546 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 547 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 548 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 549 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 550 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 551 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 552 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 553 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 554 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 555 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 556 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 557 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 558 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 559 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 560 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 561 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 562 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 563 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 564 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 565 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 566 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 567 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 568 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 569 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 570 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 571 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 572 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 573 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 574 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 575 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 576 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 577 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 578 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 579 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 580 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 581 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 582 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 583 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 584 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 585 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 586 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 587 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 588 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 589 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 590 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 591 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 592 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 593 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 594 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 595 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 596 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 597 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 598 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 599 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 600 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 601 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 602 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 603 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 604 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 605 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 606 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 607 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 608 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 609 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 610 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 611 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 612 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 613 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 614 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 615 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 616 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 617 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 618 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 619 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 620 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 621 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 622 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 623 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 624 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0035 | 3300056790 | Bacteria | 679259 |
| 2 | Ga0562378_0030 | 3300056814 | Bacteria | 540869 |
| 3 | Ga0562376_2690 | 3300056857 | Bacteria | 20446 |
| 4 | Ga0466726_147812 | 3300042619 | Bacteria | 4058 |
| 5 | Ga0466726_427074 | 3300042619 | Bacteria | 46756 |
| 6 | Ga0123357_10074708 | 3300009784 | Bacteria | 4482 |
| 7 | Ga0123356_10001318 | 3300010049 | Bacteria | 27461 |
| 8 | Ga0123356_10002888 | 3300010049 | Bacteria | 18199 |
| 9 | Ga0123356_10028884 | 3300010049 | Bacteria | 5198 |
| 10 | Ga0123356_10078563 | 3300010049 | Bacteria | 3115 |
| 11 | Ga0123353_10027496 | 3300010167 | Bacteria | 8718 |
| 12 | Ga0466730_050849 | 3300042625 | Bacteria | 52724 |
| 13 | Ga0466725_190288 | 3300042654 | Bacteria | 2393 |
| 14 | Ga0466727_329123 | 3300042655 | Bacteria | 13114 |
| 15 | FGTW_contig15317 | 2065487013 | Bacteria | 10234 |
| 16 | SWWA_contig08528__length_10146___numreads_196 | 2100351016 | Unclassified | 10146 |
| 17 | HBC_ctgsDRAFT_1002538 | 3300000333 | Bacteria | 4154 |
| 18 | WW0001_100241 | 3300002732 | Bacteria | 118798 |
| 19 | CVPL010L_1000747 | 3300002932 | Bacteria | 6000 |
| 20 | Ga0074278_109184 | 3300005721 | Bacteria | 53785 |
| 21 | Ga0102737_1007376 | 3300007142 | Unclassified | 3829 |
| 22 | Ga0103264_1031704 | 3300007188 | Unclassified | 3314 |
| 23 | Ga0104147_1007246 | 3300007224 | Unclassified | 4921 |
| 24 | Ga0127657_166880 | 3300009457 | Bacteria | 4346 |
| 25 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 26 | Ga0160445_100546 | 3300012847 | Bacteria | 17552 |
| 27 | Ga0247290_00009 | 3300035364 | Bacteria | 82427 |
| 28 | Ga0466692_144506 | 3300042591 | Bacteria | 10849 |
| 29 | Ga0466701_013139 | 3300042598 | Bacteria | 83506 |
| 30 | Ga0466705_378754 | 3300042612 | Unclassified | 2365 |
| 31 | Ga0466715_166956 | 3300042616 | Bacteria | 103860 |
| 32 | Ga0466715_283990 | 3300042616 | Bacteria | 24972 |
| 33 | Ga0466728_005894 | 3300042620 | Bacteria | 6646 |
| 34 | Ga0466728_423284 | 3300042620 | Unclassified | 1928 |
| 35 | Ga0123353_10202804 | 3300010167 | Bacteria | 3119 |
| 36 | Ga0136159_1000009 | 3300010217 | Bacteria | 227530 |
| 37 | Ga0466734_013937 | 3300042623 | Bacteria | 9856 |
| 38 | Ga0466730_013950 | 3300042625 | Bacteria | 2525 |
| 39 | Ga0466702_136609 | 3300042635 | Bacteria | 17558 |
| 40 | Ga0466724_13401 | 3300042649 | Bacteria | 12277 |
| 41 | Ga0466725_234041 | 3300042654 | Bacteria | 3575 |
| 42 | gam1t_NODE_708164_length=53755_GC=35_4_Contigs=4 | 2189573031 | Unclassified | 53785 |
| 43 | 2227111387 | 2225789004 | Bacteria | 9378 |
| 44 | IMNBL1DRAFT_c0007057 | 3300000062 | Bacteria | 5985 |
| 45 | HBC_ctgsDRAFT_1000839 | 3300000333 | Unclassified | 6738 |
| 46 | JGI24695J34938_10000040 | 3300002450 | Bacteria | 97045 |
| 47 | JGI24697J35500_11274929 | 3300002507 | Bacteria | 14743 |
| 48 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 49 | Ga0102736_1000020 | 3300007052 | Bacteria | 216649 |
| 50 | Ga0105005_1275488 | 3300007505 | Bacteria | 3975 |
| 51 | Ga0127649_100243 | 3300009460 | Unclassified | 3998 |
| 52 | Ga0160455_101646 | 3300012837 | Bacteria | 6081 |
| 53 | Ga0160460_100023 | 3300012845 | Bacteria | 338828 |
| 54 | Ga0466690_096088 | 3300042590 | Bacteria | 11917 |
| 55 | Ga0466693_368032 | 3300042592 | Bacteria | 2405 |
| 56 | Ga0466691_060419 | 3300042593 | Bacteria | 3054 |
| 57 | Ga0466696_019478 | 3300042596 | Bacteria | 14609 |
