Protein Family IF10437
Metagenome
Metatranscriptome
Isolate
1261
Members
779
Samples
633
Scaffolds
517.64
Avg Length
Representative Sequence
- ID
- 3300056790|Ga0562379_0407|Ga0562379_0407_89083_90843
- Length
- 586 aa
- Sequence
- VTNVADLTTVEKIIVLDFGSQYNQLITRRIREFGVFSELLSHRITADEIREIAPKGIIFSGGPNSVYDENAFRIDPEIYELGIPILGICYGMQLMTYNLGGKVEPAANREYGKAELEIIGTDAHLFQSTPAKQTVWMSHGDLVTQIPEGFTKIATSKDCPIASIQDDSRNFYGVQFHPEVRHSEYGNDLLRHFAFDICHCDGSWTMDNFIDMEINKIREQVGDKKVLLGLSGGVDSSVVGVLLQKAIGDQLTCIFVDHGLLRKGEAEQVMESLGGKFGLNIIKVDAKKRFLDKLAGVSDPEEKRKIIGNEFVYVFDDEATKLDGIDFLAQGTLYTDIVESGTETAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGIELGMPEALVWRQPFPGPGLGIRVLGEITEEKLEIVRDSDAILREEIANAGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVAHVNRIVYDITSKPPATVEWEYFPLNSCCLSNSHACHEKKPKRNIEEVLIIVFFVDTRYHFFKLFFCPKFNFRFLFFNVPNYFRCIFLC
Sample Types
Isolate
49.8%
Metagenome
48.9%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Apidae
22.4%
Unclassified
21.2%
Drosophilidae
9.8%
Coreidae
6.2%
Termitidae
6.1%
Blattidae
5.8%
Formicidae
4.7%
Elmidae
3.4%
Tenebrionidae
3.4%
Culicidae
2.2%
Kalotermitidae
2.0%
Scarabaeidae
1.5%
Halictidae
1.2%
Armadillidiidae
0.9%
Sarcophagidae
0.8%
Pyralidae
0.8%
Rhinotermitidae
0.7%
Termopsidae
0.5%
Bombycidae
0.5%
Ixodidae
0.4%
Psyllidae
0.4%
Passalidae
0.4%
Largidae
0.3%
Curculionidae
0.3%
Noctuidae
0.3%
Hydrophilidae
0.3%
Dytiscidae
0.3%
Nephropidae
0.3%
Libellulidae
0.1%
Nymphalidae
0.1%
Plutellidae
0.1%
Eresidae
0.1%
Siricidae
0.1%
Rhaphidophoridae
0.1%
Euphausiidae
0.1%
Ceratopogonidae
0.1%
Gomphidae
0.1%
Cerambycidae
0.1%
Portunidae
0.1%
Aphididae
0.1%
Penaeidae
0.1%
Pseudophyllodromiidae
0.1%
Daphniidae
0.1%
Calliphoridae
0.1%
Vespidae
0.1%
Hodotermitidae
0.1%
Syrphidae
0.1%
Crambidae
0.1%
Cambaridae
0.1%
Kiwaidae
0.1%
Muscidae
0.1%
Taxonomy
Archaea
1
Bacteria
1,165
Eukaryota
3
Viruses
0
Unclassified
92
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 3 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 4 | 2540341224 | Williamsoniiplasma luminosum ATCC 49195 | Isolate | Unclassified |
| 5 | 2545824514 | Entomoplasma somnilux ATCC 49194 | Isolate | Unclassified |
| 6 | 2554235383 | Spiroplasma diminutum CUAS-1 | Isolate | Culicidae |
| 7 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 8 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 9 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 10 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 11 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 12 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 13 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 14 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 15 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 16 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 17 | 2761201709 | Ogataea arabinofermentans NRRL YB-2248 | Isolate | Unclassified |
| 18 | 2802429270 | Mesoplasma chauliocola CHPA-2 | Isolate | Unclassified |
| 19 | 2806310970 | Mesoplasma florum MQ3 | Isolate | Unclassified |
| 20 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 21 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 22 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 23 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 24 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 25 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 26 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 27 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 28 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 29 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 30 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 31 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 32 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 33 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 34 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 35 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 36 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 37 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 38 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 39 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 40 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 41 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 42 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 43 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 44 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 45 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 46 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 47 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 48 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 49 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 50 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 51 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 52 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 53 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 54 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 55 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 56 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 57 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 58 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 61 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 62 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 63 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 64 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 65 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 66 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 67 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 68 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 69 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 70 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 71 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 72 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 73 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 74 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 75 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 76 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 77 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 78 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 79 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 80 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 81 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 82 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 83 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 84 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 85 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 86 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 87 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 88 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 89 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 90 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 91 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 92 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 93 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 94 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 95 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 96 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 97 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 98 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 99 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 100 | 2545555831 | Mesoplasma chauliocola ATCC 49578 | Isolate | Unclassified |
| 101 | 2554235371 | Spiroplasma chrysopicola DF-1 | Isolate | Unclassified |
| 102 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 103 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 104 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 105 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 106 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 107 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 108 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 109 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 110 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 111 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 112 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 113 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 114 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 115 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 116 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 117 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 118 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 119 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 120 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 121 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 122 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 123 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 124 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 125 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 126 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 127 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 128 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 129 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 130 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 131 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 132 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 133 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 134 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 135 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 136 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 137 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 138 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 139 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 140 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 141 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 142 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 143 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 144 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 145 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 146 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 147 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 148 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 149 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 150 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 151 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 152 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 153 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 154 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 