Protein Family IF04143
Metagenome
Metatranscriptome
Isolate
602
Members
475
Samples
233
Scaffolds
465.06
Avg Length
Representative Sequence
- ID
- 3300021227|Ga0223688_1017590|Ga0223688_10175901
- Length
- 524 aa
- Sequence
- VLRSFIFCGLGTRRSEGIITRMTSTILQLSRAGRRVAGQVKRLYGEEIKIAYNVRQTASMASFRTEKDTLGEVQVPADKYYGSQTVRSIKNFPIGVETERMPFPIITAMGILKKAAAIVNKDYGLDPKIAEAISKAADDVISGKLYTDHFPLVIWQTGSGTQTNMNTNEVISNRAIEILGGKLGSKTPVHPNDHVNKSQSSNDTFPTAMHIAVALEIHNTLMPGLEVLQKALANKAKEFENIVKIGRTHLMDAVPLTLGQEFSGYATQMQYGIDRVKDTLPRLYQLALGGTAVGTGLNTRIGFAEKCASKISELTGLPFVTAPNKFEALAAHDSMVEVSGALNTIACSLMKIANDIRLLGSGPRCGLAEIMLPENEPGSSIMPGKVNPTQCEAITMVAAQVMGNHVAVSVGGSYGHFELNVFKPQIVSNVLRSIRLIGDSCKAFTDNCVSGITANEERISKLLNESLMLVTALNPHIGYDKAALIAKTAHKEGTTLKEASLKLGLVSEEDFGKFVNPQDMLGPK
Sample Types
Isolate
61.3%
Metagenome
37.4%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
17.4%
Unclassified
11.7%
Drosophilidae
7.4%
Apidae
5.6%
Culicidae
5.0%
Elmidae
4.8%
Termitidae
4.6%
Anthocoridae
4.6%
Formicidae
3.9%
Aphididae
3.5%
Tenebrionidae
2.8%
Muscidae
2.8%
Curculionidae
2.8%
Kalotermitidae
2.8%
Sarcophagidae
2.0%
Calliphoridae
2.0%
Psyllidae
1.1%
Pteromalidae
1.1%
Armadillidiidae
1.1%
Rhinotermitidae
1.1%
Cerambycidae
0.9%
Hydrophilidae
0.9%
Tephritidae
0.7%
Glossinidae
0.4%
Cicadellidae
0.4%
Nephropidae
0.4%
Aleyrodidae
0.4%
Passalidae
0.4%
Plutellidae
0.4%
Berytidae
0.4%
Pentatomidae
0.4%
Pulicidae
0.4%
Crambidae
0.4%
Termopsidae
0.4%
Largidae
0.4%
Blattidae
0.2%
Aphrophoridae
0.2%
Ixodidae
0.2%
Hodotermitidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Ceratopogonidae
0.2%
Cylisticidae
0.2%
Carabidae
0.2%
Silvanidae
0.2%
Cimicidae
0.2%
Hippoboscidae
0.2%
Thripidae
0.2%
Delphacidae
0.2%
Anthomyiidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Noctuidae
0.2%
Alydidae
0.2%
Carposinidae
0.2%
Cambaridae
0.2%
Taxonomy
Archaea
0
Bacteria
554
Eukaryota
4
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 2 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 3 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 4 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 5 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 6 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 7 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 8 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 9 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 10 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 11 | 2761201758 | Scheffersomyces stipitis CBS 6054 | Isolate | Unclassified |
| 12 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 13 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 14 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 15 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 16 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 17 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 18 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 19 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 20 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 21 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 22 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 23 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 24 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 25 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 26 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 27 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 28 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 29 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 30 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 31 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 34 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 35 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 36 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 37 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 38 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 39 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 40 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 41 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 42 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 43 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 44 | 643886011 | Wolbachia sp. wUni (Muscidifurax uniraptor) | Isolate | Pteromalidae |
| 45 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 46 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 47 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 48 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 49 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 50 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 51 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 52 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 53 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 54 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 55 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 56 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 57 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 58 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 59 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 60 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 61 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 62 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 67 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 68 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 69 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 70 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 71 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 72 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 73 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 74 | 2744054723 | Ehrlichia ruminantium Palm River | Isolate | Unclassified |
| 75 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 76 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 77 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 78 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 79 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 80 | 2855972776 | Rickettsia colombianensi Adcor 2 | Isolate | Ixodidae |
