Protein Family IF01859
Metagenome
Isolate
578
Members
444
Samples
226
Scaffolds
231.95
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1000514|Ga0103264_100051424
- Length
- 276 aa
- Sequence
- MSRNKTTDDAAIVALAGRCHSPVTVLKHDRHTMGRIAARGVFLSQTMTSSILVVEDEPAIQELIAVNLSFAGHTIRRAHDAEQARSLINAELPDLIVLDWMLPGASGLSIARKLRADERTRHVPIIMLTAKGAEQDKLDGLEAGADDYITKPFSPKELLARIKAVLRRRAPQLTDDAIEINGLRLEPATHRLTGHDQNLSLGPTEFRLLHVFMAHPERVWSRTQLLNQVWGDHVFIEERTVDVHIRRLRKALAPSGHDACLETVRGRGYRFALRS*
Sample Types
Isolate
60.9%
Metagenome
39.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.7%
Coreidae
18.9%
Termitidae
5.4%
Anthocoridae
5.0%
Elmidae
4.5%
Culicidae
4.2%
Drosophilidae
4.0%
Curculionidae
4.0%
Formicidae
3.5%
Muscidae
3.1%
Tenebrionidae
2.1%
Calliphoridae
1.9%
Kalotermitidae
1.9%
Apidae
1.7%
Armadillidiidae
1.7%
Tephritidae
1.2%
Cerambycidae
0.9%
Palinuridae
0.7%
Talitridae
0.7%
Aphididae
0.5%
Sarcophagidae
0.5%
Largidae
0.5%
Rhinotermitidae
0.5%
Pentatomidae
0.5%
Penaeidae
0.5%
Berytidae
0.5%
Alydidae
0.5%
Ceratophyllidae
0.2%
Trigoniulidae
0.2%
Nephropidae
0.2%
Lysianassidae
0.2%
Daphniidae
0.2%
Hydrophilidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Artemiidae
0.2%
Rhopalidae
0.2%
Carabidae
0.2%
Pteromalidae
0.2%
Majidae
0.2%
Kiwaidae
0.2%
Siricidae
0.2%
Passalidae
0.2%
Crambidae
0.2%
Cixiidae
0.2%
Taxonomy
Archaea
0
Bacteria
527
Eukaryota
0
Viruses
0
Unclassified
51
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 3 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 4 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 5 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 6 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 7 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 8 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 9 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 10 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 11 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 12 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 13 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 14 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 15 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 16 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 17 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 18 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 19 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 20 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 21 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 22 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 23 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 30 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 31 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 32 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 33 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 34 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 35 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 36 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 37 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 38 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 39 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 40 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 41 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 42 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 43 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 44 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 45 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 46 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 47 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 48 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 49 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 50 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 51 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 52 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 53 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 54 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 55 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 56 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 57 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 58 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 59 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 60 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 61 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 62 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 63 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 64 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 65 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 66 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 67 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 68 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 69 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 70 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 71 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 72 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 73 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 74 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 75 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 76 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 77 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 78 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 79 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 80 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 81 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 82 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 83 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 84 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 85 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 86 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 87 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 88 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 89 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 90 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 91 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 92 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 93 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 94 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 95 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 96 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 97 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 98 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 99 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 100 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 101 