155 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 156 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 157 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 158 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 159 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 160 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 161 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 162 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 163 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 164 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 165 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 166 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 167 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 168 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 169 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 170 | 3300060759 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 171 | 3300060763 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PP_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 172 | 3300060765 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 173 | 3300060768 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 174 | 3300060772 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 175 | 3300060774 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 176 | 3300061799 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 177 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 178 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 179 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 180 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 181 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 182 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 183 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 184 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 185 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 186 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 187 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 188 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 189 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 190 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 191 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 192 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 193 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 194 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 195 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 196 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 197 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 198 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 199 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 200 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 201 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 202 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 203 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 204 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 205 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 206 | 2558860181 | Spiroplasma mirum ATCC 29335 | Isolate | Ixodidae |
| 207 | 2558860251 | Spiroplasma mirum SMCA | Isolate | Ixodidae |
| 208 | 2563366575 | Spiroplasma apis B31 | Isolate | Unclassified |
| 209 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 210 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 211 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 212 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 213 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 214 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 215 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 216 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 217 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 218 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 219 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 220 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 221 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 222 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 223 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 224 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 225 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 226 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 227 | 2802429587 | Spiroplasma eriocheiris CCTCC 'M 207170' | Isolate | Unclassified |
| 228 | 2806310895 | Mesoplasma florum CnuA-2 | Isolate | Unclassified |
| 229 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 230 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 231 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 232 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 233 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 234 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 235 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 236 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 237 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 238 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 239 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 240 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 241 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 242 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 243 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 244 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 245 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 246 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 247 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 248 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 249 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 250 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 251 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 252 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 253 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 254 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 255 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 256 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 257 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 258 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 259 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 260 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 261 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 262 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 263 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 264 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 265 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 266 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 267 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 268 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 269 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 270 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 271 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 272 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 273 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 274 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 275 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 276 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 277 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 278 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 279 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 280 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 281 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 282 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 283 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 284 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 285 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 286 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 287 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 288 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 289 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 290 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 291 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 292 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 293 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 294 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 295 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 296 | 2540341223 | Entomoplasma lucivorax ATCC 49196 | Isolate | Unclassified |
| 297 | 2558860238 | Spiroplasma sabaudiense Ar-1343 | Isolate | Culicidae |
| 298 | 2563366538 | Mesoplasma syrphidae ATCC 51578 | Isolate | Unclassified |
| 299 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 300 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 301 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 302 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 303 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 304 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 305 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 306 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 307 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 308 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 309 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 310 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 311 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 312 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 313 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 314 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 315 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 316 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 317 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 318 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 319 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 320 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 321 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 322 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 323 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 324 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 325 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 326 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 327 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 328 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 329 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 330 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 331 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 332 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 333 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 334 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 335 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 336 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 337 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 338 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 339 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 340 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 341 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 342 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 343 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 344 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 345 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 346 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 347 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 348 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 349 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 350 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 351 | 3300007506 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut | Metagenome | Drosophilidae |