| 81 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 82 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 83 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 84 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 85 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 86 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 87 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 88 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 89 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 90 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 91 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 92 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 93 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 94 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 95 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 96 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 97 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 98 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 99 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 100 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 101 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 102 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 103 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 104 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 105 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 106 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 107 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 108 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 109 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 110 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 111 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 112 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 113 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 114 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 115 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 116 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 117 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 118 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 119 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 120 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 121 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 122 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 123 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 124 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 125 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 126 | 2718218474 | Wolbachia endosymbiont of Drosophila incompta wInc_SM | Isolate | Drosophilidae |
| 127 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 128 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 129 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 130 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 131 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 132 | 2846025955 | Wolbachia endosymbiont of Cylisticus convexus Wcon | Isolate | Cylisticidae |
| 133 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 134 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 135 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 136 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 137 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 138 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 139 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 140 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 141 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 142 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 143 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 144 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 145 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 146 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 147 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 148 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 149 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 150 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 151 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 152 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 153 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 154 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 155 | 3300060768 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 156 | 3300060777 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 157 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 158 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 159 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 160 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 161 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 162 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 163 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 164 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 165 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 166 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 167 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 168 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 169 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 170 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 171 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 172 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 173 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 174 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 175 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 176 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 177 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 178 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 179 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 180 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 181 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 182 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 183 | 2513237285 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 184 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 185 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 186 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 187 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 188 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 189 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 190 | 2761201754 | Yamadazyma tenuis ATCC 10573 | Isolate | Unclassified |
