Protein Family IF13704
Metagenome
Isolate
433
Members
327
Samples
173
Scaffolds
390.28
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8021540981|8021545593|
- Length
- 443 aa
- Sequence
- MVSRNYPLTVSWINQCTGTVCSLLRNMYGSRHECRHYWYNNFCEGIAMEQTWRWYGPNDPVSLDDVRQAGATGVVTALHHIANGQVWPVDEIKERQALLAAKGLTWSVVESIPVHEDIKTHSGQYTTWIANYQQSIRNLAACGIDTVCYNFMPILDWTRTDLEYELPDGSRALRFDQIAFAAFELHILKRPGAEADYSEEEQRQAEAYYKAMSEADIEKLTRNIIAGLPGAEEGYTLDQFRARLAEYDHIDKAQLRENMAYFLRAIVPVCEEVGIRLAVHPDDPPRPILGLPRIVSTIEDMQWLKETVDSINNGFTMCTGSYGVRADNDLVKMVETFGDRIHFTHLRSTCREANPKTFHEAAHLSGDVNMVAVVDAILREEQRRKQAGDLRPIPFRPDHGHQMLDDLRKKTNPGYSAIGRLKGMAEVRGVELALKMTKYPELL
Sample Types
Isolate
59.8%
Metagenome
40.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
29.4%
Unclassified
20.9%
Anthocoridae
4.4%
Drosophilidae
3.8%
Formicidae
3.8%
Kalotermitidae
3.8%
Muscidae
3.8%
Curculionidae
3.5%
Culicidae
2.8%
Calliphoridae
2.5%
Tenebrionidae
2.5%
Termitidae
2.5%
Armadillidiidae
1.9%
Termopsidae
1.3%
Cerambycidae
1.3%
Palinuridae
0.9%
Tephritidae
0.9%
Talitridae
0.9%
Pentatomidae
0.6%
Elmidae
0.6%
Sarcophagidae
0.6%
Passalidae
0.6%
Aphididae
0.6%
Daphniidae
0.6%
Plutellidae
0.6%
Rhinotermitidae
0.6%
Crambidae
0.3%
Acrididae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Thripidae
0.3%
Pteromalidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Carabidae
0.3%
Hodotermitidae
0.3%
Majidae
0.3%
Taxonomy
Archaea
0
Bacteria
404
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 2 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 3 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 4 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 5 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 6 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 7 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 8 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 9 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 10 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 11 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 12 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 13 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 14 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 15 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 16 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 17 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 18 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 19 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 20 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 21 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 22 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 23 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 24 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 27 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 28 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 29 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 30 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 31 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 32 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 38 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 39 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 40 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 41 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 42 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 43 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 44 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 45 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 46 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 47 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 48 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 49 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 50 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 51 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 52 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 53 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 54 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 55 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 56 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 57 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 58 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 59 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 60 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 61 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 62 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 63 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 64 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 65 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 66 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 67 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 68 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 69 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 70 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 71 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 72 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 73 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 74 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 75 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 76 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 77 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 78 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 79 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 80 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 81 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 82 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 83 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 84 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 85 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 86 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 87 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 88 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 89 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 