Protein Family IF10732
Metagenome
Isolate
602
Members
493
Samples
203
Scaffolds
417.81
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2507262005|2507287393|
- Length
- 494 aa
- Sequence
- MTNEAIIPPGGRKFTGGSQGTFENKVVEPSVGKKMRYETDGKLWVPDNPIIPFIEGDGIGVDVTPAMIKVVDAAVEKAYKGKRKIAWMEIYAGEKAKKIYQKDIYGNDTWLPAETVGLIREHIVAIKGPLTTPVGGGIRSLNVSLRQELDLYICLRPVRYFYGVPSPLKNPELTDMVIFRENSEDIYTGIEWKAGSAEADKLMKFLCCEMEVAESKFLCKQGTAHDFSKKCWFGMKFCSFFCSLFCKKGAVHNFLCRALIKKNYVHTFSKECGLGVKFCTKEGTQRLVRAAIQYAIDHDRQSVTLVHKGNIMKFTEGAFKNWGYQLACEEFGASPFEGGAWMKIQNPKNGKDIIIKDVIADAFLQQILLSPEKYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDKCALFEATHGTAPKYAGQNKANPGSIILSAEMMLRHMDWNEAADLMIKGITNAIKNKTITYDFARFTQDAQERKCSEFADDIIENM
Sample Types
Isolate
66.3%
Metagenome
33.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
16.4%
Apidae
15.6%
Unclassified
13.5%
Elmidae
5.7%
Drosophilidae
4.6%
Anthocoridae
4.4%
Termitidae
4.4%
Curculionidae
4.2%
Culicidae
3.6%
Aphididae
3.6%
Formicidae
3.4%
Muscidae
2.7%
Tenebrionidae
2.3%
Calliphoridae
1.9%
Sarcophagidae
1.7%
Armadillidiidae
1.5%
Tephritidae
1.1%
Kalotermitidae
0.8%
Cerambycidae
0.8%
Rhinotermitidae
0.6%
Passalidae
0.6%
Pteromalidae
0.6%
Aleyrodidae
0.4%
Hydrophilidae
0.4%
Berytidae
0.4%
Crambidae
0.4%
Largidae
0.4%
Alydidae
0.4%
Pentatomidae
0.4%
Lysianassidae
0.2%
Daphniidae
0.2%
Hodotermitidae
0.2%
Majidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Trigoniulidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Carabidae
0.2%
Ixodidae
0.2%
Gryllidae
0.2%
Taxonomy
Archaea
0
Bacteria
553
Eukaryota
0
Viruses
0
Unclassified
49
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 3 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 4 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 5 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 6 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 7 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 8 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 9 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 10 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 11 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 12 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 13 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 14 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 15 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 16 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 17 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 18 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 19 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 20 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 21 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 22 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 23 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 24 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 25 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 26 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 33 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 35 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 36 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 37 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 38 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 39 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 40 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 41 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 42 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 43 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 44 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 45 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 46 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 47 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 48 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 49 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 50 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 51 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 52 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 53 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 54 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 55 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 56 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 57 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 58 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 59 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 60 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 61 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 62 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 63 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 64 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 65 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 66 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 67 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 68 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 69 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 70 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 71 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 72 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 73 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 74 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 75 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 76 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 77 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 78 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 79 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 80 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 81 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 82 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 83 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 84 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 85 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 86 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 87 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 88 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 89 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 90 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 91 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 92 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 93 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 94 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 95 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 96 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 97 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 98 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 99 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 100 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 101 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 102 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 103 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 104 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 105 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 106 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 107 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 108 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 109 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 110 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 111 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 112 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 113 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 114 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 115 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 116 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 117 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 118 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 119 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 120 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 121 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 122 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 123 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 124 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 125 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 126 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 127 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 128 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 129 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 130 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 131 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 132 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 133 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 134 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 135 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 136 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 137 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 138 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 139 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 