Protein Family IF06536
Metagenome
Isolate
358
Members
297
Samples
138
Scaffolds
188.06
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_268978|Ga0466719_268978_2558_3226
- Length
- 222 aa
- Sequence
- VTRRRAAAIDADALHSIDDSGINFLDFFDKELKMNQSLINSVILPFKATAYHKNIFTPLTEADVLGKWSVFFFYPADFTFVCPTELGDLADSYEEFKRLGVEIYSVSTDTHFTHKAWHDNSATIRKIKYVMVGDPTGAISRNFGVLNEETGLAERGTFVVDPSGKIQIIETNAGNIGRDAGELLRKIKAAQYVAAHPTEVCPARWQEGAATLTPSLDLVGKI
Sample Types
Isolate
61.5%
Metagenome
38.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
23.0%
Unclassified
11.7%
Drosophilidae
9.2%
Curculionidae
4.9%
Formicidae
4.9%
Culicidae
4.6%
Muscidae
4.6%
Tenebrionidae
4.6%
Apidae
3.9%
Calliphoridae
3.2%
Kalotermitidae
3.2%
Elmidae
2.8%
Anthocoridae
2.5%
Termitidae
2.1%
Armadillidiidae
2.1%
Rhinotermitidae
1.1%
Passalidae
1.1%
Tephritidae
1.1%
Sarcophagidae
0.7%
Termopsidae
0.7%
Berytidae
0.7%
Hydrophilidae
0.7%
Cerambycidae
0.7%
Largidae
0.4%
Alydidae
0.4%
Libellulidae
0.4%
Rhopalidae
0.4%
Pentatomidae
0.4%
Carabidae
0.4%
Thripidae
0.4%
Dytiscidae
0.4%
Anthomyiidae
0.4%
Gomphidae
0.4%
Vespidae
0.4%
Lysianassidae
0.4%
Hodotermitidae
0.4%
Gryllidae
0.4%
Crambidae
0.4%
Pteromalidae
0.4%
Plutellidae
0.4%
Taxonomy
Archaea
0
Bacteria
314
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 3 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 4 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 5 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 6 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 7 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 8 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 9 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 10 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 11 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 12 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 13 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 14 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 15 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 16 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 17 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 18 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 19 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 20 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 21 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 28 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 29 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 30 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 31 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 32 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 33 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 34 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 35 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 36 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 37 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 38 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 39 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 40 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 41 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 42 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 43 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 44 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 45 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 46 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 47 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 48 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 49 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 50 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 51 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 52 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 53 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 54 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 55 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 56 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 57 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 58 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 59 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 60 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 61 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 62 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 63 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 64 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 65 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 66 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 67 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 68 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 69 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 73 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 74 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 75 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 76 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 77 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 78 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 79 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 80 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 81 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 82 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 83 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 84 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 85 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 86 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 87 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 88 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 89 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 90 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 91 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 92 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 93 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 94 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 95 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 96 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 97 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 98 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 99 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 100 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 101 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 102 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 103 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 