| 58 | Ga0466701_102378 | 3300042598 | Bacteria | 42765 |
| 59 | Ga0466700_298987 | 3300042600 | Bacteria | 11791 |
| 60 | Ga0466707_191387 | 3300042601 | Bacteria | 50283 |
| 61 | Ga0466719_325262 | 3300042606 | Bacteria | 1977 |
| 62 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 63 | Ga0562379_0515 | 3300056790 | Bacteria | 76829 |
| 64 | Ga0562379_1243 | 3300056790 | Bacteria | 31266 |
| 65 | Ga0562379_1293 | 3300056790 | Unclassified | 29925 |
| 66 | Ga0562379_1381 | 3300056790 | Bacteria | 28460 |
| 67 | Ga0562378_0396 | 3300056814 | Bacteria | 80819 |
| 68 | Ga0562375_0238 | 3300056856 | Bacteria | 149705 |
| 69 | Ga0466710_147920 | 3300042613 | Bacteria | 1811 |
| 70 | Ga0466715_104811 | 3300042616 | Bacteria | 85178 |
| 71 | Ga0466715_209130 | 3300042616 | Unclassified | 4357 |
| 72 | Ga0123356_10130923 | 3300010049 | Bacteria | 2458 |
| 73 | Ga0123353_10029598 | 3300010167 | Bacteria | 8445 |
| 74 | Ga0160464_100241 | 3300012805 | Bacteria | 52916 |
| 75 | Ga0466730_092390 | 3300042625 | Bacteria | 23737 |
| 76 | Ga0466704_017093 | 3300042643 | Bacteria | 3924 |
| 77 | Ga0466727_316053 | 3300042655 | Bacteria | 6945 |
| 78 | gam1t_NODE_110906_length=43291_GC=33_7_Contigs=2 | 2189573031 | Unclassified | 43301 |
| 79 | HBC_ctgsDRAFT_1002641 | 3300000333 | Bacteria | 4065 |
| 80 | Meta3P_1000035 | 3300002464 | Bacteria | 60883 |
| 81 | Ga0068302_10053348 | 3300005071 | Unclassified | 5799 |
| 82 | Ga0102734_1000019 | 3300007129 | Bacteria | 75254 |
| 83 | Ga0127657_102822 | 3300009457 | Bacteria | 12683 |
| 84 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 85 | Ga0160452_100142 | 3300012834 | Bacteria | 87044 |
| 86 | Ga0160444_100156 | 3300012841 | Bacteria | 68274 |
| 87 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 88 | Ga0466706_051631 | 3300042599 | Bacteria | 6507 |
| 89 | Ga0466707_079562 | 3300042601 | Bacteria | 4710 |
| 90 | Ga0466719_040662 | 3300042606 | Bacteria | 3204 |
| 91 | Ga0466733_077763 | 3300042659 | Bacteria | 7927 |
| 92 | Ga0466733_104734 | 3300042659 | Bacteria | 10016 |
| 93 | Ga0466733_116395 | 3300042659 | Bacteria | 19596 |
| 94 | Ga0562379_0180 | 3300056790 | Bacteria | 182121 |
| 95 | Ga0562379_0730 | 3300056790 | Bacteria | 55190 |
| 96 | Ga0562377_0018 | 3300056842 | Bacteria | 1087840 |
| 97 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 98 | Ga0562375_1297 | 3300056856 | Unclassified | 35284 |
| 99 | Ga0562376_1670 | 3300056857 | Bacteria | 30056 |
| 100 | Ga0466723_253681 | 3300042618 | Bacteria | 13574 |
| 101 | Ga0123356_10165188 | 3300010049 | Bacteria | 2217 |
| 102 | Ga0123353_10071156 | 3300010167 | Bacteria | 5589 |
| 103 | Ga0466730_026387 | 3300042625 | Bacteria | 4592 |
| 104 | Ga0466730_074004 | 3300042625 | Unclassified | 2483 |
| 105 | Ga0466703_177810 | 3300042636 | Bacteria | 12722 |
| 106 | Ga0466724_26053 | 3300042649 | Unclassified | 17846 |
| 107 | Ga0466708_255390 | 3300042652 | Bacteria | 15700 |
| 108 | Ga0466725_168524 | 3300042654 | Bacteria | 1536 |
| 109 | Ga0466727_070873 | 3300042655 | Bacteria | 4767 |
| 110 | Ga0466727_346481 | 3300042655 | Bacteria | 130939 |
| 111 | FGTW_contig11583 | 2065487013 | Unclassified | 6443 |
| 112 | 2227080783 | 2225789004 | Bacteria | 156181 |
| 113 | JGI24695J34938_10000249 | 3300002450 | Bacteria | 52020 |
| 114 | Ga0063521_1000230 | 3300003973 | Bacteria | 38724 |
| 115 | Ga0074188_1000191 | 3300005318 | Bacteria | 37722 |
| 116 | Ga0102735_1000008 | 3300007080 | Bacteria | 61114 |
| 117 | Ga0104042_1034818 | 3300007130 | Bacteria | 5286 |
| 118 | Ga0104042_1119516 | 3300007130 | Bacteria | 3487 |
| 119 | Ga0102738_1000048 | 3300007141 | Bacteria | 51657 |
| 120 | Ga0160453_100473 | 3300012814 | Bacteria | 30597 |
| 121 | Ga0160467_100195 | 3300012829 | Bacteria | 80671 |
| 122 | Ga0316159_10091 | 3300030930 | Bacteria | 22778 |
| 123 | Ga0466691_015805 | 3300042593 | Bacteria | 4856 |
| 124 | Ga0466707_290136 | 3300042601 | Bacteria | 242153 |
| 125 | Ga0466697_163643 | 3300042611 | Bacteria | 2467 |