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 102 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 103 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 104 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 105 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 106 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 107 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 108 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 109 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 110 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 111 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 112 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 113 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 114 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 115 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 116 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 117 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 118 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 119 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 120 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 121 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 122 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 123 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 124 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 125 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 126 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 127 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 128 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 129 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 130 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 131 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 132 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 133 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 134 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 135 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 136 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 137 | 2958255616 | Serratia marcescens TM | Isolate | |
| 138 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 139 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 140 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 141 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 142 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 143 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 144 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 145 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 146 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 147 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 148 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 149 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 150 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 151 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 152 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 153 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 154 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 155 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 156 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 157 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 158 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 159 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 160 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 161 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 162 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 163 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 164 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 165 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 166 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 167 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 168 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 169 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 170 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 171 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 172 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 173 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 174 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 175 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 176 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 177 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 178 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 179 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 180 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 181 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 182 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 183 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 184 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 185 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 186 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 187 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 188 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 189 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 190 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 191 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 192 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 193 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 194 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 195 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 196 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 197 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 198 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 199 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 200 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 201 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 202 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 203 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 204 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 205 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 206 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 207 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 208 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 209 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 210 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 211 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 212 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 213 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 214 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 215 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 216 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 217 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 218 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 219 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 220 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 221 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 222 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 223 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 224 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 225 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 226 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 227 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 228 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 229 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 230 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 231 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 232 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 233 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 234 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 235 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 236 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 237 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 238 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 239 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 240 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 241 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 242 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 243 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 244 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 245 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 246 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 247 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 248 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 249 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 250 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 251 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 252 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 253 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 254 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 255 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 256 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 257 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 258 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 259 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 260 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 261 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 262 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 263 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 264 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 265 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 266 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 267 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 268 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 269 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 270 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 271 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 272 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 273 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 274 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 275 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 276 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 277 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 278 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 279 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 280 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 281 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 282 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 283 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 284 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 285 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 286 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 287 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 288 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 289 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 290 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 291 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 292 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 293 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 294 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 295 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 296 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 297 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 298 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 299 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 300 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 301 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 302 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 303 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 304 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 305 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 306 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 307 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 308 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 309 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 310 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 311 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 312 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 313 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 314 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 315 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 316 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 317 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 318 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 319 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 320 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 321 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 322 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 323 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 324 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 325 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 326 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 327 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 328 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 329 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 330 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 331 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 332 