| 352 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 353 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 354 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 355 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 356 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 357 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 358 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 359 | 3300060700 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 360 | 3300060751 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 361 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 362 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 363 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 364 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 365 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 366 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 367 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 368 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 369 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 370 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 371 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 372 | 8067289520 | Spiroplasma poulsonii MSRO_BK | Isolate | Drosophilidae |
| 373 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 374 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 375 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 376 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 377 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 378 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 379 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 380 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 381 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 382 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 383 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 384 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 385 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 386 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 387 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 388 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 389 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 390 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 391 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 392 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 393 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 394 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 395 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 396 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 397 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 398 | 2561511101 | Mesoplasma grammopterae ATCC 49580 | Isolate | Cerambycidae |
| 399 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 400 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 401 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 402 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 403 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 404 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 405 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 406 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 407 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 408 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 409 | 2761201754 | Yamadazyma tenuis ATCC 10573 | Isolate | Unclassified |
| 410 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 411 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 412 | 2806310699 | Spiroplasma melliferum KC3 | Isolate | Unclassified |
| 413 | 2806310987 | Mesoplasma florum BARC 787 | Isolate | Unclassified |
| 414 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 415 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 416 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 417 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 418 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 419 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 420 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 421 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 422 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 423 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 424 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 425 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 426 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 427 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 428 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 429 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 430 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 431 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 432 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 433 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 434 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 435 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 436 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 437 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 438 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 439 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 440 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 441 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 442 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 443 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 444 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 445 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 446 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 447 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 448 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 449 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 450 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 451 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 452 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 453 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 454 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 455 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 456 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 457 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 458 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 459 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 460 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 461 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 462 | 3300060752 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 463 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 464 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 465 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 466 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 467 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 468 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 469 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 470 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 471 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 472 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 473 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 474 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 475 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 476 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 477 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 478 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 479 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 480 | 8100315503 | Spiroplasma sp. hyd1 | Isolate | Drosophilidae |
| 481 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 482 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 483 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 484 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 485 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 486 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 487 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 488 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 489 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 490 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 491 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 492 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 493 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 494 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 495 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 496 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 497 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 498 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 499 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 500 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 501 | 2761201758 | Scheffersomyces stipitis CBS 6054 | Isolate | Unclassified |