| 191 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 192 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 193 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 194 | 2834327606 | Wolbachia sp. wRi_2 | Isolate | Drosophilidae |
| 195 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 196 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 197 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 198 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 199 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 200 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 201 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 202 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 203 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 204 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 205 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 206 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 207 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 208 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 209 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 210 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 211 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 212 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 213 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 214 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 215 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 216 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 217 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 218 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 219 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 220 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 221 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 222 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 223 | 3300060771 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 224 | 639279309 | Ehrlichia ruminantium Welgevonden, CIRAD | Isolate | Unclassified |
| 225 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 226 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 227 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 228 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 229 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 230 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 231 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 232 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 233 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 234 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 235 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 236 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 237 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 238 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 239 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 240 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 241 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 242 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 243 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 244 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 245 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 246 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 247 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 248 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 249 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 250 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 251 | 2843484624 | Wolbachia endosymbiont of Nomada ferruginata wNfe | Isolate | Apidae |
| 252 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 253 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 254 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 255 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 256 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 257 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 258 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 259 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 260 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 261 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 262 | 3002821025 | Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig | Isolate | Aphididae |
| 263 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 264 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 265 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 266 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 267 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 268 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 269 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 270 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 271 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 272 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 273 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 274 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 275 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 276 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 277 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 278 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 279 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 280 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 281 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 282 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 283 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 284 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 285 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 286 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 287 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 288 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 289 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 290 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 