| 126 | Ga0562377_0037 | 3300056842 | Bacteria | 656123 |
| 127 | Ga0562377_0706 | 3300056842 | Bacteria | 47228 |
| 128 | Ga0562375_3176 | 3300056856 | Bacteria | 16196 |
| 129 | Ga0562375_5973 | 3300056856 | Unclassified | 6196 |
| 130 | Ga0562376_0005 | 3300056857 | Bacteria | 2173693 |
| 131 | Ga0562374_0854 | 3300057007 | Bacteria | 42783 |
| 132 | Ga0466715_302440 | 3300042616 | Bacteria | 10079 |
| 133 | Ga0123356_10000703 | 3300010049 | Bacteria | 36998 |
| 134 | Ga0123356_10147595 | 3300010049 | Bacteria | 2330 |
| 135 | Ga0123353_10003756 | 3300010167 | Bacteria | 19327 |
| 136 | Ga0123353_10015075 | 3300010167 | Bacteria | 11198 |
| 137 | Ga0123353_10031304 | 3300010167 | Bacteria | 8238 |
| 138 | Ga0123353_10075522 | 3300010167 | Bacteria | 5415 |
| 139 | Ga0466735_169288 | 3300042624 | Bacteria | 9022 |
| 140 | Ga0466704_444903 | 3300042643 | Unclassified | 5426 |
| 141 | Ga0466725_044066 | 3300042654 | Bacteria | 6389 |
| 142 | Ga0466727_047145 | 3300042655 | Bacteria | 3372 |
| 143 | Ga0466727_137561 | 3300042655 | Bacteria | 4947 |
| 144 | FGTW_contig10982 | 2065487013 | Unclassified | 7910 |
| 145 | IMNBL1DRAFT_c0001682 | 3300000062 | Bacteria | 16327 |
| 146 | Meta3P_1000055 | 3300002464 | Bacteria | 91103 |
| 147 | JGI24700J35501_10926835 | 3300002508 | Bacteria | 6472 |
| 148 | CVPL010W_10000313 | 3300002931 | Bacteria | 101508 |
| 149 | Ga0103266_1000039 | 3300007067 | Bacteria | 87817 |
| 150 | Ga0102740_1002662 | 3300007140 | Bacteria | 7433 |
| 151 | Ga0103268_1000721 | 3300007192 | Unclassified | 9421 |
| 152 | Ga0265387_1000057 | 3300024582 | Bacteria | 35018 |
| 153 | Ga0466696_070339 | 3300042596 | Bacteria | 13878 |
| 154 | Ga0466701_053997 | 3300042598 | Bacteria | 2499 |
| 155 | Ga0466700_289164 | 3300042600 | Bacteria | 7685 |
| 156 | Ga0466707_165779 | 3300042601 | Bacteria | 177707 |
| 157 | Ga0466707_167218 | 3300042601 | Bacteria | 11149 |
| 158 | Ga0466713_064880 | 3300042602 | Bacteria | 13210 |
| 159 | Ga0530661_001025 | 3300056564 | Bacteria | 16273 |
| 160 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 161 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 162 | Ga0562374_0034 | 3300057007 | Bacteria | 713140 |
| 163 | Ga0562374_1938 | 3300057007 | Bacteria | 21158 |
| 164 | Ga0466715_290515 | 3300042616 | Bacteria | 20096 |
| 165 | Ga0466723_197328 | 3300042618 | Bacteria | 5444 |
| 166 | Ga0123356_10000043 | 3300010049 | Bacteria | 134576 |
| 167 | Ga0123356_10015405 | 3300010049 | Bacteria | 7331 |
| 168 | Ga0123356_10024988 | 3300010049 | Bacteria | 5614 |
| 169 | Ga0123353_10296046 | 3300010167 | Bacteria | 2474 |
| 170 | Ga0160464_100211 | 3300012805 | Bacteria | 58266 |
| 171 | Ga0160466_100625 | 3300012809 | Bacteria | 15449 |
| 172 | Ga0466730_009356 | 3300042625 | Bacteria | 17624 |
| 173 | Ga0466730_076840 | 3300042625 | Bacteria | 11923 |
| 174 | Ga0466709_233970 | 3300042648 | Bacteria | 334556 |
| 175 | AglaG_contig11115 | 2084038013 | Bacteria | 6246 |
| 176 | gam1t_NODE_723057_length=8354_GC=33_5_Contigs=2 | 2189573031 | Unclassified | 8364 |
| 177 | 2227080784 | 2225789004 | Bacteria | 153522 |
| 178 | HBC_ctgsDRAFT_1001232 | 3300000333 | Bacteria | 5600 |
| 179 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 180 | Ga0068302_10124183 | 3300005071 | Bacteria | 11411 |
| 181 | Ga0074278_135804 | 3300005721 | Unclassified | 8364 |
| 182 | Ga0074278_140641 | 3300005721 | Bacteria | 43301 |
| 183 | Ga0104147_1053846 | 3300007224 | Bacteria | 4936 |
| 184 | Ga0127656_101559 | 3300009453 | Bacteria | 30707 |
| 185 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 186 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 187 | Ga0123357_10002559 | 3300009784 | Bacteria | 20369 |
| 188 | Ga0160453_101073 | 3300012814 | Bacteria | 11852 |
| 189 | Ga0160435_1002163 | 3300012857 | Bacteria | 4812 |
| 190 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 191 | Ga0466691_125361 | 3300042593 | Bacteria | 15127 |
| 192 | Ga0466706_126345 | 3300042599 | Bacteria | 7589 |