104 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 105 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 106 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 107 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 108 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 109 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 110 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 111 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 112 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 113 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 114 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 115 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 116 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 117 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 118 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 119 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 120 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 121 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 122 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 123 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 124 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 125 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 126 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 127 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 128 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 129 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 130 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 131 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 132 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 133 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 134 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 135 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 136 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 137 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 138 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 139 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 140 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 141 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 142 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 143 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 144 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 145 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 146 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 147 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 148 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 149 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 150 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 151 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 152 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 153 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 154 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 155 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 156 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 157 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 158 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 159 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 160 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 161 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 162 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 163 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 164 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 165 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 166 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 167 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 168 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 169 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 170 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 171 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 172 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 173 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 174 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 175 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 176 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 177 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 178 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 179 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 180 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 181 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 182 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 183 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 184 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 185 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 186 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 187 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 188 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 189 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 190 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 191 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 192 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 193 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 194 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 195 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 196 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 197 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 198 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 199 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 200 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 201 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 202 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 203 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 204 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 205 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 206 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 207 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 208 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 209 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 210 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 211 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 212 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 213 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 214 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 215 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 216 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 217 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 218 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 219 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 220 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 221 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 222 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 223 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 224 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 225 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 226 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 227 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 228 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 229 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 230 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 231 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 232 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 233 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 234 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 235 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 236 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 237 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 238 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 239 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 240 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 241 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 242 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 243 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 244 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 245 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 246 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 247 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 248 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 249 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 250 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 251 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 252 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 253 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 254 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 255 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 256 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 257 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 258 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 259 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 260 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 261 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 262 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 263 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 264 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 265 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 266 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 267 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 268 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 269 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 270 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 271 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 272 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 273 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 274 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 275 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 276 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 277 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 278 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 279 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 280 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 281 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 282 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 283 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 284 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 285 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 286 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 287 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 288 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 289 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 290 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 291 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 292 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 293 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 294 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 295 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 296 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 297 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0017 | 3300056842 | Bacteria | 1143096 |
| 2 | Ga0466715_142139 | 3300042616 | Bacteria | 17336 |
| 3 | IMNBL1DRAFT_c0011910 | 3300000062 | Bacteria | 4020 |
| 4 | Ga0063521_1000288 | 3300003973 | Bacteria | 30889 |
| 5 | Ga0074188_1166651 | 3300005318 | Bacteria | 902 |
| 6 | Ga0074304_1156319 | 3300005319 | Unclassified | 839 |
| 7 | Ga0104049_1001990 | 3300007103 | Unclassified | 2325 |
| 8 | Ga0102740_1001075 | 3300007140 | Bacteria | 8141 |
| 9 | Ga0160431_100722 | 3300012828 | Bacteria | 11451 |
| 10 | Ga0160444_100051 | 3300012841 | Unclassified | 172660 |
| 11 | Ga0160433_100285 | 3300012846 | Bacteria | 33238 |
| 12 | Ga0160435_1000086 | 3300012857 | Bacteria | 54466 |
| 13 | Ga0265387_1000047 | 3300024582 | Unclassified | 40475 |
| 14 | Ga0466729_209681 | 3300042621 | Unclassified | 1744 |
| 15 | Ga0466701_042248 | 3300042598 | Bacteria | 8270 |
| 16 | Ga0466716_168632 | 3300042605 | Bacteria | 4698 |
| 17 | Ga0466716_235034 | 3300042605 | Bacteria | 5306 |
| 18 | Ga0466705_165927 | 3300042612 | Bacteria | 4535 |
| 19 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 20 | FGTW_contig12056 | 2065487013 | Bacteria | 1514 |
| 21 | Ga0160454_100402 | 3300012798 | Bacteria | 21277 |
| 22 | Ga0160472_100089 | 3300012839 | Bacteria | 148681 |
| 23 | Ga0160433_100014 | 3300012846 | Bacteria | 237201 |
| 24 | Ga0160448_102332 | 3300012854 | Bacteria | 5888 |
| 25 | Ga0247290_00029 | 3300035364 | Unclassified | 56602 |
| 26 | Ga0247290_00053 | 3300035364 | Unclassified | 39558 |
| 27 | Ga0466727_166961 | 3300042655 | Bacteria | 1596 |
| 28 | Ga0466706_005343 | 3300042599 | Bacteria | 1629 |
| 29 | SPBB_contig11516 | 2044078006 | Bacteria | 90532 |
| 30 | IMNBGM34_c001137 | 3300000036 | Bacteria | 5101 |