291 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 292 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 293 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 294 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 295 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 296 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 297 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 298 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 299 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 300 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 301 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 302 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 303 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 304 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 305 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 306 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 307 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 308 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 309 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 310 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 311 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 312 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 313 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 314 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 315 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 316 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 317 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 318 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 319 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 320 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 321 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 322 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 323 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 324 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 325 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 326 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 327 | 3300060705 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 328 | 3300060758 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 329 | 637000340 | Wolbachia endosymbiont TRS of Brugia malayi | Isolate | Unclassified |
| 330 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 331 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 332 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 333 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 334 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 335 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 336 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 337 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 338 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 339 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 340 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 341 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 342 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 343 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 344 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 345 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 346 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 347 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 348 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 349 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 350 | 3300038763 | Termite gut microbial communities of Labiotermes labralis from French Guiana - 62_rP2 | Metatranscriptome | Termitidae |
| 351 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 352 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 353 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 354 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 355 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 356 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 357 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 358 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 359 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 360 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 361 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 362 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 363 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 364 | 2761201709 | Ogataea arabinofermentans NRRL YB-2248 | Isolate | Unclassified |
| 365 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 366 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 367 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 368 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 369 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 370 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 371 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 372 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 373 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 374 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 375 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 376 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 377 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 378 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 379 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 380 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 381 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 382 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 383 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 384 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 385 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 386 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 387 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 388 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 389 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 390 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 391 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 392 | 639279308 | Ehrlichia ruminantium Welgevonden, ARC-OVI | Isolate | Unclassified |