140 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 141 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 142 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 143 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 144 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 145 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 146 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 147 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 148 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 149 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 150 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 151 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 152 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 153 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 154 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 155 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 156 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 157 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 158 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 159 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 160 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 161 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 162 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 163 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 164 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 165 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 166 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 167 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 168 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 169 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 170 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 171 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 172 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 173 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 174 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 175 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 176 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 177 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 178 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 179 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 180 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 181 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 182 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 183 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 184 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 185 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 186 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 187 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 188 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 189 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 190 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 191 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 192 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 193 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 194 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 195 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 196 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 197 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 198 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 199 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 200 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 201 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 202 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 203 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 204 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 205 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 206 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 207 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 208 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 209 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 210 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 211 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 212 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 213 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 214 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 215 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 216 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 217 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 218 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 219 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 220 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 221 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 222 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 223 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 224 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 225 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 226 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 227 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 228 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 229 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 230 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 231 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 232 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 233 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 234 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 235 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 236 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 237 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 238 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 239 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 240 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 241 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 242 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 243 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 244 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 245 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 246 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 247 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 248 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 249 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 250 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 251 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 252 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 253 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 254 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 255 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 256 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 257 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 258 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 259 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 260 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 261 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 262 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 263 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 264 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 265 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 266 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 267 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 268 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 269 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 270 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 271 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 272 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 273 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 274 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 275 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 276 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 277 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 278 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 279 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 280 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 281 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 282 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 283 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 284 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 285 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 286 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 287 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 288 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 289 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 290 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 291 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 292 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 293 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 294 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 295 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 