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 333 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 334 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 335 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 336 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 337 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 338 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 339 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 340 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 341 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 342 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 343 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 344 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 345 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 346 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 347 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 348 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 349 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 350 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 351 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 352 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 353 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 354 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 355 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 356 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 357 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 358 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 359 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 360 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 361 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 362 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 363 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 364 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 365 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 366 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 367 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 368 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 369 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 370 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 371 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 372 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 373 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 374 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 375 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 376 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 377 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 378 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 379 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 380 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 381 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 382 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 383 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 384 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 385 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 386 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 387 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 388 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 389 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 390 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 391 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 392 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 393 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 394 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 395 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 396 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 397 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 398 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 399 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 400 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 401 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 402 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 403 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 404 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 405 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 406 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 407 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 408 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 409 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 410 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 411 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 412 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 413 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 414 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 415 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 416 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 417 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 418 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 419 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 420 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 421 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 422 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 423 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 424 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 425 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 426 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 427 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 428 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 429 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 430 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 431 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 432 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 433 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 434 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 435 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 436 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 437 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 438 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 439 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 440 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 441 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 442 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 443 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 444 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_000046 | 3300056564 | Bacteria | 137604 |
| 2 | Ga0562375_0007 | 3300056856 | Bacteria | 1880046 |
| 3 | Ga0160431_100997 | 3300012828 | Unclassified | 8690 |