| 393 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 394 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 395 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 396 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 397 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 398 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 399 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 400 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 401 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 402 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 403 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 404 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 405 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 406 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 407 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 408 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 409 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 410 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 411 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 412 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 413 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 414 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 415 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 416 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 417 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 418 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 419 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 420 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 421 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 422 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 423 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 424 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 425 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 426 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 427 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 428 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 429 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 430 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 431 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 432 | 2843491798 | Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii | Isolate | Drosophilidae |
| 433 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 434 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 435 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 436 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 437 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 438 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 439 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 440 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 441 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 442 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 443 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 444 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 445 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 446 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 447 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 448 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 449 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 450 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 451 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 452 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 453 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 454 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 455 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 456 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 457 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 458 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 459 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 460 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 461 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 462 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 463 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 464 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 465 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 466 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 467 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 468 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 469 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 470 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 471 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 472 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 473 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 474 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 475 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 2 | Ga0562377_1198 | 3300056842 | Bacteria | 29825 |
| 3 | Ga0590774_00574 | 3300060758 | Bacteria | 3666 |
| 4 | Ga0123353_10021025 | 3300010167 | Bacteria | 9775 |
| 5 | Ga0160442_102868 | 3300012806 | Bacteria | 1850 |
| 6 | Ga0160471_100093 | 3300012812 | Bacteria | 57742 |
| 7 | Ga0466715_218003 | 3300042616 | Bacteria | 17483 |
| 8 | Ga0466715_237537 | 3300042616 | Bacteria | 14528 |
| 9 | Ga0466723_107709 | 3300042618 | Bacteria | 17044 |
| 10 | Ga0466726_016487 | 3300042619 | Bacteria | 7709 |
| 11 | FGTW_contig32599 | 2065487013 | Unclassified | 2383 |
| 12 | 2217936982 | 2209111014 | Unclassified | 19810 |
| 13 | 2227080768 | 2225789004 | Bacteria | 273152 |
| 14 | Ga0063521_1000029 | 3300003973 | Bacteria | 122497 |
| 15 | Ga0063521_1000080 | 3300003973 | Unclassified | 79768 |
| 16 | Ga0063521_1000155 | 3300003973 | Bacteria | 51752 |
| 17 | Ga0102735_1000372 | 3300007080 | Bacteria | 13762 |
| 18 | Ga0466730_052579 | 3300042625 | Bacteria | 322082 |
| 19 | Ga0466703_093265 | 3300042636 | Bacteria | 7280 |
| 20 | Ga0466704_323331 | 3300042643 | Bacteria | 32534 |
| 21 | Ga0466709_276829 | 3300042648 | Bacteria | 4509 |
| 22 | Ga0466724_27172 | 3300042649 | Bacteria | 94035 |
| 23 | Ga0160460_100010 | 3300012845 | Bacteria | 503980 |
| 24 | Ga0160430_101615 | 3300012852 | Unclassified | 8113 |
| 25 | Ga0223688_1017590 | 3300021227 | Bacteria | 2139 |