296 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 297 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 298 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 299 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 300 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 301 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 302 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 303 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 304 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 305 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 306 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 307 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 308 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 309 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 310 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 311 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 312 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 313 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 314 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 315 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 316 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 317 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 318 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 319 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 320 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 321 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 322 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 323 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 324 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 325 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 326 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 327 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 328 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 329 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 330 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 331 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 332 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 333 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 334 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 335 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 336 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 337 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 338 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 339 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 340 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 341 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 342 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 343 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 344 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 345 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 346 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 347 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 348 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 349 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 350 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 351 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 352 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 353 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 354 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 355 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 356 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 357 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 358 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 359 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 360 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 361 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 362 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 363 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 364 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 365 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 366 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 367 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 368 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 369 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 370 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 371 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 372 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 373 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 374 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 375 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 376 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 377 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 378 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 379 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 380 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 381 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 382 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 383 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 384 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 385 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 386 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 387 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 388 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 389 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 390 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 391 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 392 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 393 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 394 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 395 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 396 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 397 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 398 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 399 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 400 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 401 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 402 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 403 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 404 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 405 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 406 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 407 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 408 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 409 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 410 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 411 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 412 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 413 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 414 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 415 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 416 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 417 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 418 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 419 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 420 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 421 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 422 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 423 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 424 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 425 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 426 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 427 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 428 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 429 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 430 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 431 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 432 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 433 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 434 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 435 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 436 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 437 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 438 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 439 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 440 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 441 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 442 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 443 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 444 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 445 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 446 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 447 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 448 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 449 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 450 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 451 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 