| 193 | Ga0466713_100538 | 3300042602 | Bacteria | 188125 |
| 194 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 195 | Ga0466714_123168 | 3300042603 | Bacteria | 2612 |
| 196 | Ga0466722_244858 | 3300042609 | Bacteria | 6961 |
| 197 | Ga0562377_0028 | 3300056842 | Bacteria | 766538 |
| 198 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 199 | Ga0562374_0007 | 3300057007 | Bacteria | 2074405 |
| 200 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 201 | Ga0466711_114389 | 3300042615 | Bacteria | 3453 |
| 202 | Ga0466726_088808 | 3300042619 | Bacteria | 2751 |
| 203 | Ga0123356_10048604 | 3300010049 | Bacteria | 3948 |
| 204 | Ga0466730_097610 | 3300042625 | Unclassified | 18238 |
| 205 | Ga0466703_009321 | 3300042636 | Bacteria | 31629 |
| 206 | Ga0466703_143745 | 3300042636 | Bacteria | 2994 |
| 207 | DPOL_contig05640 | 2035918003 | Bacteria | 29209 |
| 208 | SCG598I22_12470 | 3300000462 | Bacteria | 23937 |
| 209 | SCG598B02_13276 | 3300000472 | Bacteria | 66647 |
| 210 | CVPL010L_1000019 | 3300002932 | Bacteria | 107242 |
| 211 | Ga0063521_1000079 | 3300003973 | Bacteria | 79802 |
| 212 | Ga0103261_1000018 | 3300007083 | Bacteria | 118008 |
| 213 | Ga0104042_1000445 | 3300007130 | Bacteria | 10734 |
| 214 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 215 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 216 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 217 | Ga0247289_0009 | 3300035363 | Bacteria | 70813 |
| 218 | Ga0247289_0069 | 3300035363 | Unclassified | 29424 |
| 219 | Ga0415639_020807 | 3300038395 | Bacteria | 17302 |
| 220 | Ga0466696_044417 | 3300042596 | Bacteria | 16581 |
| 221 | Ga0466701_088756 | 3300042598 | Bacteria | 87139 |
| 222 | Ga0466706_128233 | 3300042599 | Bacteria | 1299 |
| 223 | Ga0466706_195304 | 3300042599 | Bacteria | 2822 |
| 224 | Ga0466707_125639 | 3300042601 | Bacteria | 1825 |
| 225 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 226 | Ga0466716_096025 | 3300042605 | Bacteria | 4928 |
| 227 | Ga0466733_029160 | 3300042659 | Bacteria | 16399 |
| 228 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 229 | Ga0562378_0008 | 3300056814 | Bacteria | 1370151 |
| 230 | Ga0562377_1815 | 3300056842 | Bacteria | 19380 |
| 231 | Ga0562375_0169 | 3300056856 | Unclassified | 191486 |
| 232 | Ga0562374_0010 | 3300057007 | Bacteria | 1930599 |
| 233 | Ga0123357_10103301 | 3300009784 | Bacteria | 3666 |
| 234 | Ga0123355_10221126 | 3300009826 | Bacteria | 2723 |
| 235 | Ga0123353_10001168 | 3300010167 | Bacteria | 32047 |
| 236 | Ga0123353_10091786 | 3300010167 | Bacteria | 4891 |
| 237 | Ga0160454_100011 | 3300012798 | Bacteria | 394348 |
| 238 | Ga0160465_102588 | 3300012803 | Bacteria | 3845 |
| 239 | Ga0160471_100662 | 3300012812 | Unclassified | 8667 |
| 240 | Ga0466730_082666 | 3300042625 | Unclassified | 5707 |
| 241 | Ga0466702_238990 | 3300042635 | Bacteria | 163005 |
| 242 | Ga0466724_59631 | 3300042649 | Unclassified | 20988 |
| 243 | Ga0466724_63363 | 3300042649 | Bacteria | 6847 |
| 244 | Ga0466708_412872 | 3300042652 | Bacteria | 8340 |
| 245 | Ga0063521_1000105 | 3300003973 | Bacteria | 65293 |
| 246 | Ga0072941_1019920 | 3300005201 | Bacteria | 5011 |
| 247 | Ga0072941_1025202 | 3300005201 | Bacteria | 5663 |
| 248 | Ga0102733_100022 | 3300006995 | Bacteria | 33961 |
| 249 | Ga0103263_100011 | 3300007042 | Bacteria | 48330 |
| 250 | Ga0105553_1041437 | 3300007767 | Unclassified | 5474 |
| 251 | Ga0466696_314914 | 3300042596 | Bacteria | 3424 |
| 252 | Ga0466706_094597 | 3300042599 | Unclassified | 12349 |
| 253 | Ga0466706_137848 | 3300042599 | Bacteria | 4317 |
| 254 | Ga0466707_274258 | 3300042601 | Bacteria | 5996 |
| 255 | Ga0466717_000780 | 3300042604 | Bacteria | 1782 |
| 256 | Ga0466721_349851 | 3300042608 | Bacteria | 11657 |
| 257 | Ga0466722_218898 | 3300042609 | Unclassified | 1797 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03446 | GO:0050661 | NADP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.