90 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 91 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 92 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 93 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 94 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 95 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 96 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 97 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 98 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 99 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 100 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 101 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 102 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 103 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 104 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 105 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 106 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 107 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 108 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 109 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 110 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 111 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 112 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 113 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 114 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 115 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 116 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 117 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 118 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 119 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 120 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 121 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 122 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 123 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 124 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 125 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 126 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 127 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 128 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 129 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 130 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 131 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 132 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 133 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 134 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 135 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 136 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 137 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 138 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 139 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 140 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 141 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 142 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 143 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 144 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 145 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 146 | 2958255616 | Serratia marcescens TM | Isolate | |
| 147 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 148 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 149 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 150 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 151 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 152 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 153 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 154 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 155 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 156 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 157 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 158 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 159 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 160 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 161 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 162 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 163 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 164 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 165 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 166 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 167 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 168 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 169 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 170 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 171 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 172 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 173 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 174 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 175 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 176 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 177 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 178 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 179 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 180 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 181 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 182 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 183 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 184 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 185 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 186 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 187 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 188 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 189 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 190 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 191 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 192 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 193 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 194 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 195 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 196 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 197 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 198 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 199 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 200 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 201 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 202 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 203 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 204 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 205 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 206 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 207 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 208 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 209 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 210 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 211 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 212 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 213 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 214 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 215 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 216 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 217 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 218 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 219 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 220 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 221 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 222 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 223 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 224 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 225 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 226 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 227 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 228 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 229 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 230 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 231 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 232 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 233 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 234 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 235 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 236 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 237 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 238 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 239 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 240 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 241 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 242 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 243 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 244 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 245 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 246 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 247 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 248 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 249 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 250 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 251 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 252 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 253 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 254 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 255 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 256 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 257 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 258 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 259 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 260 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 261 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 262 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 263 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 264 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 265 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 266 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 267 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 268 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 269 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 270 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 271 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 272 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 273 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 274 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 275 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 276 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 277 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 278 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 279 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 280 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 281 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 282 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 283 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 284 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 285 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 286 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 287 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 288 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 289 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 290 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 291 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 292 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 293 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 294 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 295 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 296 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 297 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 298 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 