| 4 | Ga0160444_102877 | 3300012841 | Unclassified | 2558 |
| 5 | Ga0160445_100003 | 3300012847 | Bacteria | 543107 |
| 6 | Ga0160434_100092 | 3300012850 | Bacteria | 54229 |
| 7 | Ga0466656_289517 | 3300042550 | Bacteria | 1528 |
| 8 | Ga0466657_022809 | 3300042582 | Bacteria | 54942 |
| 9 | Ga0466657_083496 | 3300042582 | Unclassified | 4137 |
| 10 | Ga0466657_224617 | 3300042582 | Bacteria | 5145 |
| 11 | Ga0466657_273109 | 3300042582 | Bacteria | 13105 |
| 12 | Ga0466701_007859 | 3300042598 | Bacteria | 109470 |
| 13 | Ga0123354_10008736 | 3300010882 | Bacteria | 15443 |
| 14 | Ga0466705_475677 | 3300042612 | Bacteria | 1445 |
| 15 | Ga0466723_253211 | 3300042618 | Bacteria | 8704 |
| 16 | DPOL_contig13333 | 2035918003 | Unclassified | 16905 |
| 17 | CVPL010W_10019206 | 3300002931 | Bacteria | 4547 |
| 18 | Ga0063521_1000060 | 3300003973 | Bacteria | 95522 |
| 19 | Ga0063521_1003511 | 3300003973 | Unclassified | 3721 |
| 20 | Ga0063521_1007640 | 3300003973 | Unclassified | 2576 |
| 21 | Ga0102736_1000192 | 3300007052 | Bacteria | 15929 |
| 22 | Ga0102740_1002124 | 3300007140 | Bacteria | 4673 |
| 23 | Ga0102737_1002611 | 3300007142 | Bacteria | 4392 |
| 24 | Ga0103264_1000106 | 3300007188 | Bacteria | 48559 |
| 25 | Ga0123357_10002008 | 3300009784 | Bacteria | 22306 |
| 26 | Ga0466730_018035 | 3300042625 | Bacteria | 1183 |
| 27 | Ga0466725_016500 | 3300042654 | Bacteria | 36157 |
| 28 | Ga0466733_181097 | 3300042659 | Bacteria | 30304 |
| 29 | Ga0530661_002096 | 3300056564 | Bacteria | 8167 |
| 30 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 31 | Ga0466701_029585 | 3300042598 | Bacteria | 129201 |
| 32 | Ga0466700_259980 | 3300042600 | Bacteria | 2307 |
| 33 | Ga0160455_100041 | 3300012837 | Bacteria | 272793 |
| 34 | Ga0160472_110592 | 3300012839 | Bacteria | 1132 |
| 35 | Ga0160443_101234 | 3300012848 | Unclassified | 9537 |
| 36 | Ga0160435_1001877 | 3300012857 | Unclassified | 5180 |
| 37 | Ga0160436_1011224 | 3300012861 | Bacteria | 1924 |
| 38 | Ga0123356_10154386 | 3300010049 | Bacteria | 2284 |
| 39 | Ga0123356_11632477 | 3300010049 | Bacteria | 798 |
| 40 | Ga0160464_100997 | 3300012805 | Unclassified | 13398 |
| 41 | Ga0160471_101981 | 3300012812 | Bacteria | 3623 |
| 42 | Ga0466710_114726 | 3300042613 | Bacteria | 1280 |
| 43 | Ga0466718_166912 | 3300042617 | Bacteria | 2500 |
| 44 | DPOL_contig06126 | 2035918003 | Bacteria | 42797 |
| 45 | SPBB_contig09853 | 2044078006 | Unclassified | 56359 |
| 46 | Meta3P_1000412 | 3300002464 | Bacteria | 36334 |
| 47 | Meta3P_1008885 | 3300002464 | Unclassified | 1941 |
| 48 | JGI24699J35502_10977279 | 3300002509 | Bacteria | 1258 |
| 49 | CVPL010W_10024532 | 3300002931 | Bacteria | 2981 |
| 50 | CVPL010W_10038497 | 3300002931 | Bacteria | 1508 |
| 51 | Ga0102736_1000022 | 3300007052 | Bacteria | 138148 |
| 52 | Ga0102737_1004769 | 3300007142 | Bacteria | 2824 |
| 53 | Ga0103264_1000514 | 3300007188 | Bacteria | 24002 |
| 54 | Ga0466730_025087 | 3300042625 | Unclassified | 17811 |
| 55 | Ga0466730_037247 | 3300042625 | Bacteria | 1014 |
| 56 | Ga0466730_044140 | 3300042625 | Bacteria | 1292 |
| 57 | Ga0466724_35564 | 3300042649 | Bacteria | 10745 |
| 58 | Ga0466724_52064 | 3300042649 | Bacteria | 126311 |
| 59 | Ga0466725_044110 | 3300042654 | Bacteria | 1212 |
| 60 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 61 | Ga0160431_101013 | 3300012828 | Unclassified | 8598 |
| 62 | Ga0160458_100204 | 3300012832 | Unclassified | 43250 |
| 63 | Ga0160472_100306 | 3300012839 | Bacteria | 49835 |
| 64 | Ga0160444_100307 | 3300012841 | Bacteria | 33900 |
| 65 | Ga0160448_100033 | 3300012854 | Bacteria | 138417 |
| 66 | Ga0316159_10927 | 3300030930 | Bacteria | 4084 |
| 67 | Ga0466657_272543 | 3300042582 | Bacteria | 144653 |
| 68 | Ga0466690_089711 | 3300042590 | Bacteria | 11329 |
| 69 | Ga0123356_10014913 | 3300010049 | Bacteria | 7459 |
| 70 | Ga0123353_10355748 | 3300010167 | Bacteria | 2204 |
| 71 | Ga0160464_100117 | 3300012805 | Unclassified | 88640 |
| 72 | DPO_contig02120 | 2032320009 | Bacteria | 83897 |
| 73 | CVPL010W_10012175 | 3300002931 | Bacteria | 6926 |
| 74 | CVPL010W_10034290 | 3300002931 | Bacteria | 1953 |
| 75 | Ga0063521_1000013 | 3300003973 | Bacteria | 168262 |
| 76 | Ga0103264_1000366 | 3300007188 | Bacteria | 23835 |
| 77 | Ga0105005_1007890 | 3300007505 | Bacteria | 2200 |
| 78 | Ga0105005_1039071 | 3300007505 | Bacteria | 16095 |
| 79 | Ga0466702_456322 | 3300042635 | Bacteria | 6505 |
| 80 | Ga0466717_305574 | 3300042604 | Bacteria | 1343 |
| 81 | Ga0466722_036478 | 3300042609 | Bacteria | 3965 |
| 82 | Ga0160470_101099 | 3300012813 | Unclassified | 7315 |
| 83 | Ga0160446_100021 | 3300012835 | Bacteria | 229376 |
| 84 | Ga0160446_102616 | 3300012835 | Bacteria | 3074 |
| 85 | Ga0160444_100053 | 3300012841 | Bacteria | 166531 |
| 86 | Ga0160433_100494 | 3300012846 | Bacteria | 18763 |
| 87 | Ga0160447_100987 | 3300012849 | Unclassified | 11759 |
| 88 | Ga0160434_100524 | 3300012850 | Unclassified | 10045 |
| 89 | Ga0160430_100001 | 3300012852 | Bacteria | 595720 |
| 90 | Ga0160448_100647 | 3300012854 | Bacteria | 11676 |
| 91 | Ga0157631_103866 | 3300013007 | Bacteria | 8959 |
| 92 | Ga0466657_023812 | 3300042582 | Bacteria | 2785 |
| 93 | Ga0466657_227977 | 3300042582 | Unclassified | 4994 |
| 94 | Ga0466692_067817 | 3300042591 | Bacteria | 40030 |
| 95 | Ga0466692_123135 | 3300042591 | Bacteria | 4410 |
| 96 | Ga0123355_10596923 | 3300009826 | Bacteria | 1312 |
| 97 | Ga0123356_10011690 | 3300010049 | Bacteria | 8551 |
| 98 | Ga0160471_101876 | 3300012812 | Bacteria | 3788 |
| 99 | Ga0466710_389880 | 3300042613 | Bacteria | 1535 |
| 100 | Ga0466718_162644 | 3300042617 | Bacteria | 4948 |
| 101 | DPOL_contig15384 | 2035918003 | Unclassified | 13470 |
| 102 | DPOL_contig15838 | 2035918003 | Unclassified | 2640 |
| 103 | Ga0074188_1157671 | 3300005318 | Unclassified | 1411 |
| 104 | Ga0104051_1103229 | 3300007078 | Unclassified | 1606 |
| 105 | Ga0103260_1005272 | 3300007139 | Bacteria | 1913 |
| 106 | Ga0102740_1000036 | 3300007140 | Bacteria | 30532 |
| 107 | Ga0102740_1008577 | 3300007140 | Bacteria | 1679 |
| 108 | Ga0103267_1005870 | 3300007190 | Bacteria | 3462 |
| 109 | Ga0466713_150007 | 3300042602 | Bacteria | 123521 |
| 110 | Ga0160470_104223 | 3300012813 | Bacteria | 2085 |
| 111 | Ga0160453_101373 | 3300012814 | Unclassified | 8598 |
| 112 | Ga0160432_100469 | 3300012818 | Unclassified | 26255 |
| 113 | Ga0160467_100728 | 3300012829 | Bacteria | 24079 |
| 114 | Ga0160445_105390 | 3300012847 | Unclassified | 2196 |
| 115 | Ga0160443_100090 | 3300012848 | Bacteria | 158846 |
| 116 | Ga0466657_165913 | 3300042582 | Bacteria | 2854 |
| 117 | Ga0466693_150650 | 3300042592 | Bacteria | 4029 |