| 31 | Meta3P_1000279 | 3300002464 | Bacteria | 40484 |
| 32 | Ga0103260_1001118 | 3300007139 | Unclassified | 4883 |
| 33 | Ga0102737_1000158 | 3300007142 | Bacteria | 42980 |
| 34 | Ga0104147_1022041 | 3300007224 | Bacteria | 14858 |
| 35 | Ga0105004_1215970 | 3300007763 | Bacteria | 970 |
| 36 | Ga0123355_10116283 | 3300009826 | Bacteria | 4162 |
| 37 | Ga0160433_107456 | 3300012846 | Bacteria | 1506 |
| 38 | Ga0316159_11581 | 3300030930 | Unclassified | 2793 |
| 39 | Ga0466703_047164 | 3300042636 | Bacteria | 41377 |
| 40 | Ga0466703_188833 | 3300042636 | Bacteria | 4589 |
| 41 | Ga0466724_27449 | 3300042649 | Unclassified | 40633 |
| 42 | Ga0466701_103106 | 3300042598 | Bacteria | 35693 |
| 43 | Ga0562377_0241 | 3300056842 | Bacteria | 129113 |
| 44 | HBC_ctgsDRAFT_1013104 | 3300000333 | Bacteria | 1992 |
| 45 | Meta3P_1010043 | 3300002464 | Unclassified | 2975 |
| 46 | Ga0063521_1000082 | 3300003973 | Bacteria | 78761 |
| 47 | Ga0063521_1000092 | 3300003973 | Bacteria | 71579 |
| 48 | Ga0103265_1017441 | 3300007068 | Bacteria | 942 |
| 49 | Ga0102735_1017386 | 3300007080 | Bacteria | 947 |
| 50 | Ga0102734_1013028 | 3300007129 | Unclassified | 4153 |
| 51 | Ga0102740_1003587 | 3300007140 | Unclassified | 3280 |
| 52 | Ga0103267_1000235 | 3300007190 | Unclassified | 30591 |
| 53 | Ga0103268_1025121 | 3300007192 | Unclassified | 1375 |
| 54 | Ga0160433_100010 | 3300012846 | Bacteria | 293456 |
| 55 | Ga0160435_1001654 | 3300012857 | Bacteria | 5594 |
| 56 | Ga0466696_406153 | 3300042596 | Unclassified | 5251 |
| 57 | Ga0466734_112661 | 3300042623 | Bacteria | 48375 |
| 58 | Ga0466708_046192 | 3300042652 | Unclassified | 1676 |
| 59 | Ga0466713_153027 | 3300042602 | Bacteria | 2754 |
| 60 | Ga0466705_272784 | 3300042612 | Bacteria | 31153 |
| 61 | Ga0562378_0034 | 3300056814 | Bacteria | 488617 |
| 62 | Ga0466729_097262 | 3300042621 | Bacteria | 61385 |
| 63 | SPBB_contig10681 | 2044078006 | Bacteria | 147815 |
| 64 | FGTW_contig20921 | 2065487013 | Unclassified | 3714 |
| 65 | HBC_ctgsDRAFT_1078355 | 3300000333 | Unclassified | 783 |
| 66 | CVPL010W_10007669 | 3300002931 | Bacteria | 10515 |
| 67 | CVPL005L_10001763 | 3300002938 | Unclassified | 24999 |
| 68 | Ga0063521_1000029 | 3300003973 | Bacteria | 122497 |
| 69 | Ga0102734_1002434 | 3300007129 | Bacteria | 4362 |
| 70 | Ga0105553_1042369 | 3300007767 | Bacteria | 22586 |
| 71 | Ga0123355_10006701 | 3300009826 | Bacteria | 17125 |
| 72 | Ga0160464_100230 | 3300012805 | Unclassified | 54758 |
| 73 | Ga0160471_101160 | 3300012812 | Bacteria | 5583 |
| 74 | Ga0160467_102738 | 3300012829 | Bacteria | 3547 |
| 75 | Ga0160459_100137 | 3300012831 | Unclassified | 49237 |
| 76 | Ga0160433_100251 | 3300012846 | Bacteria | 37567 |
| 77 | Ga0160447_133357 | 3300012849 | Bacteria | 651 |
| 78 | Ga0160436_1001887 | 3300012861 | Bacteria | 5538 |
| 79 | Ga0466690_368746 | 3300042590 | Bacteria | 9309 |
| 80 | Ga0466696_183974 | 3300042596 | Unclassified | 1151 |
| 81 | Ga0466696_227008 | 3300042596 | Bacteria | 16810 |
| 82 | Ga0466704_443962 | 3300042643 | Bacteria | 37836 |
| 83 | Ga0466724_17582 | 3300042649 | Bacteria | 122637 |
| 84 | Ga0466708_009325 | 3300042652 | Bacteria | 2900 |
| 85 | Ga0466701_030161 | 3300042598 | Bacteria | 1093 |
| 86 | Ga0466701_035885 | 3300042598 | Bacteria | 250285 |
| 87 | Ga0562375_3565 | 3300056856 | Unclassified | 14222 |
| 88 | Ga0466729_195322 | 3300042621 | Bacteria | 3104 |
| 89 | CVPL010L_1000128 | 3300002932 | Bacteria | 70257 |
| 90 | Ga0123355_10741132 | 3300009826 | Bacteria | 1114 |
| 91 | Ga0123355_11364999 | 3300009826 | Unclassified | 704 |
| 92 | Ga0160468_100452 | 3300012819 | Bacteria | 16803 |
| 93 | Ga0160456_100133 | 3300012820 | Bacteria | 70892 |
| 94 | Ga0160472_102122 | 3300012839 | Unclassified | 4773 |
| 95 | Ga0160447_100685 | 3300012849 | Unclassified | 14802 |
| 96 | Ga0415639_283472 | 3300038395 | Unclassified | 2203 |
| 97 | Ga0466729_230562 | 3300042621 | Bacteria | 12156 |
| 98 | Ga0466704_250297 | 3300042643 | Unclassified | 1594 |
| 99 | Ga0466724_24965 | 3300042649 | Bacteria | 130915 |
| 100 | Ga0466701_018115 | 3300042598 | Bacteria | 84655 |
| 101 | Ga0466701_045037 | 3300042598 | Unclassified | 3458 |
| 102 | Ga0466716_289888 | 3300042605 | Unclassified | 1327 |
| 103 | Ga0530661_001718 | 3300056564 | Bacteria | 10098 |
| 104 | Ga0530661_027230 | 3300056564 | Bacteria | 1641 |
| 105 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 106 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 107 | FGTW_contig30601 | 2065487013 | Unclassified | 14533 |
| 108 | Ga0102735_1000085 | 3300007080 | Bacteria | 24769 |
| 109 | Ga0102737_1000735 | 3300007142 | Unclassified | 10237 |
| 110 | Ga0103267_1049497 | 3300007190 | Unclassified | 1376 |
| 111 | Ga0105005_1021471 | 3300007505 | Unclassified | 2390 |
| 112 | Ga0123355_11190535 | 3300009826 | Bacteria | 779 |
| 113 | Ga0466730_030226 | 3300042625 | Unclassified | 1522 |
| 114 | Ga0466730_082030 | 3300042625 | Unclassified | 27589 |
| 115 | Ga0466704_416171 | 3300042643 | Unclassified | 1374 |
| 116 | Ga0466719_125731 | 3300042606 | Bacteria | 1426 |
| 117 | Ga0466719_268978 | 3300042606 | Bacteria | 7949 |
| 118 | Ga0466722_115427 | 3300042609 | Bacteria | 2644 |
| 119 | Ga0562379_0719 | 3300056790 | Unclassified | 55736 |
| 120 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 121 | DPO_contig08128 | 2032320009 | Unclassified | 7945 |
| 122 | DPOL_contig20124 | 2035918003 | Unclassified | 21704 |
| 123 | 2227080769 | 2225789004 | Bacteria | 257506 |
| 124 | IMNBGM34_c012247 | 3300000036 | Bacteria | 1075 |
| 125 | Ga0102734_1000944 | 3300007129 | Bacteria | 7483 |
| 126 | Ga0103264_1000717 | 3300007188 | Bacteria | 15600 |
| 127 | Ga0103268_1000497 | 3300007192 | Bacteria | 11877 |
| 128 | Ga0160460_100264 | 3300012845 | Unclassified | 43516 |
| 129 | Ga0160443_101715 | 3300012848 | Unclassified | 6423 |
| 130 | Ga0466690_195501 | 3300042590 | Bacteria | 9394 |
| 131 | Ga0466735_121279 | 3300042624 | Bacteria | 3275 |
| 132 | Ga0466730_012040 | 3300042625 | Unclassified | 26725 |
| 133 | Ga0466730_023003 | 3300042625 | Bacteria | 6154 |
| 134 | Ga0466724_17605 | 3300042649 | Bacteria | 124775 |
| 135 | Ga0466724_36135 | 3300042649 | Bacteria | 5015 |
| 136 | Ga0466724_63919 | 3300042649 | Bacteria | 27006 |
| 137 | Ga0466708_406084 | 3300042652 | Bacteria | 3534 |
| 138 | Ga0466707_418871 | 3300042601 | Bacteria | 2581 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08534 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.