299 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 300 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 301 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 302 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 303 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 304 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 305 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 306 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 307 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 308 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 309 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 310 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 311 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 312 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 313 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 314 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 315 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 316 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 317 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 318 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 319 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 320 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 321 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 322 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 323 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 324 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 325 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 326 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 327 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 2 | Ga0466714_078883 | 3300042603 | Bacteria | 3393 |
| 3 | Ga0123355_10166864 | 3300009826 | Bacteria | 3301 |
| 4 | Ga0123356_10216159 | 3300010049 | Bacteria | 1970 |
| 5 | Ga0160446_100265 | 3300012835 | Bacteria | 32629 |
| 6 | Ga0160455_100616 | 3300012837 | Unclassified | 15513 |
| 7 | Ga0160433_100127 | 3300012846 | Bacteria | 68773 |
| 8 | Ga0466690_147187 | 3300042590 | Bacteria | 19575 |
| 9 | Ga0466692_099715 | 3300042591 | Bacteria | 2244 |
| 10 | FGTW_contig06820 | 2065487013 | Unclassified | 1743 |
| 11 | IMNBL1DRAFT_c0002869 | 3300000062 | Bacteria | 11558 |
| 12 | SCG598L16_135900 | 3300000490 | Bacteria | 90439 |
| 13 | CVPL010W_10005429 | 3300002931 | Bacteria | 13640 |
| 14 | CVPL010L_1003405 | 3300002932 | Unclassified | 1822 |
| 15 | Ga0068302_10029072 | 3300005071 | Bacteria | 5258 |
| 16 | Ga0074302_1136717 | 3300005316 | Unclassified | 1725 |
| 17 | Ga0103268_1000493 | 3300007192 | Bacteria | 11934 |
| 18 | Ga0466734_087919 | 3300042623 | Bacteria | 2032 |
| 19 | Ga0466730_009517 | 3300042625 | Bacteria | 72332 |
| 20 | Ga0466730_033506 | 3300042625 | Bacteria | 40067 |
| 21 | Ga0466703_353799 | 3300042636 | Bacteria | 98308 |
| 22 | Ga0466724_62278 | 3300042649 | Bacteria | 2981 |
| 23 | Ga0466728_177231 | 3300042620 | Bacteria | 3298 |
| 24 | Ga0466733_140515 | 3300042659 | Bacteria | 6065 |
| 25 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 26 | Ga0123353_10135808 | 3300010167 | Bacteria | 3944 |
| 27 | Ga0123353_10225099 | 3300010167 | Bacteria | 2929 |
| 28 | Ga0160448_104662 | 3300012854 | Unclassified | 3762 |
| 29 | Ga0247290_00600 | 3300035364 | Unclassified | 5937 |
| 30 | Ga0466691_009899 | 3300042593 | Bacteria | 3783 |
| 31 | Ga0466696_189901 | 3300042596 | Bacteria | 10950 |
| 32 | Ga0063521_1000009 | 3300003973 | Bacteria | 190208 |
| 33 | Ga0104051_1101869 | 3300007078 | Bacteria | 2900 |
| 34 | Ga0104041_1032490 | 3300007106 | Bacteria | 5743 |
| 35 | Ga0104040_1142036 | 3300007149 | Unclassified | 4661 |
| 36 | Ga0104040_1142291 | 3300007149 | Bacteria | 3075 |
| 37 | Ga0105553_1075025 | 3300007767 | Bacteria | 5413 |
| 38 | Ga0466730_003235 | 3300042625 | Unclassified | 1468 |
| 39 | Ga0466730_048631 | 3300042625 | Bacteria | 90164 |
| 40 | Ga0466724_37455 | 3300042649 | Bacteria | 30532 |
| 41 | Ga0466711_093700 | 3300042615 | Bacteria | 2912 |
| 42 | Ga0466728_065730 | 3300042620 | Bacteria | 16851 |
| 43 | Ga0466705_307273 | 3300042612 | Bacteria | 3111 |
| 44 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 45 | Ga0466707_154277 | 3300042601 | Bacteria | 12010 |
| 46 | Ga0466707_300943 | 3300042601 | Bacteria | 7115 |
| 47 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 48 | Ga0466714_131109 | 3300042603 | Bacteria | 2980 |
| 49 | Ga0466716_208958 | 3300042605 | Bacteria | 2034 |
| 50 | Ga0160433_101599 | 3300012846 | Unclassified | 5928 |
| 51 | Ga0316159_10755 | 3300030930 | Bacteria | 4690 |
| 52 | Ga0466690_121026 | 3300042590 | Bacteria | 3618 |
| 53 | 2227507941 | 2225789004 | Bacteria | 76739 |
| 54 | Ga0074278_129590 | 3300005721 | Bacteria | 100971 |
| 55 | Ga0104051_1103221 | 3300007078 | Unclassified | 1608 |
| 56 | Ga0102738_1001992 | 3300007141 | Bacteria | 3087 |
| 57 | Ga0466735_037453 | 3300042624 | Bacteria | 5588 |
| 58 | Ga0466735_112259 | 3300042624 | Bacteria | 12703 |
| 59 | Ga0466730_008632 | 3300042625 | Bacteria | 30892 |
| 60 | Ga0466704_458428 | 3300042643 | Bacteria | 21257 |
| 61 | Ga0466727_300761 | 3300042655 | Bacteria | 2237 |
| 62 | Ga0466711_382674 | 3300042615 | Bacteria | 10110 |
| 63 | Ga0562377_0037 | 3300056842 | Bacteria | 656123 |
| 64 | Ga0466706_206411 | 3300042599 | Bacteria | 2620 |
| 65 | Ga0466707_286262 | 3300042601 | Unclassified | 1985 |
| 66 | Ga0466722_111166 | 3300042609 | Bacteria | 17794 |
| 67 | Ga0160471_100661 | 3300012812 | Bacteria | 8669 |
| 68 | Ga0160444_103073 | 3300012841 | Bacteria | 2441 |
| 69 | Ga0160435_1000045 | 3300012857 | Bacteria | 92320 |
| 70 | DPOL_contig16210 | 2035918003 | Bacteria | 5896 |
| 71 | gam1t_NODE_680599_length=8012_GC=33_9_Contigs=9 | 2189573031 | Unclassified | 8092 |
| 72 | IMNBL1DRAFT_c0005354 | 3300000062 | Bacteria | 7366 |
| 73 | SCG598P17_11240 | 3300000461 | Bacteria | 36996 |
| 74 | CVPL010L_1000130 | 3300002932 | Bacteria | 22349 |
| 75 | Ga0063521_1008583 | 3300003973 | Unclassified | 2440 |