| 26 | Ga0247289_0318 | 3300035363 | Unclassified | 8349 |
| 27 | Ga0466692_143809 | 3300042591 | Bacteria | 49470 |
| 28 | Ga0466713_041894 | 3300042602 | Bacteria | 97930 |
| 29 | Ga0466722_161645 | 3300042609 | Bacteria | 15765 |
| 30 | Ga0466733_185104 | 3300042659 | Bacteria | 2262 |
| 31 | Ga0123355_10145736 | 3300009826 | Bacteria | 3611 |
| 32 | Ga0123356_10116444 | 3300010049 | Bacteria | 2591 |
| 33 | Ga0466711_310604 | 3300042615 | Bacteria | 2491 |
| 34 | IMNBL1DRAFT_c0000444 | 3300000062 | Bacteria | 34756 |
| 35 | Ga0063521_1000368 | 3300003973 | Unclassified | 25755 |
| 36 | Ga0102740_1002064 | 3300007140 | Bacteria | 4770 |
| 37 | Ga0127656_101453 | 3300009453 | Bacteria | 8777 |
| 38 | Ga0127645_102471 | 3300009461 | Bacteria | 14833 |
| 39 | Ga0127524_165822 | 3300009478 | Bacteria | 2014 |
| 40 | Ga0466735_028351 | 3300042624 | Bacteria | 10946 |
| 41 | Ga0466730_031131 | 3300042625 | Bacteria | 34278 |
| 42 | Ga0466730_080655 | 3300042625 | Bacteria | 24212 |
| 43 | Ga0466703_151559 | 3300042636 | Bacteria | 5949 |
| 44 | Ga0466704_307231 | 3300042643 | Bacteria | 2223 |
| 45 | Ga0466709_104807 | 3300042648 | Bacteria | 40134 |
| 46 | Ga0466724_23747 | 3300042649 | Unclassified | 7913 |
| 47 | Ga0466724_24320 | 3300042649 | Bacteria | 6377 |
| 48 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 49 | Ga0466708_249092 | 3300042652 | Bacteria | 4376 |
| 50 | Ga0466656_090196 | 3300042550 | Unclassified | 13069 |
| 51 | Ga0466657_260420 | 3300042582 | Bacteria | 1708 |
| 52 | Ga0466690_424338 | 3300042590 | Bacteria | 2908 |
| 53 | Ga0466696_302916 | 3300042596 | Bacteria | 25646 |
| 54 | Ga0466701_035905 | 3300042598 | Bacteria | 91404 |
| 55 | Ga0466716_125743 | 3300042605 | Unclassified | 1996 |
| 56 | Ga0466719_033897 | 3300042606 | Unclassified | 1855 |
| 57 | Ga0466722_026469 | 3300042609 | Bacteria | 18008 |
| 58 | Ga0466722_113410 | 3300042609 | Bacteria | 15308 |
| 59 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 60 | Ga0590795_02992 | 3300060771 | Unclassified | 1629 |
| 61 | Ga0123353_10092086 | 3300010167 | Bacteria | 4883 |
| 62 | Ga0160471_102542 | 3300012812 | Unclassified | 2998 |
| 63 | Ga0466715_517301 | 3300042616 | Bacteria | 18267 |
| 64 | Ga0466723_025078 | 3300042618 | Unclassified | 10895 |
| 65 | Ga0466729_195820 | 3300042621 | Unclassified | 7568 |
| 66 | JGI24705J35276_12233454 | 3300002504 | Bacteria | 4850 |
| 67 | CVPL010W_10007151 | 3300002931 | Bacteria | 11548 |
| 68 | CVPL010L_1000298 | 3300002932 | Unclassified | 12632 |
| 69 | CVPL005L_10017341 | 3300002938 | Bacteria | 4238 |
| 70 | Ga0063521_1000015 | 3300003973 | Bacteria | 156890 |
| 71 | Ga0102735_1004009 | 3300007080 | Unclassified | 1986 |
| 72 | Ga0104041_1002538 | 3300007106 | Bacteria | 2443 |
| 73 | Ga0102734_1000031 | 3300007129 | Bacteria | 55117 |
| 74 | Ga0102737_1000810 | 3300007142 | Bacteria | 9667 |
| 75 | Ga0466730_000817 | 3300042625 | Bacteria | 42703 |
| 76 | Ga0466730_002805 | 3300042625 | Bacteria | 56749 |
| 77 | Ga0466703_190811 | 3300042636 | Bacteria | 5922 |
| 78 | Ga0466704_177476 | 3300042643 | Bacteria | 16994 |
| 79 | Ga0466709_005524 | 3300042648 | Bacteria | 140810 |
| 80 | Ga0466724_28305 | 3300042649 | Bacteria | 39305 |
| 81 | Ga0466724_45809 | 3300042649 | Bacteria | 229411 |
| 82 | Ga0160467_100489 | 3300012829 | Bacteria | 38283 |
| 83 | Ga0160433_100904 | 3300012846 | Bacteria | 10072 |
| 84 | Ga0160436_1002518 | 3300012861 | Bacteria | 4630 |
| 85 | Ga0309902_000024 | 3300028910 | Unclassified | 16814 |
| 86 | Ga0466657_289581 | 3300042582 | Bacteria | 50467 |
| 87 | Ga0466696_006459 | 3300042596 | Bacteria | 10570 |
| 88 | Ga0466701_020904 | 3300042598 | Bacteria | 560833 |
| 89 | Ga0466701_021547 | 3300042598 | Bacteria | 156093 |
| 90 | Ga0466713_118645 | 3300042602 | Bacteria | 113373 |
| 91 | Ga0466713_120225 | 3300042602 | Bacteria | 135023 |
| 92 | Ga0466733_026941 | 3300042659 | Bacteria | 8673 |
| 93 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 94 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 95 | Ga0590801_02501 | 3300060777 | Unclassified | 1651 |
| 96 | Ga0123355_10278077 | 3300009826 | Bacteria | 2315 |
| 97 | Ga0466711_176812 | 3300042615 | Bacteria | 4681 |
| 98 | Ga0466726_200093 | 3300042619 | Bacteria | 5651 |
| 99 | Ga0466728_295797 | 3300042620 | Bacteria | 2733 |
| 100 | IMNBL1DRAFT_c0004444 | 3300000062 | Bacteria | 8440 |
| 101 | Ga0102739_1000442 | 3300007095 | Bacteria | 8548 |
| 102 | Ga0104147_1007518 | 3300007224 | Unclassified | 15608 |
| 103 | Ga0466729_305505 | 3300042621 | Bacteria | 5575 |
| 104 | Ga0466735_097492 | 3300042624 | Bacteria | 24929 |
| 105 | Ga0466730_046358 | 3300042625 | Bacteria | 6483 |
| 106 | Ga0160430_103147 | 3300012852 | Bacteria | 4734 |
| 107 | Ga0160448_105612 | 3300012854 | Bacteria | 3258 |
| 108 | Ga0265387_1000015 | 3300024582 | Bacteria | 72265 |
| 109 | Ga0309903_100183 | 3300029809 | Unclassified | 2842 |
| 110 | Ga0466707_304149 | 3300042601 | Bacteria | 15511 |
| 111 | Ga0466713_046033 | 3300042602 | Bacteria | 104936 |
| 112 | Ga0466698_307316 | 3300042610 | Bacteria | 1714 |
| 113 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 114 | Ga0562377_0054 | 3300056842 | Bacteria | 518542 |
| 115 | Ga0123353_10214493 | 3300010167 | Bacteria | 3016 |
| 116 | Ga0123353_10332994 | 3300010167 | Bacteria | 2297 |
| 117 | Ga0160464_100198 | 3300012805 | Unclassified | 61341 |
| 118 | Ga0466711_165171 | 3300042615 | Bacteria | 4267 |
| 119 | Ga0466715_063650 | 3300042616 | Bacteria | 6538 |
| 120 | Ga0466715_342560 | 3300042616 | Bacteria | 11719 |
| 121 | Ga0466715_601648 | 3300042616 | Bacteria | 4999 |
| 122 | Ga0466728_115508 | 3300042620 | Bacteria | 15958 |
| 123 | IMNBL1DRAFT_c0002032 | 3300000062 | Bacteria | 14490 |
| 124 | JGI24702J35022_10024936 | 3300002462 | Bacteria | 3229 |
| 125 | Meta3P_1000080 | 3300002464 | Bacteria | 125210 |
| 126 | Ga0104045_1003352 | 3300007085 | Bacteria | 2417 |
| 127 | Ga0104019_1005696 | 3300007150 | Bacteria | 3234 |
| 128 | Ga0105553_1018675 | 3300007767 | Bacteria | 2205 |
| 129 | Ga0127655_1058513 | 3300009459 | Unclassified | 8108 |
| 130 | Ga0127649_100672 | 3300009460 | Bacteria | 16011 |