| 502 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 503 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 504 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 505 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 506 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 507 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 508 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 509 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 510 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 511 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 512 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 513 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 514 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 515 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 516 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 517 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 518 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 519 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 520 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 521 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 522 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 523 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 524 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 525 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 526 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 527 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 528 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 529 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 530 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 531 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 532 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 533 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 534 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 535 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 536 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 537 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 538 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 539 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 540 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 541 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 542 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 543 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 544 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 545 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 546 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 547 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 548 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 549 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 550 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 551 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 552 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 553 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 554 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 555 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 556 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 557 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 558 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 559 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 560 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 561 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 562 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 563 | 8100317081 | Spiroplasma sp. Moj | Isolate | Drosophilidae |
| 564 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 565 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 566 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 567 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 568 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 569 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 570 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 571 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 572 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 573 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 574 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 575 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 576 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 577 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 578 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 579 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 580 | 2561511100 | Mesoplasma photuris ATCC 49581 | Isolate | Unclassified |
| 581 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 582 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 583 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 584 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 585 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 586 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 587 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 588 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 589 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 590 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 591 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 592 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 593 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 594 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 595 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 596 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 597 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 598 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 599 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 600 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 601 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 602 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 603 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 604 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 605 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 606 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 607 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 608 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 609 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 610 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 611 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 612 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 613 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 614 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 615 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 616 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 617 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 618 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 619 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 620 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 621 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 622 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 623 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 624 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 625 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 626 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 627 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 628 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 629 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 630 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 631 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 632 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 633 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 634 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 635 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 636 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 637 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 638 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 639 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 640 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 641 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 642 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 643 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 644 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 645 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 646 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 647 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 648 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 649 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 650 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 651 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 652 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 653 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 654 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 655 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 656 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 657 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 658 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 659 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 660 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 661 | 3300060701 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 662 | 3300060703 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 663 | 3300060704 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 664 | 3300060750 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 665 | 3300060755 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 666 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 667 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 668 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 669 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 670 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 671 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 672 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 673 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 674 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 675 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 676 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 677 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 678 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 679 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 680 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 681 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 682 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 683 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 684 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 685 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 686 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 687 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 688 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 689 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 690 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 691 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 692 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 693 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 694 | 2541047151 | Spiroplasma melliferum IPMB4A | Isolate | Apidae |