| 76 | Ga0074188_1155755 | 3300005318 | Unclassified | 1991 |
| 77 | Ga0103266_1000989 | 3300007067 | Bacteria | 5339 |
| 78 | Ga0103265_1000088 | 3300007068 | Unclassified | 13654 |
| 79 | Ga0104040_1000680 | 3300007149 | Bacteria | 5004 |
| 80 | Ga0466727_007031 | 3300042655 | Bacteria | 10843 |
| 81 | Ga0466723_217097 | 3300042618 | Bacteria | 2443 |
| 82 | Ga0466733_124706 | 3300042659 | Bacteria | 3381 |
| 83 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 84 | Ga0466707_372205 | 3300042601 | Bacteria | 11183 |
| 85 | Ga0123355_10019058 | 3300009826 | Bacteria | 10916 |
| 86 | Ga0123355_10061261 | 3300009826 | Bacteria | 6076 |
| 87 | Ga0160468_100081 | 3300012819 | Bacteria | 123596 |
| 88 | Ga0160468_106367 | 3300012819 | Bacteria | 1282 |
| 89 | Ga0160455_100069 | 3300012837 | Bacteria | 184978 |
| 90 | Ga0466690_041750 | 3300042590 | Bacteria | 12537 |
| 91 | Ga0466690_093759 | 3300042590 | Bacteria | 4343 |
| 92 | Ga0466691_051100 | 3300042593 | Bacteria | 8242 |
| 93 | 2227100826 | 2225789004 | Unclassified | 1792 |
| 94 | IMNBL1DRAFT_c0001464 | 3300000062 | Bacteria | 17646 |
| 95 | SCG598I20_11690 | 3300000473 | Bacteria | 50215 |
| 96 | Ga0063521_1000137 | 3300003973 | Bacteria | 54669 |
| 97 | Ga0074311_1143457 | 3300005317 | Bacteria | 1584 |
| 98 | Ga0103264_1000161 | 3300007188 | Bacteria | 55153 |
| 99 | Ga0105008_1017997 | 3300007507 | Unclassified | 3812 |
| 100 | Ga0466703_290973 | 3300042636 | Bacteria | 1717 |
| 101 | Ga0466724_45304 | 3300042649 | Bacteria | 38049 |
| 102 | Ga0466723_340821 | 3300042618 | Bacteria | 6319 |
| 103 | Ga0466705_110916 | 3300042612 | Bacteria | 65673 |
| 104 | Ga0562378_0401 | 3300056814 | Bacteria | 79876 |
| 105 | Ga0466713_038994 | 3300042602 | Bacteria | 1331 |
| 106 | Ga0466713_054440 | 3300042602 | Unclassified | 2376 |
| 107 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 108 | Ga0466714_154944 | 3300042603 | Bacteria | 103066 |
| 109 | Ga0160433_101657 | 3300012846 | Bacteria | 5770 |
| 110 | Ga0265387_1000021 | 3300024582 | Bacteria | 68555 |
| 111 | Ga0247289_0005 | 3300035363 | Bacteria | 82561 |
| 112 | Ga0247289_0008 | 3300035363 | Unclassified | 74200 |
| 113 | Ga0247290_00008 | 3300035364 | Bacteria | 91582 |
| 114 | Ga0466690_198094 | 3300042590 | Bacteria | 1749 |
| 115 | Ga0466696_171399 | 3300042596 | Bacteria | 3327 |
| 116 | DPOL_contig15617 | 2035918003 | Unclassified | 63688 |
| 117 | FGTW_contig31625 | 2065487013 | Bacteria | 3862 |
| 118 | gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 | 2189573031 | Bacteria | 100971 |
| 119 | gam1t_NODE_660665_length=13869_GC=34_7_Contigs=2 | 2189573031 | Bacteria | 13879 |
| 120 | Meta3P_1000921 | 3300002464 | Bacteria | 16122 |
| 121 | Ga0063521_1000484 | 3300003973 | Bacteria | 19204 |
| 122 | Ga0074278_104671 | 3300005721 | Bacteria | 13879 |
| 123 | Ga0104042_1119862 | 3300007130 | Unclassified | 2609 |
| 124 | Ga0102738_1000248 | 3300007141 | Bacteria | 10734 |
| 125 | Ga0466730_049373 | 3300042625 | Unclassified | 2612 |
| 126 | Ga0466704_583464 | 3300042643 | Bacteria | 34188 |
| 127 | Ga0466709_279016 | 3300042648 | Bacteria | 4006 |
| 128 | Ga0466724_67748 | 3300042649 | Unclassified | 22717 |
| 129 | Ga0466715_093005 | 3300042616 | Bacteria | 8882 |
| 130 | Ga0466723_034132 | 3300042618 | Bacteria | 4364 |
| 131 | Ga0466726_062467 | 3300042619 | Bacteria | 4896 |
| 132 | Ga0466707_037111 | 3300042601 | Unclassified | 4075 |
| 133 | Ga0466707_382688 | 3300042601 | Bacteria | 19671 |
| 134 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 135 | Ga0466713_135258 | 3300042602 | Bacteria | 7268 |
| 136 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 137 | Ga0160467_100029 | 3300012829 | Bacteria | 258610 |
| 138 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 139 | Ga0160433_100240 | 3300012846 | Bacteria | 39651 |
| 140 | Ga0160445_100114 | 3300012847 | Bacteria | 71378 |
| 141 | Ga0160448_100016 | 3300012854 | Bacteria | 240625 |
| 142 | Ga0265387_1000398 | 3300024582 | Bacteria | 6932 |
| 143 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 144 | Ga0466690_018538 | 3300042590 | Bacteria | 3986 |
| 145 | FGTW_contig30559 | 2065487013 | Bacteria | 16349 |
| 146 | HBC_ctgsDRAFT_1000306 | 3300000333 | Bacteria | 11173 |
| 147 | CVPL010L_1000009 | 3300002932 | Bacteria | 129286 |
| 148 | Ga0063521_1000068 | 3300003973 | Bacteria | 87932 |
| 149 | Ga0063521_1003237 | 3300003973 | Bacteria | 3886 |
| 150 | Ga0063521_1009412 | 3300003973 | Unclassified | 2339 |
| 151 | Ga0074278_137551 | 3300005721 | Unclassified | 8092 |
| 152 | Ga0103261_1000191 | 3300007083 | Unclassified | 10298 |
| 153 | Ga0102740_1000767 | 3300007140 | Bacteria | 9617 |
| 154 | Ga0103264_1000386 | 3300007188 | Bacteria | 23118 |
| 155 | Ga0104147_1012875 | 3300007224 | Bacteria | 13297 |
| 156 | Ga0466735_090852 | 3300042624 | Bacteria | 7986 |
| 157 | Ga0466730_025729 | 3300042625 | Bacteria | 20513 |
| 158 | Ga0466715_119024 | 3300042616 | Bacteria | 12209 |
| 159 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 160 | Ga0466707_126289 | 3300042601 | Unclassified | 4159 |
| 161 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 162 | Ga0466713_122291 | 3300042602 | Bacteria | 25380 |
| 163 | Ga0160448_103017 | 3300012854 | Bacteria | 5038 |
| 164 | Ga0466696_337848 | 3300042596 | Bacteria | 1264 |
| 165 | GhopperDRAF_NODE_365295_len_1505_cov_6_616611 | 2035265001 | Bacteria | 1535 |
| 166 | FGTW_contig31104 | 2065487013 | Bacteria | 6095 |
| 167 | gam1t_NODE_193726_length=9665_GC=33_4_Contigs=1 | 2189573031 | Unclassified | 9665 |
| 168 | Ga0074278_110845 | 3300005721 | Bacteria | 9665 |
| 169 | Ga0102736_1000494 | 3300007052 | Bacteria | 7959 |
| 170 | Ga0466735_071698 | 3300042624 | Bacteria | 4273 |
| 171 | Ga0466735_114761 | 3300042624 | Bacteria | 3857 |
| 172 | Ga0466703_043626 | 3300042636 | Bacteria | 13742 |
| 173 | Ga0466726_003449 | 3300042619 | Bacteria | 4084 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03786 | UxuA | D-mannonate dehydratase (UxuA) | 48 | 435 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.