| 118 | Ga0466696_108063 | 3300042596 | Bacteria | 8416 |
| 119 | Ga0123356_10093437 | 3300010049 | Bacteria | 2871 |
| 120 | Ga0123353_10519124 | 3300010167 | Bacteria | 1729 |
| 121 | Ga0123353_10728762 | 3300010167 | Bacteria | 1385 |
| 122 | Ga0123354_10006352 | 3300010882 | Bacteria | 17534 |
| 123 | Ga0466710_045624 | 3300042613 | Bacteria | 7891 |
| 124 | Ga0466710_068771 | 3300042613 | Bacteria | 3370 |
| 125 | Ga0466710_111515 | 3300042613 | Bacteria | 1463 |
| 126 | JGI24705J35276_12238018 | 3300002504 | Bacteria | 15059 |
| 127 | CVPL010W_10002054 | 3300002931 | Bacteria | 23665 |
| 128 | CVPL010W_10036170 | 3300002931 | Bacteria | 2853 |
| 129 | CVPL010L_1000556 | 3300002932 | Unclassified | 7681 |
| 130 | CVPL005W_1004995 | 3300002934 | Unclassified | 2174 |
| 131 | CVPL005L_10002197 | 3300002938 | Bacteria | 22446 |
| 132 | Ga0074304_1143012 | 3300005319 | Bacteria | 1279 |
| 133 | Ga0103261_1001297 | 3300007083 | Bacteria | 6869 |
| 134 | Ga0104041_1001398 | 3300007106 | Bacteria | 5022 |
| 135 | Ga0102734_1008000 | 3300007129 | Bacteria | 3878 |
| 136 | Ga0103268_1001764 | 3300007192 | Bacteria | 5121 |
| 137 | Ga0105005_1002807 | 3300007505 | Unclassified | 2438 |
| 138 | Ga0466734_119628 | 3300042623 | Bacteria | 3980 |
| 139 | Ga0466730_102803 | 3300042625 | Unclassified | 5329 |
| 140 | Ga0466724_05908 | 3300042649 | Unclassified | 20555 |
| 141 | Ga0466701_015773 | 3300042598 | Bacteria | 44563 |
| 142 | Ga0466701_085019 | 3300042598 | Bacteria | 1373 |
| 143 | Ga0466707_096100 | 3300042601 | Bacteria | 163276 |
| 144 | Ga0466722_090658 | 3300042609 | Bacteria | 4084 |
| 145 | Ga0160470_100170 | 3300012813 | Unclassified | 58980 |
| 146 | Ga0160469_100002 | 3300012824 | Bacteria | 1020748 |
| 147 | Ga0265387_1000155 | 3300024582 | Bacteria | 12611 |
| 148 | Ga0123355_10103926 | 3300009826 | Bacteria | 4463 |
| 149 | FGTW_contig13147 | 2065487013 | Unclassified | 7107 |
| 150 | SWWA_contig16972__length_10381___numreads_645 | 2100351016 | Unclassified | 10381 |
| 151 | CVPL005L_10005773 | 3300002938 | Bacteria | 12568 |
| 152 | Ga0102736_1002239 | 3300007052 | Bacteria | 3110 |
| 153 | Ga0102737_1003606 | 3300007142 | Bacteria | 3488 |
| 154 | Ga0102737_1003909 | 3300007142 | Bacteria | 3297 |
| 155 | Ga0102737_1013843 | 3300007142 | Bacteria | 1303 |
| 156 | Ga0103264_1000668 | 3300007188 | Bacteria | 16272 |
| 157 | Ga0103268_1039494 | 3300007192 | Bacteria | 1143 |
| 158 | Ga0466734_095798 | 3300042623 | Bacteria | 54232 |
| 159 | Ga0466724_67335 | 3300042649 | Bacteria | 21611 |
| 160 | Ga0466725_129198 | 3300042654 | Bacteria | 4038 |
| 161 | Ga0466701_019529 | 3300042598 | Bacteria | 146632 |
| 162 | Ga0466713_140209 | 3300042602 | Unclassified | 7159 |
| 163 | Ga0160432_100526 | 3300012818 | Unclassified | 23305 |
| 164 | Ga0160433_100026 | 3300012846 | Bacteria | 183415 |
| 165 | Ga0160448_106520 | 3300012854 | Bacteria | 2910 |
| 166 | Ga0265387_1000023 | 3300024582 | Bacteria | 64853 |
| 167 | Ga0466701_008771 | 3300042598 | Bacteria | 246761 |
| 168 | Ga0123357_10044213 | 3300009784 | Bacteria | 6046 |
| 169 | Ga0123355_10051273 | 3300009826 | Bacteria | 6697 |
| 170 | Ga0123355_10206582 | 3300009826 | Unclassified | 2856 |
| 171 | Ga0466715_431234 | 3300042616 | Bacteria | 5125 |
| 172 | FGTW_contig30476 | 2065487013 | Unclassified | 24936 |
| 173 | SWWA_contig31958__length_3189___numreads_66 | 2100351016 | Bacteria | 3189 |
| 174 | 2227430812 | 2225789004 | Unclassified | 5550 |
| 175 | Meta3P_1000785 | 3300002464 | Unclassified | 16404 |
| 176 | CVPL010L_1003248 | 3300002932 | Bacteria | 2564 |
| 177 | Ga0063521_1000020 | 3300003973 | Bacteria | 138309 |
| 178 | Ga0063521_1000034 | 3300003973 | Bacteria | 116714 |
| 179 | Ga0103260_1000933 | 3300007139 | Bacteria | 5414 |
| 180 | Ga0102740_1007315 | 3300007140 | Unclassified | 1903 |
| 181 | Ga0104050_1028982 | 3300007153 | Bacteria | 2739 |
| 182 | Ga0103264_1049863 | 3300007188 | Bacteria | 3623 |
| 183 | Ga0466730_054155 | 3300042625 | Unclassified | 8227 |
| 184 | Ga0466730_085868 | 3300042625 | Unclassified | 1050 |
| 185 | Ga0466724_04607 | 3300042649 | Unclassified | 13071 |
| 186 | Ga0466724_25445 | 3300042649 | Bacteria | 2772 |
| 187 | Ga0466725_042514 | 3300042654 | Bacteria | 57634 |
| 188 | Ga0466725_154470 | 3300042654 | Bacteria | 3423 |
| 189 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 190 | Ga0562375_0004 | 3300056856 | Bacteria | 3010592 |
| 191 | Ga0466713_040227 | 3300042602 | Bacteria | 18010 |
| 192 | Ga0466722_125434 | 3300042609 | Bacteria | 4260 |
| 193 | Ga0160467_100001 | 3300012829 | Bacteria | 1734829 |
| 194 | Ga0160467_100005 | 3300012829 | Bacteria | 690767 |
| 195 | Ga0160460_100553 | 3300012845 | Bacteria | 20266 |
| 196 | Ga0160445_100039 | 3300012847 | Bacteria | 164891 |
| 197 | Ga0160436_1000027 | 3300012861 | Unclassified | 90817 |
| 198 | Ga0160436_1007359 | 3300012861 | Unclassified | 2513 |
| 199 | Ga0157631_102181 | 3300013007 | Bacteria | 13263 |
| 200 | Ga0466657_097181 | 3300042582 | Bacteria | 1482 |
| 201 | Ga0466690_351730 | 3300042590 | Bacteria | 2488 |
| 202 | Ga0123356_10109091 | 3300010049 | Bacteria | 2670 |
| 203 | Ga0466710_443230 | 3300042613 | Bacteria | 99469 |
| 204 | Ga0466728_053739 | 3300042620 | Bacteria | 9794 |
| 205 | DPOL_contig00174 | 2035918003 | Unclassified | 14207 |
| 206 | FGTW_contig30482 | 2065487013 | Bacteria | 23493 |
| 207 | SWWA_contig05831__length_4064___numreads_97 | 2100351016 | Unclassified | 4064 |
| 208 | HBC_ctgsDRAFT_1003574 | 3300000333 | Bacteria | 3562 |
| 209 | JGI24702J35022_10001662 | 3300002462 | Bacteria | 13823 |
| 210 | CVPL010W_10002039 | 3300002931 | Bacteria | 43912 |
| 211 | Ga0063521_1000916 | 3300003973 | Unclassified | 9747 |
| 212 | Ga0074302_1028741 | 3300005316 | Unclassified | 1621 |
| 213 | Ga0074188_1000564 | 3300005318 | Bacteria | 7848 |
| 214 | Ga0102736_1004733 | 3300007052 | Bacteria | 1792 |
| 215 | Ga0102736_1006258 | 3300007052 | Bacteria | 1472 |
| 216 | Ga0103260_1000136 | 3300007139 | Bacteria | 17354 |
| 217 | Ga0103264_1000261 | 3300007188 | Bacteria | 62554 |
| 218 | Ga0103267_1000309 | 3300007190 | Bacteria | 18363 |
| 219 | Ga0103268_1001194 | 3300007192 | Bacteria | 6733 |
| 220 | Ga0123357_10000042 | 3300009784 | Bacteria | 102427 |
| 221 | Ga0466734_125117 | 3300042623 | Bacteria | 21639 |
| 222 | Ga0466730_001529 | 3300042625 | Unclassified | 43336 |
| 223 | Ga0466730_017938 | 3300042625 | Bacteria | 5345 |
| 224 | Ga0466730_069675 | 3300042625 | Bacteria | 9907 |
| 225 | Ga0466709_024098 | 3300042648 | Bacteria | 6602 |
| 226 | Ga0466708_034393 | 3300042652 | Bacteria | 30437 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.