| 695 | 2554235381 | Spiroplasma syrphidicola EA-1 | Isolate | Syrphidae |
| 696 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 697 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 698 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 699 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 700 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 701 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 702 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 703 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 704 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 705 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 706 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 707 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 708 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 709 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 710 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 711 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 712 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 713 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 714 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 715 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 716 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 717 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 718 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 719 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 720 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 721 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 722 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 723 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 724 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 725 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 726 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 727 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 728 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 729 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 730 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 731 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 732 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 733 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 734 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 735 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 736 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 737 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 738 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 739 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 740 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 741 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 742 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 743 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 744 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 745 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 746 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 747 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 748 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 749 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 750 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 751 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 752 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 753 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 754 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 755 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 756 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
| 757 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 758 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 759 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 760 | 3300060775 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 761 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 762 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 763 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 764 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 765 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 766 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 767 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 768 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 769 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 770 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 771 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 772 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 773 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 774 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 775 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 776 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 777 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 778 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 779 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_220836 | 3300042659 | Bacteria | 30432 |
| 2 | Ga0466733_221529 | 3300042659 | Bacteria | 2558 |
| 3 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 4 | Ga0562378_0255 | 3300056814 | Unclassified | 123233 |
| 5 | Ga0562377_0047 | 3300056842 | Bacteria | 585239 |
| 6 | Ga0562377_0948 | 3300056842 | Unclassified | 36922 |
| 7 | Ga0562377_1217 | 3300056842 | Bacteria | 29182 |
| 8 | Ga0562377_1301 | 3300056842 | Unclassified | 27338 |
| 9 | Ga0562375_0036 | 3300056856 | Bacteria | 609533 |
| 10 | Ga0562375_0603 | 3300056856 | Bacteria | 69159 |
| 11 | Ga0562376_4311 | 3300056857 | Bacteria | 12142 |
| 12 | Ga0123355_10227716 | 3300009826 | Unclassified | 2668 |
| 13 | Ga0123356_10176849 | 3300010049 | Bacteria | 2151 |
| 14 | Ga0123356_10195051 | 3300010049 | Bacteria | 2060 |
| 15 | Ga0123356_10219767 | 3300010049 | Bacteria | 1956 |
| 16 | Ga0123354_10119371 | 3300010882 | Bacteria | 3416 |
| 17 | Ga0466705_466256 | 3300042612 | Bacteria | 6754 |
| 18 | Ga0466715_464890 | 3300042616 | Bacteria | 1884 |
| 19 | Ga0466715_620245 | 3300042616 | Bacteria | 30740 |
| 20 | Ga0466723_120994 | 3300042618 | Bacteria | 5505 |
| 21 | Ga0466723_196940 | 3300042618 | Bacteria | 17355 |
| 22 | Ga0466723_226636 | 3300042618 | Bacteria | 4360 |
| 23 | Ga0466726_375636 | 3300042619 | Bacteria | 21985 |
| 24 | Ga0466735_164684 | 3300042624 | Bacteria | 17490 |
| 25 | Ga0466703_137773 | 3300042636 | Unclassified | 6380 |
| 26 | Ga0466703_138789 | 3300042636 | Bacteria | 30404 |
| 27 | Ga0466703_204140 | 3300042636 | Bacteria | 5552 |
| 28 | Ga0466703_282255 | 3300042636 | Bacteria | 11125 |
| 29 | Ga0466704_299023 | 3300042643 | Bacteria | 12258 |
| 30 | Ga0466704_393617 | 3300042643 | Bacteria | 75094 |
| 31 | Ga0466724_18481 | 3300042649 | Bacteria | 159472 |
| 32 | Ga0466724_18525 | 3300042649 | Bacteria | 22500 |
| 33 | Ga0466708_129698 | 3300042652 | Bacteria | 22151 |
| 34 | Ga0466708_324253 | 3300042652 | Bacteria | 2769 |
| 35 | Ga0466725_412402 | 3300042654 | Bacteria | 4027 |
| 36 | Ga0466727_272611 | 3300042655 | Unclassified | 1475 |
| 37 | Ga0466706_175147 | 3300042599 | Bacteria | 20897 |
| 38 | Ga0466707_341341 | 3300042601 | Bacteria | 164517 |
| 39 | Ga0466707_384798 | 3300042601 | Bacteria | 79427 |
| 40 | Ga0466716_046761 | 3300042605 | Bacteria | 4116 |
| 41 | Ga0466716_321476 | 3300042605 | Bacteria | 49085 |
| 42 | Ga0466722_122527 | 3300042609 | Bacteria | 52518 |
| 43 | Ga0466698_026234 | 3300042610 | Bacteria | 3924 |
| 44 | 2227444699 | 2225789004 | Bacteria | 5463 |
| 45 | IMNBL1DRAFT_c0002809 | 3300000062 | Bacteria | 11774 |
| 46 | JGI24700J35501_10930918 | 3300002508 | Bacteria | 45536 |
| 47 | CVPL005W_1000114 | 3300002934 | Bacteria | 33423 |
| 48 | Ga0063521_1001902 | 3300003973 | Unclassified | 5332 |
| 49 | Ga0102734_1000126 | 3300007129 | Bacteria | 36824 |
| 50 | Ga0102737_1001254 | 3300007142 | Bacteria | 7280 |
| 51 | Ga0102737_1001418 | 3300007142 | Unclassified | 6695 |
| 52 | Ga0103264_1000088 | 3300007188 | Bacteria | 92446 |
| 53 | Ga0103264_1000421 | 3300007188 | Bacteria | 21971 |
| 54 | Ga0103267_1000042 | 3300007190 | Bacteria | 46742 |
| 55 | Ga0103268_1000772 | 3300007192 | Bacteria | 9023 |
| 56 | Ga0103268_1001325 | 3300007192 | Unclassified | 6268 |
| 57 | Ga0127649_103247 | 3300009460 | Bacteria | 10436 |
| 58 | Ga0123357_10000152 | 3300009784 | Bacteria | 61683 |
| 59 | Ga0160456_100563 | 3300012820 | Bacteria | 11188 |
| 60 | Ga0160441_100828 | 3300012825 | Bacteria | 15454 |
| 61 | Ga0160472_100084 | 3300012839 | Bacteria | 151562 |
| 62 | Ga0160460_100165 | 3300012845 | Bacteria | 73034 |
| 63 | Ga0160443_104419 | 3300012848 | Unclassified | 2113 |
| 64 | Ga0466690_391759 | 3300042590 | Unclassified | 1517 |
| 65 | Ga0466690_418872 | 3300042590 | Bacteria | 12428 |
| 66 | Ga0466691_133209 | 3300042593 | Bacteria | 2777 |
| 67 | Ga0466696_322532 | 3300042596 | Bacteria | 10128 |
| 68 | Ga0466705_109076 | 3300042612 | Bacteria | 9854 |
| 69 | Ga0466733_180935 | 3300042659 | Bacteria | 3752 |
| 70 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 71 | Ga0562378_0843 | 3300056814 | Unclassified | 41007 |
| 72 | Ga0562377_0008 | 3300056842 | Bacteria | 1610398 |
| 73 | Ga0562377_0231 | 3300056842 | Bacteria | 134767 |
| 74 | Ga0562376_3076 | 3300056857 | Unclassified | 17881 |
| 75 | Ga0562376_3405 | 3300056857 | Unclassified | 16087 |
| 76 | Ga0562374_1187 | 3300057007 | Unclassified | 32810 |
| 77 | Ga0562374_2997 | 3300057007 | Unclassified | 11672 |
| 78 | Ga0590810_00471 | 3300060703 | Unclassified | 3052 |
| 79 | Ga0123357_10016893 | 3300009784 | Bacteria | 9632 |
| 80 | Ga0123357_10059650 | 3300009784 | Bacteria | 5119 |
| 81 | Ga0123355_10023115 | 3300009826 | Bacteria | 9977 |
| 82 | Ga0123355_10040495 | 3300009826 | Bacteria | 7583 |
| 83 | Ga0123355_10051648 | 3300009826 | Bacteria | 6671 |
| 84 | Ga0123356_10003281 | 3300010049 | Bacteria | 16995 |
| 85 | Ga0123353_10269756 | 3300010167 | Bacteria | 2623 |
| 86 | Ga0466705_451743 | 3300042612 | Bacteria | 5517 |
| 87 | Ga0466705_517528 | 3300042612 | Unclassified | 6197 |
| 88 | Ga0466711_083224 | 3300042615 | Bacteria | 16231 |
| 89 | Ga0466715_130468 | 3300042616 | Bacteria | 16984 |
| 90 | Ga0466718_157947 | 3300042617 | Bacteria | 3044 |
| 91 | Ga0466723_109114 | 3300042618 | Bacteria | 15810 |
| 92 | Ga0466723_125331 | 3300042618 | Bacteria | 36330 |
| 93 | Ga0466726_336591 | 3300042619 | Bacteria | 3116 |
| 94 | Ga0466728_307727 | 3300042620 | Bacteria | 4731 |
| 95 | Ga0466728_341068 | 3300042620 | Bacteria | 15029 |
| 96 | Ga0466729_148180 | 3300042621 | Bacteria | 106613 |
| 97 | Ga0466734_003772 | 3300042623 | Bacteria | 1694 |
| 98 | Ga0466703_023258 | 3300042636 | Bacteria | 13123 |