| 131 | Ga0466703_251384 | 3300042636 | Bacteria | 34375 |
| 132 | Ga0466704_128331 | 3300042643 | Bacteria | 56282 |
| 133 | Ga0466704_553150 | 3300042643 | Bacteria | 16914 |
| 134 | Ga0466709_208650 | 3300042648 | Bacteria | 37365 |
| 135 | Ga0466724_27056 | 3300042649 | Bacteria | 3909 |
| 136 | Ga0466724_37237 | 3300042649 | Bacteria | 305109 |
| 137 | Ga0466657_044351 | 3300042582 | Unclassified | 3061 |
| 138 | Ga0466701_079636 | 3300042598 | Bacteria | 27156 |
| 139 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 140 | Ga0466719_480573 | 3300042606 | Bacteria | 3920 |
| 141 | Ga0466733_165817 | 3300042659 | Bacteria | 8199 |
| 142 | Ga0530661_007692 | 3300056564 | Bacteria | 3055 |
| 143 | Ga0590814_03915 | 3300060705 | Unclassified | 1671 |
| 144 | Ga0123353_10117139 | 3300010167 | Bacteria | 4285 |
| 145 | Ga0160454_101376 | 3300012798 | Bacteria | 3664 |
| 146 | 2227505209 | 2225789004 | Bacteria | 3696 |
| 147 | HBC_ctgsDRAFT_1003846 | 3300000333 | Bacteria | 3456 |
| 148 | Meta3P_1000571 | 3300002464 | Unclassified | 14000 |
| 149 | WW0001_100173 | 3300002732 | Bacteria | 22960 |
| 150 | WW0001_100413 | 3300002732 | Bacteria | 31173 |
| 151 | Ga0103266_1000457 | 3300007067 | Bacteria | 12095 |
| 152 | Ga0103267_1001103 | 3300007190 | Bacteria | 7076 |
| 153 | Ga0127656_102481 | 3300009453 | Unclassified | 2617 |
| 154 | Ga0127657_100612 | 3300009457 | Bacteria | 22622 |
| 155 | Ga0466735_229765 | 3300042624 | Unclassified | 3958 |
| 156 | Ga0466730_012999 | 3300042625 | Bacteria | 66772 |
| 157 | Ga0466730_041640 | 3300042625 | Bacteria | 93224 |
| 158 | Ga0466703_100065 | 3300042636 | Bacteria | 8384 |
| 159 | Ga0466703_187859 | 3300042636 | Bacteria | 8427 |
| 160 | Ga0466704_090615 | 3300042643 | Bacteria | 7463 |
| 161 | Ga0466704_548862 | 3300042643 | Unclassified | 16006 |
| 162 | Ga0466709_002152 | 3300042648 | Bacteria | 7463 |
| 163 | Ga0466724_68720 | 3300042649 | Bacteria | 83149 |
| 164 | Ga0466708_061903 | 3300042652 | Bacteria | 26923 |
| 165 | Ga0160444_102176 | 3300012841 | Unclassified | 3093 |
| 166 | Ga0160447_104709 | 3300012849 | Unclassified | 3972 |
| 167 | Ga0160448_101124 | 3300012854 | Bacteria | 8806 |
| 168 | Ga0160435_1007198 | 3300012857 | Bacteria | 2437 |
| 169 | Ga0316159_11344 | 3300030930 | Unclassified | 6701 |
| 170 | Ga0247290_00026 | 3300035364 | Unclassified | 58120 |
| 171 | Ga0466657_147440 | 3300042582 | Bacteria | 3861 |
| 172 | Ga0466696_245543 | 3300042596 | Bacteria | 7081 |
| 173 | Ga0466701_028792 | 3300042598 | Bacteria | 67562 |
| 174 | Ga0466716_150572 | 3300042605 | Bacteria | 2992 |
| 175 | Ga0466722_111871 | 3300042609 | Bacteria | 5278 |
| 176 | Ga0466722_252632 | 3300042609 | Bacteria | 22068 |
| 177 | Ga0466698_071779 | 3300042610 | Bacteria | 21378 |
| 178 | Ga0466697_018419 | 3300042611 | Bacteria | 2749 |
| 179 | Ga0466710_313063 | 3300042613 | Bacteria | 2045 |
| 180 | Ga0466723_110591 | 3300042618 | Bacteria | 18271 |
| 181 | Ga0466726_424046 | 3300042619 | Bacteria | 11968 |
| 182 | IMNBL1DRAFT_c0000087 | 3300000062 | Bacteria | 82347 |
| 183 | CVPL010L_1000037 | 3300002932 | Bacteria | 103923 |
| 184 | Ga0074306_1117890 | 3300005309 | Unclassified | 2261 |
| 185 | Ga0103265_1000010 | 3300007068 | Bacteria | 47599 |
| 186 | Ga0466705_301141 | 3300042612 | Bacteria | 30306 |
| 187 | Ga0466734_101718 | 3300042623 | Bacteria | 6143 |
| 188 | Ga0466735_219899 | 3300042624 | Bacteria | 3963 |
| 189 | Ga0466730_074013 | 3300042625 | Bacteria | 8615 |
| 190 | Ga0160447_101682 | 3300012849 | Bacteria | 8341 |
| 191 | Ga0160435_1002755 | 3300012857 | Unclassified | 4246 |
| 192 | Ga0160457_1002658 | 3300012858 | Bacteria | 3528 |
| 193 | Ga0223682_1002970 | 3300021231 | Unclassified | 2436 |
| 194 | Ga0399895_001326 | 3300038763 | Unclassified | 5528 |
| 195 | Ga0120204_000109 | 3300038942 | Bacteria | 3950 |
| 196 | Ga0466657_158390 | 3300042582 | Bacteria | 5335 |
| 197 | Ga0466690_287019 | 3300042590 | Bacteria | 7590 |
| 198 | Ga0466690_337797 | 3300042590 | Bacteria | 1993 |
| 199 | Ga0466713_109001 | 3300042602 | Bacteria | 28119 |
| 200 | Ga0562377_0241 | 3300056842 | Bacteria | 129113 |
| 201 | Ga0590792_03567 | 3300060768 | Unclassified | 1656 |
| 202 | Ga0123356_10013071 | 3300010049 | Bacteria | 8030 |
| 203 | Ga0136160_1000459 | 3300010225 | Unclassified | 38894 |
| 204 | Ga0123354_10115650 | 3300010882 | Bacteria | 3504 |
| 205 | Ga0466715_008279 | 3300042616 | Bacteria | 34287 |
| 206 | Ga0466715_551493 | 3300042616 | Bacteria | 2120 |
| 207 | Ga0466728_244193 | 3300042620 | Bacteria | 23581 |
| 208 | FGTW_contig30439 | 2065487013 | Bacteria | 37896 |
| 209 | FGTW_contig31440 | 2065487013 | Bacteria | 4354 |
| 210 | Ga0063521_1000040 | 3300003973 | Bacteria | 112648 |
| 211 | Ga0074188_1000351 | 3300005318 | Bacteria | 12100 |
| 212 | Ga0103264_1000180 | 3300007188 | Bacteria | 37620 |
| 213 | Ga0103264_1001856 | 3300007188 | Bacteria | 17083 |
| 214 | Ga0104147_1028248 | 3300007224 | Bacteria | 6590 |
| 215 | Ga0105005_1034802 | 3300007505 | Bacteria | 22976 |
| 216 | Ga0466735_018547 | 3300042624 | Bacteria | 16232 |
| 217 | Ga0466730_005873 | 3300042625 | Unclassified | 5597 |
| 218 | Ga0466730_101257 | 3300042625 | Bacteria | 6721 |
| 219 | Ga0466709_227699 | 3300042648 | Unclassified | 11497 |
| 220 | Ga0466709_267571 | 3300042648 | Bacteria | 15677 |
| 221 | Ga0466724_07018 | 3300042649 | Unclassified | 1585 |
| 222 | Ga0466724_25559 | 3300042649 | Bacteria | 176427 |
| 223 | Ga0466708_033676 | 3300042652 | Bacteria | 8230 |
| 224 | Ga0466725_355217 | 3300042654 | Bacteria | 2157 |
| 225 | Ga0160468_100012 | 3300012819 | Bacteria | 410397 |
| 226 | Ga0160459_100056 | 3300012831 | Unclassified | 172056 |
| 227 | Ga0160457_1000086 | 3300012858 | Bacteria | 122920 |
| 228 | Ga0247290_00001 | 3300035364 | Bacteria | 125527 |
| 229 | Ga0466696_013287 | 3300042596 | Bacteria | 7853 |
| 230 | Ga0466696_123381 | 3300042596 | Unclassified | 5492 |
| 231 | Ga0466706_127960 | 3300042599 | Bacteria | 71121 |
| 232 | Ga0466700_146446 | 3300042600 | Bacteria | 8036 |
| 233 | Ga0466707_135675 | 3300042601 | Unclassified | 4121 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.