| 99 | Ga0466703_417847 | 3300042636 | Bacteria | 93327 |
| 100 | Ga0466704_198945 | 3300042643 | Bacteria | 26642 |
| 101 | Ga0466727_290526 | 3300042655 | Bacteria | 40242 |
| 102 | Ga0466706_093299 | 3300042599 | Bacteria | 58976 |
| 103 | Ga0466700_119788 | 3300042600 | Bacteria | 12531 |
| 104 | Ga0466707_099536 | 3300042601 | Bacteria | 3451 |
| 105 | Ga0466707_316107 | 3300042601 | Bacteria | 20051 |
| 106 | Ga0466707_342229 | 3300042601 | Bacteria | 17191 |
| 107 | Ga0466713_076445 | 3300042602 | Bacteria | 18163 |
| 108 | Ga0466717_190552 | 3300042604 | Bacteria | 2321 |
| 109 | Ga0466719_026951 | 3300042606 | Bacteria | 5809 |
| 110 | Ga0466719_056176 | 3300042606 | Bacteria | 9347 |
| 111 | Ga0466719_310165 | 3300042606 | Bacteria | 2522 |
| 112 | Ga0466721_178644 | 3300042608 | Bacteria | 2105 |
| 113 | Ga0466722_216216 | 3300042609 | Bacteria | 2105 |
| 114 | Ga0466722_237473 | 3300042609 | Bacteria | 43452 |
| 115 | Ga0466698_433684 | 3300042610 | Unclassified | 5328 |
| 116 | 2227145822 | 2225789004 | Bacteria | 1605 |
| 117 | 2227532943 | 2225789004 | Bacteria | 16332 |
| 118 | IMNBL1DRAFT_c0006849 | 3300000062 | Bacteria | 6129 |
| 119 | JGI24703J35330_11747923 | 3300002501 | Bacteria | 9129 |
| 120 | CVPL010W_10000025 | 3300002931 | Bacteria | 82116 |
| 121 | CVPL010L_1000065 | 3300002932 | Unclassified | 54722 |
| 122 | CVPL005W_1000212 | 3300002934 | Bacteria | 28542 |
| 123 | Ga0068305_10049040 | 3300005083 | Bacteria | 5528 |
| 124 | Ga0068305_10060901 | 3300005083 | Bacteria | 5327 |
| 125 | Ga0072940_1018348 | 3300005200 | Bacteria | 15035 |
| 126 | Ga0072941_1119041 | 3300005201 | Bacteria | 4397 |
| 127 | Ga0072941_1237283 | 3300005201 | Bacteria | 5447 |
| 128 | Ga0103266_1000010 | 3300007067 | Bacteria | 102423 |
| 129 | Ga0102735_1000037 | 3300007080 | Bacteria | 61745 |
| 130 | Ga0102734_1000376 | 3300007129 | Bacteria | 37229 |
| 131 | Ga0105524_100666 | 3300007733 | Bacteria | 16261 |
| 132 | Ga0111035_105906 | 3300007901 | Bacteria | 8836 |
| 133 | Ga0123357_10002153 | 3300009784 | Bacteria | 21707 |
| 134 | Ga0160467_100235 | 3300012829 | Bacteria | 69110 |
| 135 | Ga0160457_1000023 | 3300012858 | Bacteria | 328177 |
| 136 | Ga0160457_1000054 | 3300012858 | Bacteria | 181933 |
| 137 | Ga0160457_1001523 | 3300012858 | Bacteria | 6263 |
| 138 | Ga0264413_130088 | 3300024493 | Unclassified | 2967 |
| 139 | Ga0309903_100003 | 3300029809 | Bacteria | 120869 |
| 140 | Ga0466691_046490 | 3300042593 | Bacteria | 17279 |
| 141 | Ga0466694_013411 | 3300042594 | Bacteria | 11601 |
| 142 | Ga0466696_210459 | 3300042596 | Bacteria | 2001 |
| 143 | Ga0466696_441147 | 3300042596 | Bacteria | 1694 |
| 144 | Ga0466699_364762 | 3300042597 | Bacteria | 2043 |
| 145 | Ga0466705_215891 | 3300042612 | Bacteria | 32568 |
| 146 | Ga0466705_254904 | 3300042612 | Bacteria | 20666 |
| 147 | Ga0466705_289079 | 3300042612 | Bacteria | 4252 |
| 148 | Ga0466705_319321 | 3300042612 | Bacteria | 167328 |
| 149 | Ga0530661_000880 | 3300056564 | Unclassified | 18586 |
| 150 | Ga0562379_0006 | 3300056790 | Bacteria | 2459409 |
| 151 | Ga0562379_0204 | 3300056790 | Bacteria | 168255 |
| 152 | Ga0562379_0323 | 3300056790 | Bacteria | 117518 |
| 153 | Ga0562379_0410 | 3300056790 | Bacteria | 93813 |
| 154 | Ga0562379_3177 | 3300056790 | Unclassified | 11554 |
| 155 | Ga0562377_0900 | 3300056842 | Unclassified | 38838 |
| 156 | Ga0562377_1247 | 3300056842 | Unclassified | 28556 |
| 157 | Ga0562377_1757 | 3300056842 | Bacteria | 20138 |
| 158 | Ga0562375_2486 | 3300056856 | Unclassified | 20531 |
| 159 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 160 | Ga0562374_0271 | 3300057007 | Bacteria | 102985 |
| 161 | Ga0590811_00081 | 3300060704 | Unclassified | 7134 |
| 162 | Ga0590788_00094 | 3300060765 | Unclassified | 6833 |
| 163 | Ga0590792_00062 | 3300060768 | Unclassified | 7015 |
| 164 | Ga0590798_00954 | 3300060774 | Bacteria | 2284 |
| 165 | Ga0590771_00025 | 3300061799 | Unclassified | 7938 |
| 166 | Ga0123357_10168064 | 3300009784 | Bacteria | 2604 |
| 167 | Ga0123357_10194819 | 3300009784 | Bacteria | 2324 |
| 168 | Ga0123356_10003579 | 3300010049 | Bacteria | 16235 |
| 169 | Ga0123353_10026127 | 3300010167 | Bacteria | 8911 |
| 170 | Ga0160464_100673 | 3300012805 | Bacteria | 20674 |
| 171 | Ga0466715_345663 | 3300042616 | Bacteria | 19788 |
| 172 | Ga0466715_373478 | 3300042616 | Bacteria | 15598 |
| 173 | Ga0466715_524120 | 3300042616 | Bacteria | 9835 |
| 174 | Ga0466715_569936 | 3300042616 | Bacteria | 13425 |
| 175 | Ga0466726_110208 | 3300042619 | Bacteria | 23615 |
| 176 | Ga0466726_268419 | 3300042619 | Bacteria | 2000 |
| 177 | Ga0466728_248718 | 3300042620 | Bacteria | 11138 |
| 178 | Ga0466735_213174 | 3300042624 | Bacteria | 4500 |
| 179 | Ga0466703_014010 | 3300042636 | Bacteria | 12768 |
| 180 | Ga0466703_048402 | 3300042636 | Bacteria | 91221 |
| 181 | Ga0466703_051482 | 3300042636 | Bacteria | 19332 |
| 182 | Ga0466704_191611 | 3300042643 | Bacteria | 19750 |
| 183 | Ga0466709_117176 | 3300042648 | Unclassified | 60840 |
| 184 | Ga0466724_25669 | 3300042649 | Bacteria | 9390 |
| 185 | Ga0466724_35496 | 3300042649 | Bacteria | 5825 |
| 186 | Ga0466708_261973 | 3300042652 | Bacteria | 16143 |
| 187 | Ga0466727_164752 | 3300042655 | Bacteria | 2219 |
| 188 | Ga0466701_028952 | 3300042598 | Bacteria | 142052 |
| 189 | Ga0466701_057237 | 3300042598 | Bacteria | 162355 |
| 190 | Ga0466707_288583 | 3300042601 | Bacteria | 12239 |
| 191 | Ga0466713_006380 | 3300042602 | Bacteria | 123817 |
| 192 | IMNBGM34_c000060 | 3300000036 | Bacteria | 31148 |
| 193 | HBC_ctgsDRAFT_1012833 | 3300000333 | Bacteria | 2012 |
| 194 | CVPL010L_1000003 | 3300002932 | Bacteria | 150513 |
| 195 | CVPL005W_1000635 | 3300002934 | Bacteria | 16107 |
| 196 | CVPL005L_10000006 | 3300002938 | Bacteria | 217355 |
| 197 | CVPL005L_10005581 | 3300002938 | Bacteria | 18319 |
| 198 | Ga0072941_1012493 | 3300005201 | Bacteria | 10258 |
| 199 | Ga0074278_119675 | 3300005721 | Bacteria | 5800 |
| 200 | Ga0103261_1001916 | 3300007083 | Unclassified | 3293 |
| 201 | Ga0102740_1000054 | 3300007140 | Unclassified | 27264 |
| 202 | Ga0102737_1001023 | 3300007142 | Unclassified | 13314 |
| 203 | Ga0102737_1003100 | 3300007142 | Unclassified | 3904 |
| 204 | Ga0103264_1001667 | 3300007188 | Bacteria | 34243 |
| 205 | Ga0103264_1001997 | 3300007188 | Bacteria | 12475 |
| 206 | Ga0103264_1002205 | 3300007188 | Bacteria | 8724 |
| 207 | Ga0103267_1000028 | 3300007190 | Bacteria | 52707 |
| 208 | Ga0103268_1002197 | 3300007192 | Unclassified | 4434 |
| 209 | Ga0105553_1035243 | 3300007767 | Bacteria | 9286 |
| 210 | Ga0160458_100020 | 3300012832 | Bacteria | 275525 |
| 211 | Ga0160447_100755 | 3300012849 | Unclassified | 13946 |
| 212 | Ga0157631_106338 | 3300013007 | Bacteria | 2244 |
| 213 | Ga0466692_127558 | 3300042591 | Bacteria | 24546 |
| 214 | Ga0466692_145345 | 3300042591 | Bacteria | 28066 |
| 215 | Ga0466692_153394 | 3300042591 | Bacteria | 32696 |
| 216 | Ga0466693_107735 | 3300042592 | Bacteria | 2665 |
| 217 | Ga0466691_021650 | 3300042593 | Bacteria | 4315 |
| 218 | Ga0466691_114549 | 3300042593 | Bacteria | 24170 |
| 219 | Ga0466691_169994 | 3300042593 | Bacteria | 3651 |
| 220 | Ga0466733_155466 | 3300042659 | Bacteria | 9058 |
| 221 | Ga0530661_002296 | 3300056564 | Bacteria | 7462 |
| 222 | Ga0562378_0090 | 3300056814 | Unclassified | 252542 |
| 223 | Ga0562377_0509 | 3300056842 | Bacteria | 61655 |
| 224 | Ga0562377_1463 | 3300056842 | Unclassified | 24160 |
| 225 | Ga0562376_1235 | 3300056857 | Unclassified | 37106 |
| 226 | Ga0590807_00042 | 3300060700 | Unclassified | 6798 |
| 227 | Ga0590766_00064 | 3300060752 | Unclassified | 9360 |
| 228 | Ga0590784_01680 | 3300060763 | Unclassified | 3102 |
| 229 | Ga0123357_10007403 | 3300009784 | Bacteria | 13561 |
| 230 | Ga0123357_10011369 | 3300009784 | Bacteria | 11407 |
| 231 | Ga0123355_10089385 | 3300009826 | Unclassified | 4889 |
| 232 | Ga0123355_10366023 | 3300009826 | Bacteria | 1894 |
| 233 | Ga0123354_10000050 | 3300010882 | Bacteria | 89235 |
| 234 | Ga0123354_10000061 | 3300010882 | Bacteria | 80242 |
| 235 | Ga0123354_10017831 | 3300010882 | Bacteria | 11123 |
| 236 | Ga0123354_10113991 | 3300010882 | Bacteria | 3546 |
| 237 | Ga0466711_214658 | 3300042615 | Bacteria | 15836 |
| 238 | Ga0466715_225527 | 3300042616 | Bacteria | 12993 |
| 239 | Ga0466715_401541 | 3300042616 | Bacteria | 3140 |
| 240 | Ga0466715_532527 | 3300042616 | Bacteria | 2294 |
| 241 | Ga0466715_553362 | 3300042616 | Bacteria | 11746 |
| 242 | Ga0466723_022551 | 3300042618 | Bacteria | 13991 |
| 243 | Ga0466723_222440 | 3300042618 | Bacteria | 33124 |
| 244 | Ga0466726_096724 | 3300042619 | Bacteria | 86105 |
| 245 | Ga0466726_493032 | 3300042619 | Bacteria | 8097 |
| 246 | Ga0466728_136237 | 3300042620 | Unclassified | 5395 |
| 247 | Ga0466728_187032 | 3300042620 | Bacteria | 4851 |
| 248 | Ga0466734_055114 | 3300042623 | Bacteria | 7866 |
| 249 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 250 | Ga0466704_163383 | 3300042643 | Bacteria | 19832 |
| 251 | Ga0466704_378891 | 3300042643 | Bacteria | 31782 |
| 252 | Ga0466704_611002 | 3300042643 | Bacteria | 7607 |
| 253 | Ga0466709_278847 | 3300042648 | Unclassified | 5502 |
| 254 | Ga0466724_08058 | 3300042649 | Bacteria | 6350 |
| 255 | Ga0466727_139969 | 3300042655 | Bacteria | 96451 |
| 256 | Ga0466706_114680 | 3300042599 | Bacteria | 2185 |
| 257 | Ga0466706_237024 | 3300042599 | Bacteria | 3308 |
| 258 | Ga0466707_204757 | 3300042601 | Bacteria | 96467 |
| 259 | Ga0466716_540993 | 3300042605 | Bacteria | 22338 |
| 260 | Ga0466719_176880 | 3300042606 | Bacteria | 6550 |
| 261 | Ga0466719_198240 | 3300042606 | Unclassified | 2751 |
| 262 | Ga0466720_154382 | 3300042607 | Bacteria | 21279 |
| 263 | Ga0466722_092967 | 3300042609 | Bacteria | 4179 |
| 264 | Ga0466722_149612 | 3300042609 | Bacteria | 5722 |
| 265 | Ga0466698_251765 | 3300042610 | Bacteria | 2734 |
| 266 | 2227518256 | 2225789004 | Bacteria | 3390 |
| 267 | IMNBL1DRAFT_c0001089 | 3300000062 | Bacteria | 20838 |
| 268 | IMNBL1DRAFT_c0004196 | 3300000062 | Bacteria | 8758 |
| 269 | JGI24705J35276_12235453 | 3300002504 | Bacteria | 6544 |
| 270 | CVPL010W_10006085 | 3300002931 | Bacteria | 12567 |
| 271 | CVPL010W_10010080 | 3300002931 | Bacteria | 8321 |
| 272 | CVPL005L_10005856 | 3300002938 | Bacteria | 12395 |
| 273 | Ga0063521_1001406 | 3300003973 | Bacteria | 6665 |
| 274 | Ga0102733_100003 | 3300006995 | Bacteria | 141982 |
| 275 | Ga0103263_100113 | 3300007042 | Bacteria | 14674 |
| 276 | Ga0102736_1000037 | 3300007052 | Unclassified | 40308 |
| 277 | Ga0103266_1000004 | 3300007067 | Bacteria | 133035 |
| 278 | Ga0102735_1000009 | 3300007080 | Bacteria | 56509 |
| 279 | Ga0104045_1004826 | 3300007085 | Bacteria | 35989 |
| 280 | Ga0103260_1000032 | 3300007139 | Unclassified | 55227 |
| 281 | Ga0104048_1000101 | 3300007143 | Unclassified | 10911 |
| 282 | Ga0104050_1005514 | 3300007153 | Bacteria | 12385 |
| 283 | Ga0103268_1000745 | 3300007192 | Unclassified | 15918 |
| 284 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 285 | Ga0160459_100004 | 3300012831 | Bacteria | 605685 |
| 286 | Ga0160458_100716 | 3300012832 | Bacteria | 10692 |
| 287 | Ga0160433_100239 | 3300012846 | Bacteria | 39847 |
| 288 | Ga0160433_100313 | 3300012846 | Bacteria | 31174 |
| 289 | Ga0160443_100028 | 3300012848 | Bacteria | 368417 |
| 290 | Ga0160457_1000771 | 3300012858 | Bacteria | 11564 |
| 291 | Ga0255572_1000199 | 3300026175 | Bacteria | 67353 |
| 292 | Ga0309904_1000013 | 3300029810 | Bacteria | 45334 |
| 293 | Ga0466656_386996 | 3300042550 | Bacteria | 2749 |
| 294 | Ga0466692_071759 | 3300042591 | Bacteria | 6280 |
| 295 | Ga0466693_056620 | 3300042592 | Bacteria | 145249 |
| 296 | Ga0466691_209440 | 3300042593 | Unclassified | 1810 |
| 297 | Ga0466696_089527 | 3300042596 | Bacteria | 7213 |
| 298 | Ga0466696_146790 | 3300042596 | Bacteria | 19807 |
| 299 | Ga0466696_496114 | 3300042596 | Bacteria | 17891 |
| 300 | Ga0466699_022115 | 3300042597 | Bacteria | 11238 |
| 301 | Ga0466697_173448 | 3300042611 | Bacteria | 4005 |
| 302 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 303 | Ga0562379_0038 | 3300056790 | Bacteria | 649117 |
| 304 | Ga0562379_0039 | 3300056790 | Bacteria | 641946 |
| 305 | Ga0562378_1827 | 3300056814 | Unclassified | 20842 |
| 306 | Ga0562378_3587 | 3300056814 | Unclassified | 8815 |
| 307 | Ga0562375_0268 | 3300056856 | Unclassified | 134431 |
| 308 | Ga0562375_6377 | 3300056856 | Unclassified | 4869 |
| 309 | Ga0562374_1706 | 3300057007 | Unclassified | 24172 |
| 310 | Ga0590808_00526 | 3300060701 | Unclassified | 3042 |
| 311 | Ga0590776_00892 | 3300060759 | Unclassified | 3692 |
| 312 | Ga0590796_00055 | 3300060772 | Unclassified | 8881 |
| 313 | Ga0590799_01153 | 3300060775 | Unclassified | 3073 |
| 314 | Ga0123357_10029920 | 3300009784 | Bacteria | 7384 |
| 315 | Ga0123356_10003022 | 3300010049 | Bacteria | 17766 |
| 316 | Ga0160454_101953 | 3300012798 | Bacteria | 2615 |
| 317 | Ga0160442_100005 | 3300012806 | Bacteria | 613537 |
| 318 | Ga0466705_420380 | 3300042612 | Bacteria | 591368 |
| 319 | Ga0466711_059102 | 3300042615 | Bacteria | 5684 |
| 320 | Ga0466711_215438 | 3300042615 | Bacteria | 5466 |
| 321 | Ga0466715_103166 | 3300042616 | Bacteria | 7204 |
| 322 | Ga0466715_195743 | 3300042616 | Bacteria | 11970 |
| 323 | Ga0466718_084370 | 3300042617 | Bacteria | 6226 |
| 324 | Ga0466726_344702 | 3300042619 | Bacteria | 3070 |
| 325 | Ga0466702_223189 | 3300042635 | Bacteria | 2881 |
| 326 | Ga0466702_247181 | 3300042635 | Bacteria | 33626 |
| 327 | Ga0466703_081795 | 3300042636 | Bacteria | 7630 |
| 328 | Ga0466703_248560 | 3300042636 | Bacteria | 44932 |
| 329 | Ga0466703_391425 | 3300042636 | Bacteria | 18627 |
| 330 | Ga0466703_422881 | 3300042636 | Bacteria | 44036 |
| 331 | Ga0466704_449429 | 3300042643 | Bacteria | 4056 |
| 332 | Ga0466724_02720 | 3300042649 | Bacteria | 247008 |
| 333 | Ga0466708_026012 | 3300042652 | Bacteria | 23006 |
| 334 | Ga0466708_169035 | 3300042652 | Bacteria | 17320 |
| 335 | Ga0466725_085374 | 3300042654 | Bacteria | 33319 |
| 336 | Ga0466727_157431 | 3300042655 | Bacteria | 20639 |
| 337 | Ga0466727_182819 | 3300042655 | Bacteria | 12627 |
| 338 | Ga0466701_068352 | 3300042598 | Bacteria | 11681 |
| 339 | Ga0466716_328734 | 3300042605 | Bacteria | 9370 |
| 340 | Ga0466719_097002 | 3300042606 | Bacteria | 2331 |
| 341 | Ga0466719_192771 | 3300042606 | Bacteria | 52306 |
| 342 | Ga0466719_450514 | 3300042606 | Bacteria | 3159 |
| 343 | Ga0466719_477917 | 3300042606 | Bacteria | 48959 |
| 344 | Ga0466722_003533 | 3300042609 | Bacteria | 2421 |
| 345 | Ga0466722_150655 | 3300042609 | Bacteria | 5384 |
| 346 | Ga0466722_180831 | 3300042609 | Bacteria | 10794 |
| 347 | IMNBL1DRAFT_c0000021 | 3300000062 | Bacteria | 148886 |
| 348 | IMNBL1DRAFT_c0010627 | 3300000062 | Bacteria | 4376 |
| 349 | SCG598O11_12225 | 3300000471 | Bacteria | 128113 |
| 350 | JGI24703J35330_11747433 | 3300002501 | Bacteria | 6878 |
| 351 | JGI24703J35330_11748729 | 3300002501 | Bacteria | 29398 |
| 352 | JGI24705J35276_12238340 | 3300002504 | Bacteria | 19554 |
| 353 | CVPL010W_10000640 | 3300002931 | Bacteria | 38354 |
| 354 | CVPL010W_10002167 | 3300002931 | Bacteria | 23001 |
| 355 | CVPL010W_10013583 | 3300002931 | Unclassified | 6167 |
| 356 | CVPL005L_10000910 | 3300002938 | Bacteria | 32877 |
| 357 | Ga0068305_10140185 | 3300005083 | Bacteria | 1812 |
| 358 | Ga0072941_1225073 | 3300005201 | Bacteria | 3119 |
| 359 | Ga0102739_1000153 | 3300007095 | Bacteria | 19022 |
| 360 | Ga0102740_1001048 | 3300007140 | Unclassified | 8402 |
| 361 | Ga0102738_1000011 | 3300007141 | Bacteria | 105735 |
| 362 | Ga0102737_1005909 | 3300007142 | Bacteria | 2391 |
| 363 | Ga0105006_1203566 | 3300007506 | Bacteria | 2685 |
| 364 | Ga0127649_102308 | 3300009460 | Bacteria | 79074 |
| 365 | Ga0160470_102482 | 3300012813 | Bacteria | 3458 |
| 366 | Ga0160440_100003 | 3300012815 | Bacteria | 688892 |
| 367 | Ga0160440_100022 | 3300012815 | Bacteria | 270723 |
| 368 | Ga0160452_100367 | 3300012834 | Bacteria | 37149 |
| 369 | Ga0160472_101132 | 3300012839 | Bacteria | 8945 |
| 370 | Ga0160445_100015 | 3300012847 | Bacteria | 266913 |
| 371 | Ga0160445_104264 | 3300012847 | Bacteria | 2649 |
| 372 | Ga0255572_1000005 | 3300026175 | Bacteria | 243479 |
| 373 | Ga0255572_1000022 | 3300026175 | Bacteria | 127369 |
| 374 | Ga0466656_174500 | 3300042550 | Bacteria | 1992 |
| 375 | Ga0466657_111567 | 3300042582 | Bacteria | 14060 |
| 376 | Ga0466657_217169 | 3300042582 | Bacteria | 65749 |
| 377 | Ga0466690_183584 | 3300042590 | Bacteria | 6440 |
| 378 | Ga0466692_040528 | 3300042591 | Bacteria | 123812 |
| 379 | Ga0466696_162694 | 3300042596 | Bacteria | 15017 |
| 380 | Ga0466699_207178 | 3300042597 | Bacteria | 1601 |
| 381 | Ga0466705_214445 | 3300042612 | Bacteria | 2990 |
| 382 | Ga0562379_0407 | 3300056790 | Bacteria | 94492 |
| 383 | Ga0562378_0039 | 3300056814 | Bacteria | 444185 |
| 384 | Ga0562378_1799 | 3300056814 | Unclassified | 21096 |
| 385 | Ga0562377_0084 | 3300056842 | Bacteria | 343537 |
| 386 | Ga0562377_0637 | 3300056842 | Bacteria | 52563 |
| 387 | Ga0562376_0132 | 3300056857 | Bacteria | 164128 |
| 388 | Ga0562376_0604 | 3300056857 | Bacteria | 61358 |
| 389 | Ga0562376_2639 | 3300056857 | Unclassified | 20761 |
| 390 | Ga0562376_5377 | 3300056857 | Unclassified | 8432 |
| 391 | Ga0562374_0043 | 3300057007 | Bacteria | 619745 |
| 392 | Ga0590764_00318 | 3300060751 | Unclassified | 3161 |
| 393 | Ga0123357_10077680 | 3300009784 | Bacteria | 4378 |
| 394 | Ga0123357_10128894 | 3300009784 | Bacteria | 3157 |
| 395 | Ga0123355_10014435 | 3300009826 | Bacteria | 12359 |
| 396 | Ga0123355_10036804 | 3300009826 | Bacteria | 7958 |
| 397 | Ga0123355_10052200 | 3300009826 | Bacteria | 6634 |
| 398 | Ga0123356_10041228 | 3300010049 | Bacteria | 4302 |
| 399 | Ga0466705_509944 | 3300042612 | Bacteria | 5282 |
| 400 | Ga0466705_518115 | 3300042612 | Bacteria | 5321 |
| 401 | Ga0466710_279789 | 3300042613 | Bacteria | 12169 |
| 402 | Ga0466710_336325 | 3300042613 | Bacteria | 1803 |
| 403 | Ga0466712_172315 | 3300042614 | Bacteria | 5241 |
| 404 | Ga0466715_038059 | 3300042616 | Bacteria | 5552 |
| 405 | Ga0466715_050114 | 3300042616 | Bacteria | 8543 |
| 406 | Ga0466715_132551 | 3300042616 | Bacteria | 2164 |
| 407 | Ga0466723_027439 | 3300042618 | Bacteria | 14482 |
| 408 | Ga0466723_028291 | 3300042618 | Bacteria | 11455 |
| 409 | Ga0466723_069167 | 3300042618 | Bacteria | 17621 |
| 410 | Ga0466726_086290 | 3300042619 | Bacteria | 5525 |
| 411 | Ga0466726_293672 | 3300042619 | Bacteria | 1777 |
| 412 | Ga0466728_222526 | 3300042620 | Bacteria | 4330 |
| 413 | Ga0466730_095252 | 3300042625 | Bacteria | 126847 |
| 414 | Ga0466704_065021 | 3300042643 | Bacteria | 297957 |
| 415 | Ga0466708_125903 | 3300042652 | Bacteria | 7553 |
| 416 | Ga0466725_115071 | 3300042654 | Bacteria | 4993 |
| 417 | Ga0466727_206639 | 3300042655 | Bacteria | 2380 |
| 418 | Ga0466727_225049 | 3300042655 | Bacteria | 48864 |
| 419 | Ga0466701_072203 | 3300042598 | Bacteria | 12466 |
| 420 | Ga0466706_080441 | 3300042599 | Bacteria | 247551 |
| 421 | Ga0466706_172364 | 3300042599 | Bacteria | 12566 |
| 422 | Ga0466706_174826 | 3300042599 | Bacteria | 4319 |
| 423 | Ga0466707_073565 | 3300042601 | Bacteria | 17218 |
| 424 | Ga0466707_150682 | 3300042601 | Bacteria | 8801 |
| 425 | Ga0466713_044065 | 3300042602 | Bacteria | 5492 |
| 426 | Ga0466713_149517 | 3300042602 | Bacteria | 77741 |
| 427 | Ga0466717_303734 | 3300042604 | Bacteria | 2301 |
| 428 | Ga0466716_315650 | 3300042605 | Bacteria | 6082 |
| 429 | Ga0466716_470373 | 3300042605 | Bacteria | 2715 |
| 430 | Ga0466719_011981 | 3300042606 | Bacteria | 1900 |
| 431 | Ga0466719_310427 | 3300042606 | Bacteria | 3428 |
| 432 | IMNBL1DRAFT_c0000442 | 3300000062 | Bacteria | 34795 |
| 433 | SCG598O02_12513 | 3300000460 | Bacteria | 160606 |
| 434 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 435 | JGI24698J34947_10000919 | 3300002449 | Bacteria | 14948 |
| 436 | CVPL010W_10007813 | 3300002931 | Bacteria | 10363 |
| 437 | CVPL010W_10013945 | 3300002931 | Bacteria | 6610 |
| 438 | CVPL010L_1000596 | 3300002932 | Unclassified | 8895 |
| 439 | Ga0068302_10033768 | 3300005071 | Bacteria | 6992 |
| 440 | Ga0072941_1192125 | 3300005201 | Bacteria | 9182 |
| 441 | Ga0102736_1000481 | 3300007052 | Bacteria | 9944 |
| 442 | Ga0102739_1000244 | 3300007095 | Unclassified | 16316 |
| 443 | Ga0102734_1003289 | 3300007129 | Bacteria | 4881 |
| 444 | Ga0104048_1001248 | 3300007143 | Bacteria | 17721 |
| 445 | Ga0103264_1000102 | 3300007188 | Bacteria | 49840 |
| 446 | Ga0103264_1000114 | 3300007188 | Bacteria | 51929 |
| 447 | Ga0160446_100474 | 3300012835 | Unclassified | 17679 |
| 448 | Ga0160447_100404 | 3300012849 | Bacteria | 21355 |
| 449 | Ga0309902_000001 | 3300028910 | Bacteria | 348555 |
| 450 | Ga0247289_1647 | 3300035363 | Bacteria | 1897 |
| 451 | Ga0415639_078958 | 3300038395 | Bacteria | 2133 |
| 452 | Ga0466657_012444 | 3300042582 | Bacteria | 321104 |
| 453 | Ga0466691_019418 | 3300042593 | Bacteria | 6945 |
| 454 | Ga0466691_106319 | 3300042593 | Bacteria | 2963 |
| 455 | Ga0466691_225541 | 3300042593 | Bacteria | 6238 |
| 456 | Ga0466696_069257 | 3300042596 | Bacteria | 4467 |
| 457 | Ga0466696_373715 | 3300042596 | Bacteria | 21381 |
| 458 | Ga0562379_0025 | 3300056790 | Bacteria | 849184 |
| 459 | Ga0562379_0091 | 3300056790 | Bacteria | 324047 |
| 460 | Ga0562379_0317 | 3300056790 | Bacteria | 120244 |
| 461 | Ga0562379_1592 | 3300056790 | Bacteria | 24631 |
| 462 | Ga0562379_1909 | 3300056790 | Bacteria | 20360 |
| 463 | Ga0562378_1954 | 3300056814 | Unclassified | 19461 |
| 464 | Ga0562377_0040 | 3300056842 | Bacteria | 613468 |
| 465 | Ga0562377_0324 | 3300056842 | Unclassified | 95760 |
| 466 | Ga0562377_1859 | 3300056842 | Bacteria | 18880 |
| 467 | Ga0562377_2748 | 3300056842 | Unclassified | 11855 |
| 468 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 469 | Ga0590763_00335 | 3300060750 | Unclassified | 3069 |
| 470 | Ga0123357_10054194 | 3300009784 | Bacteria | 5407 |
| 471 | Ga0123356_10008378 | 3300010049 | Bacteria | 10281 |
| 472 | Ga0123356_10050426 | 3300010049 | Unclassified | 3873 |
| 473 | Ga0123356_10251520 | 3300010049 | Bacteria | 1845 |
| 474 | Ga0123353_10000326 | 3300010167 | Bacteria | 59029 |
| 475 | Ga0123354_10081842 | 3300010882 | Bacteria | 4556 |
| 476 | Ga0160454_100053 | 3300012798 | Bacteria | 174389 |
| 477 | Ga0466711_063520 | 3300042615 | Bacteria | 11449 |
| 478 | Ga0466715_127895 | 3300042616 | Bacteria | 15065 |
| 479 | Ga0466715_225213 | 3300042616 | Bacteria | 12111 |
| 480 | Ga0466715_357572 | 3300042616 | Bacteria | 181743 |
| 481 | Ga0466715_513090 | 3300042616 | Bacteria | 3735 |
| 482 | Ga0466718_070499 | 3300042617 | Bacteria | 5346 |
| 483 | Ga0466726_143651 | 3300042619 | Bacteria | 40576 |
| 484 | Ga0466726_157671 | 3300042619 | Bacteria | 25979 |
| 485 | Ga0466726_265968 | 3300042619 | Bacteria | 49048 |
| 486 | Ga0466728_076382 | 3300042620 | Bacteria | 2816 |
| 487 | Ga0466728_081746 | 3300042620 | Bacteria | 10342 |
| 488 | Ga0466734_003049 | 3300042623 | Bacteria | 6342 |
| 489 | Ga0466730_068250 | 3300042625 | Bacteria | 45257 |
| 490 | Ga0466703_165458 | 3300042636 | Bacteria | 7184 |
| 491 | Ga0466703_205043 | 3300042636 | Bacteria | 18531 |
| 492 | Ga0466703_353799 | 3300042636 | Bacteria | 98308 |
| 493 | Ga0466704_188604 | 3300042643 | Bacteria | 24684 |
| 494 | Ga0466704_298246 | 3300042643 | Bacteria | 13042 |
| 495 | Ga0466704_460534 | 3300042643 | Bacteria | 24087 |
| 496 | Ga0466704_568101 | 3300042643 | Bacteria | 3733 |
| 497 | Ga0466704_575277 | 3300042643 | Bacteria | 17865 |
| 498 | Ga0466709_015809 | 3300042648 | Bacteria | 82452 |
| 499 | Ga0466709_226256 | 3300042648 | Bacteria | 2286 |
| 500 | Ga0466708_047863 | 3300042652 | Bacteria | 12986 |
| 501 | Ga0466708_267723 | 3300042652 | Bacteria | 7880 |
| 502 | Ga0466727_069994 | 3300042655 | Bacteria | 98959 |
| 503 | Ga0466727_092943 | 3300042655 | Bacteria | 8539 |
| 504 | Ga0466706_084790 | 3300042599 | Bacteria | 11568 |
| 505 | Ga0466700_211536 | 3300042600 | Bacteria | 4520 |
| 506 | Ga0466707_035305 | 3300042601 | Bacteria | 25399 |
| 507 | Ga0466707_129169 | 3300042601 | Bacteria | 8592 |
| 508 | Ga0466707_199230 | 3300042601 | Bacteria | 10152 |
| 509 | Ga0466707_255706 | 3300042601 | Bacteria | 12287 |
| 510 | Ga0466707_265397 | 3300042601 | Bacteria | 2994 |
| 511 | Ga0466707_290136 | 3300042601 | Bacteria | 242153 |
| 512 | Ga0466713_013069 | 3300042602 | Bacteria | 20584 |
| 513 | Ga0466713_047504 | 3300042602 | Bacteria | 15230 |
| 514 | Ga0466716_468597 | 3300042605 | Bacteria | 3125 |
| 515 | Ga0466719_064908 | 3300042606 | Bacteria | 4980 |
| 516 | 2227080766 | 2225789004 | Bacteria | 378528 |
| 517 | 2227466290 | 2225789004 | Bacteria | 24913 |
| 518 | IMNBL1DRAFT_c0000129 | 3300000062 | Bacteria | 67784 |
| 519 | IMNBL1DRAFT_c0003992 | 3300000062 | Bacteria | 9093 |
| 520 | HBC_ctgsDRAFT_1000310 | 3300000333 | Bacteria | 11091 |
| 521 | JGI24695J34938_10000273 | 3300002450 | Bacteria | 50542 |
| 522 | JGI24702J35022_10008031 | 3300002462 | Archaea | 6009 |
| 523 | Meta3P_1002872 | 3300002464 | Bacteria | 13454 |
| 524 | Ga0072941_1033975 | 3300005201 | Bacteria | 3804 |
| 525 | Ga0074278_148530 | 3300005721 | Bacteria | 48193 |
| 526 | Ga0103266_1000097 | 3300007067 | Bacteria | 62891 |
| 527 | Ga0102734_1002071 | 3300007129 | Bacteria | 4837 |
| 528 | Ga0102734_1005114 | 3300007129 | Bacteria | 4631 |
| 529 | Ga0103260_1000027 | 3300007139 | Bacteria | 71480 |
| 530 | Ga0102737_1002065 | 3300007142 | Bacteria | 5167 |
| 531 | Ga0104019_1034914 | 3300007150 | Bacteria | 2523 |
| 532 | Ga0103264_1000178 | 3300007188 | Bacteria | 55971 |
| 533 | Ga0103264_1000755 | 3300007188 | Bacteria | 15083 |
| 534 | Ga0105524_102113 | 3300007733 | Bacteria | 6175 |
| 535 | Ga0123357_10002819 | 3300009784 | Bacteria | 19634 |
| 536 | Ga0160459_100411 | 3300012831 | Bacteria | 17645 |
| 537 | Ga0160452_101222 | 3300012834 | Bacteria | 8136 |
| 538 | Ga0255576_1000001 | 3300026558 | Bacteria | 687723 |
| 539 | Ga0255575_1005432 | 3300026559 | Bacteria | 8099 |
| 540 | Ga0316159_10465 | 3300030930 | Bacteria | 6324 |
| 541 | Ga0466690_020873 | 3300042590 | Bacteria | 13237 |
| 542 | Ga0466693_444147 | 3300042592 | Bacteria | 3349 |
| 543 | Ga0466691_077588 | 3300042593 | Bacteria | 24167 |
| 544 | Ga0466691_082803 | 3300042593 | Bacteria | 4511 |
| 545 | Ga0466695_105636 | 3300042595 | Bacteria | 4301 |
| 546 | Ga0466705_151144 | 3300042612 | Bacteria | 8694 |
| 547 | Ga0562378_1741 | 3300056814 | Unclassified | 21805 |
| 548 | Ga0562378_1966 | 3300056814 | Unclassified | 19277 |
| 549 | Ga0562377_0060 | 3300056842 | Bacteria | 477040 |
| 550 | Ga0562375_0167 | 3300056856 | Bacteria | 192904 |
| 551 | Ga0562375_1486 | 3300056856 | Unclassified | 31345 |
| 552 | Ga0562375_2564 | 3300056856 | Unclassified | 19879 |
| 553 | Ga0562375_6598 | 3300056856 | Unclassified | 3963 |
| 554 | Ga0562376_1098 | 3300056857 | Unclassified | 40365 |
| 555 | Ga0562376_2818 | 3300056857 | Unclassified | 19402 |
| 556 | Ga0562376_5097 | 3300056857 | Unclassified | 9336 |
| 557 | Ga0562374_0004 | 3300057007 | Bacteria | 3025848 |
| 558 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 559 | Ga0562374_1107 | 3300057007 | Unclassified | 34820 |
| 560 | Ga0590769_00854 | 3300060755 | Unclassified | 2977 |
| 561 | Ga0123357_10235558 | 3300009784 | Bacteria | 1995 |
| 562 | Ga0123355_10009437 | 3300009826 | Bacteria | 14838 |
| 563 | Ga0123355_10047001 | 3300009826 | Bacteria | 7019 |
| 564 | Ga0123355_10060955 | 3300009826 | Bacteria | 6092 |
| 565 | Ga0123355_10068485 | 3300009826 | Bacteria | 5708 |
| 566 | Ga0123355_10082957 | 3300009826 | Bacteria | 5110 |
| 567 | Ga0123356_10015606 | 3300010049 | Bacteria | 7275 |
| 568 | Ga0123354_10091812 | 3300010882 | Bacteria | 4190 |
| 569 | Ga0466710_002707 | 3300042613 | Bacteria | 15470 |
| 570 | Ga0466711_023837 | 3300042615 | Bacteria | 62988 |
| 571 | Ga0466711_164680 | 3300042615 | Bacteria | 37146 |
| 572 | Ga0466715_074981 | 3300042616 | Bacteria | 14819 |
| 573 | Ga0466715_099931 | 3300042616 | Bacteria | 2121 |
| 574 | Ga0466715_199468 | 3300042616 | Bacteria | 12105 |
| 575 | Ga0466723_005292 | 3300042618 | Bacteria | 6956 |
| 576 | Ga0466723_079419 | 3300042618 | Bacteria | 12674 |
| 577 | Ga0466726_207072 | 3300042619 | Bacteria | 3685 |
| 578 | Ga0466726_258629 | 3300042619 | Bacteria | 6266 |
| 579 | Ga0466729_086608 | 3300042621 | Bacteria | 2381 |
| 580 | Ga0466729_175954 | 3300042621 | Bacteria | 7396 |
| 581 | Ga0466735_007727 | 3300042624 | Bacteria | 126549 |
| 582 | Ga0466735_234554 | 3300042624 | Bacteria | 4699 |
| 583 | Ga0466703_344153 | 3300042636 | Bacteria | 3222 |
| 584 | Ga0466703_420112 | 3300042636 | Bacteria | 3647 |
| 585 | Ga0466703_432471 | 3300042636 | Bacteria | 7113 |
| 586 | Ga0466704_533142 | 3300042643 | Unclassified | 9306 |
| 587 | Ga0466709_016858 | 3300042648 | Bacteria | 4550 |
| 588 | Ga0466709_029894 | 3300042648 | Bacteria | 4272 |
| 589 | Ga0466709_073694 | 3300042648 | Bacteria | 11129 |
| 590 | Ga0466724_69524 | 3300042649 | Bacteria | 891007 |
| 591 | Ga0466708_222382 | 3300042652 | Bacteria | 45711 |
| 592 | Ga0466725_230046 | 3300042654 | Bacteria | 108087 |
| 593 | Ga0466727_025721 | 3300042655 | Bacteria | 11205 |
| 594 | Ga0466700_079720 | 3300042600 | Bacteria | 44343 |
| 595 | Ga0466707_024604 | 3300042601 | Bacteria | 66152 |
| 596 | Ga0466707_077425 | 3300042601 | Bacteria | 32634 |
| 597 | Ga0466707_151859 | 3300042601 | Bacteria | 1862 |
| 598 | Ga0466707_382404 | 3300042601 | Unclassified | 17120 |
| 599 | Ga0466713_127758 | 3300042602 | Bacteria | 30264 |
| 600 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 601 | Ga0466717_048816 | 3300042604 | Unclassified | 2983 |
| 602 | Ga0466719_017942 | 3300042606 | Bacteria | 2876 |
| 603 | Ga0466722_099432 | 3300042609 | Bacteria | 9907 |
| 604 | Ga0466722_190620 | 3300042609 | Bacteria | 7890 |
| 605 | AustNasuHG_c1001766 | 3300000089 | Bacteria | 7827 |
| 606 | JGI24695J34938_10002198 | 3300002450 | Bacteria | 15203 |
| 607 | JGI24705J35276_12238415 | 3300002504 | Bacteria | 21295 |
| 608 | JGI24700J35501_10930400 | 3300002508 | Bacteria | 13624 |
| 609 | CVPL010W_10006686 | 3300002931 | Bacteria | 11690 |
| 610 | CVPL005W_1000145 | 3300002934 | Bacteria | 30557 |
| 611 | Ga0068305_10004659 | 3300005083 | Bacteria | 11439 |
| 612 | Ga0072940_1039298 | 3300005200 | Bacteria | 28634 |
| 613 | Ga0072941_1008490 | 3300005201 | Bacteria | 19006 |
| 614 | Ga0072941_1039131 | 3300005201 | Bacteria | 40389 |
| 615 | Ga0103261_1000023 | 3300007083 | Bacteria | 256806 |
| 616 | Ga0103261_1000046 | 3300007083 | Unclassified | 39142 |
| 617 | Ga0102740_1000422 | 3300007140 | Bacteria | 11766 |
| 618 | Ga0102738_1000001 | 3300007141 | Bacteria | 409385 |
| 619 | Ga0104050_1002249 | 3300007153 | Bacteria | 10060 |
| 620 | Ga0103264_1000101 | 3300007188 | Bacteria | 49856 |
| 621 | Ga0103267_1000100 | 3300007190 | Bacteria | 31906 |
| 622 | Ga0103268_1004453 | 3300007192 | Bacteria | 2846 |
| 623 | Ga0123357_10000560 | 3300009784 | Bacteria | 36706 |
| 624 | Ga0160441_100216 | 3300012825 | Bacteria | 57462 |
| 625 | Ga0160467_100347 | 3300012829 | Bacteria | 49054 |
| 626 | Ga0160472_100151 | 3300012839 | Unclassified | 100200 |
| 627 | Ga0160445_100689 | 3300012847 | Bacteria | 13732 |
| 628 | Ga0160447_100004 | 3300012849 | Bacteria | 554359 |
| 629 | Ga0160430_100733 | 3300012852 | Unclassified | 15796 |
| 630 | Ga0160435_1003044 | 3300012857 | Unclassified | 4007 |
| 631 | Ga0466657_374394 | 3300042582 | Bacteria | 21365 |
| 632 | Ga0466696_393572 | 3300042596 | Bacteria | 3590 |
| 633 | Ga0466699_141835 | 3300042597 | Bacteria | 10598 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07722 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.