452 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 453 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 454 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 455 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 456 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 457 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 458 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 459 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 460 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 461 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 462 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 463 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 464 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 465 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 466 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 467 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 468 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 469 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 470 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 471 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 472 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 473 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 474 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 475 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 476 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 477 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 478 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 479 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 480 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 481 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 482 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 483 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 484 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 485 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 486 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 487 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 488 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 489 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 490 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 491 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 492 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 493 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_140741 | 3300042611 | Bacteria | 5739 |
| 2 | Ga0160453_103880 | 3300012814 | Bacteria | 2929 |
| 3 | Ga0160460_100534 | 3300012845 | Bacteria | 21190 |
| 4 | Ga0265387_1000619 | 3300024582 | Unclassified | 5570 |
| 5 | Ga0466694_177760 | 3300042594 | Bacteria | 2309 |
| 6 | Ga0123356_10061879 | 3300010049 | Unclassified | 3496 |
| 7 | Ga0123353_10252124 | 3300010167 | Bacteria | 2732 |
| 8 | Ga0123354_10000003 | 3300010882 | Bacteria | 303062 |
| 9 | Ga0160471_100049 | 3300012812 | Bacteria | 163291 |
| 10 | Ga0466701_050125 | 3300042598 | Bacteria | 85937 |
| 11 | Ga0466706_052238 | 3300042599 | Bacteria | 6162 |
| 12 | Ga0466713_052057 | 3300042602 | Bacteria | 69837 |
| 13 | Ga0466721_024590 | 3300042608 | Bacteria | 2153 |
| 14 | HBC_ctgsDRAFT_1003585 | 3300000333 | Bacteria | 3559 |
| 15 | WW0001_100241 | 3300002732 | Bacteria | 118798 |
| 16 | CVPL010W_10009995 | 3300002931 | Bacteria | 16608 |
| 17 | Ga0072941_1177347 | 3300005201 | Bacteria | 9713 |
| 18 | Ga0102736_1000433 | 3300007052 | Bacteria | 8571 |
| 19 | Ga0104042_1001090 | 3300007130 | Bacteria | 5130 |
| 20 | Ga0102740_1000798 | 3300007140 | Unclassified | 8529 |
| 21 | Ga0103264_1000012 | 3300007188 | Bacteria | 124297 |
| 22 | Ga0105553_1041971 | 3300007767 | Unclassified | 6166 |
| 23 | Ga0466724_54446 | 3300042649 | Unclassified | 55900 |
| 24 | Ga0466697_202167 | 3300042611 | Bacteria | 2076 |
| 25 | Ga0562378_0537 | 3300056814 | Bacteria | 61658 |
| 26 | Ga0562374_0128 | 3300057007 | Bacteria | 193000 |
| 27 | Ga0160468_100589 | 3300012819 | Unclassified | 13582 |
| 28 | Ga0160467_100283 | 3300012829 | Bacteria | 59093 |
| 29 | Ga0160433_100364 | 3300012846 | Unclassified | 26363 |
| 30 | Ga0123356_10009302 | 3300010049 | Bacteria | 9706 |
| 31 | Ga0466710_249716 | 3300042613 | Bacteria | 63199 |
| 32 | Ga0466701_080739 | 3300042598 | Bacteria | 98476 |
| 33 | Ga0466706_080721 | 3300042599 | Bacteria | 40521 |
| 34 | Ga0466717_057655 | 3300042604 | Bacteria | 3616 |
| 35 | DPO_contig06813 | 2032320009 | Bacteria | 12261 |
| 36 | DPOL_contig14086 | 2035918003 | Unclassified | 58258 |
| 37 | 2227080787 | 2225789004 | Bacteria | 142991 |
| 38 | SCG598O11_12225 | 3300000471 | Bacteria | 128113 |
| 39 | JGI24705J35276_12236346 | 3300002504 | Bacteria | 7872 |
| 40 | Ga0102734_1003379 | 3300007129 | Bacteria | 3618 |
| 41 | Ga0102737_1000042 | 3300007142 | Bacteria | 36771 |
| 42 | Ga0102737_1000499 | 3300007142 | Bacteria | 12778 |
| 43 | Ga0103264_1000069 | 3300007188 | Bacteria | 85289 |
| 44 | Ga0466730_011576 | 3300042625 | Bacteria | 72720 |
| 45 | Ga0466724_27122 | 3300042649 | Unclassified | 2333 |
| 46 | Ga0466724_42166 | 3300042649 | Bacteria | 51734 |
| 47 | Ga0466725_072290 | 3300042654 | Unclassified | 8935 |
| 48 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 49 | Ga0160468_103324 | 3300012819 | Unclassified | 2244 |
| 50 | Ga0160448_105504 | 3300012854 | Unclassified | 3306 |
| 51 | Ga0265387_1000034 | 3300024582 | Bacteria | 52969 |
| 52 | Ga0466695_195304 | 3300042595 | Unclassified | 4351 |
| 53 | Ga0466701_009543 | 3300042598 | Bacteria | 17939 |
| 54 | Ga0466701_012048 | 3300042598 | Bacteria | 19642 |
| 55 | Ga0466701_014547 | 3300042598 | Bacteria | 8391 |
| 56 | Ga0123356_10000003 | 3300010049 | Bacteria | 290856 |
| 57 | Ga0466710_036981 | 3300042613 | Bacteria | 2495 |
| 58 | Ga0466701_103266 | 3300042598 | Bacteria | 6434 |
| 59 | Ga0466713_022614 | 3300042602 | Bacteria | 74715 |
| 60 | Ga0466717_201166 | 3300042604 | Bacteria | 2232 |
| 61 | SPBB_contig00370 | 2044078006 | Bacteria | 118424 |
| 62 | CVPL005W_1000938 | 3300002934 | Bacteria | 9200 |
| 63 | CVPL005L_10017208 | 3300002938 | Bacteria | 4285 |
| 64 | Ga0104048_1168897 | 3300007143 | Bacteria | 2657 |
| 65 | Ga0103264_1000319 | 3300007188 | Bacteria | 26150 |
| 66 | Ga0466730_007415 | 3300042625 | Unclassified | 27704 |
| 67 | Ga0466730_028878 | 3300042625 | Unclassified | 40765 |
| 68 | Ga0466730_052371 | 3300042625 | Bacteria | 25627 |
| 69 | Ga0466730_099211 | 3300042625 | Unclassified | 4509 |
| 70 | Ga0466724_07199 | 3300042649 | Bacteria | 1743 |
| 71 | Ga0466724_27236 | 3300042649 | Unclassified | 2929 |
| 72 | Ga0466708_036911 | 3300042652 | Bacteria | 7203 |
| 73 | Ga0466725_002256 | 3300042654 | Bacteria | 27409 |
| 74 | Ga0562374_0023 | 3300057007 | Bacteria | 1031437 |
| 75 | Ga0160456_100037 | 3300012820 | Bacteria | 206901 |
| 76 | Ga0160447_101623 | 3300012849 | Bacteria | 8588 |
| 77 | Ga0466695_123299 | 3300042595 | Bacteria | 2030 |
| 78 | Ga0123355_10150009 | 3300009826 | Unclassified | 3544 |
| 79 | Ga0123353_10304101 | 3300010167 | Bacteria | 2432 |
| 80 | Ga0160465_105148 | 3300012803 | Unclassified | 1779 |
| 81 | Ga0466710_090218 | 3300042613 | Bacteria | 9492 |
| 82 | Ga0466710_173395 | 3300042613 | Bacteria | 6919 |
| 83 | Ga0466710_418926 | 3300042613 | Bacteria | 2262 |
| 84 | Ga0466706_035589 | 3300042599 | Bacteria | 5052 |
| 85 | SCG598O02_12513 | 3300000460 | Bacteria | 160606 |
| 86 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 87 | Meta3P_1001064 | 3300002464 | Unclassified | 12650 |
| 88 | CVPL010L_1000071 | 3300002932 | Bacteria | 93695 |
| 89 | CVPL005W_1000600 | 3300002934 | Bacteria | 13446 |
| 90 | CVPL005L_10000364 | 3300002938 | Bacteria | 63119 |
| 91 | Ga0063521_1000666 | 3300003973 | Unclassified | 13458 |
| 92 | Ga0103266_1000120 | 3300007067 | Bacteria | 38540 |
| 93 | Ga0104041_1002813 | 3300007106 | Unclassified | 17486 |
| 94 | Ga0102734_1001136 | 3300007129 | Bacteria | 6758 |
| 95 | Ga0103268_1000003 | 3300007192 | Bacteria | 104067 |
| 96 | Ga0104147_1028668 | 3300007224 | Unclassified | 3536 |
| 97 | Ga0466731_200800 | 3300042622 | Unclassified | 3052 |
| 98 | Ga0466730_002581 | 3300042625 | Bacteria | 4748 |
| 99 | Ga0466730_033616 | 3300042625 | Unclassified | 4754 |
| 100 | Ga0530661_000820 | 3300056564 | Unclassified | 19576 |
| 101 | Ga0562379_0400 | 3300056790 | Bacteria | 96904 |
| 102 | Ga0160459_101864 | 3300012831 | Unclassified | 3923 |
| 103 | Ga0160446_101307 | 3300012835 | Bacteria | 5578 |
| 104 | Ga0160443_104580 | 3300012848 | Bacteria | 2047 |
| 105 | Ga0466657_015947 | 3300042582 | Bacteria | 203876 |
| 106 | Ga0123357_10218441 | 3300009784 | Unclassified | 2121 |
| 107 | Ga0466710_091764 | 3300042613 | Bacteria | 10549 |
| 108 | Ga0466701_058583 | 3300042598 | Bacteria | 4488 |
| 109 | Ga0466706_100256 | 3300042599 | Bacteria | 1780 |
| 110 | Ga0466707_284362 | 3300042601 | Bacteria | 185230 |
| 111 | Ga0466717_027009 | 3300042604 | Bacteria | 7399 |
| 112 | Ga0466722_225912 | 3300042609 | Bacteria | 22256 |
| 113 | IMNBL1DRAFT_c0001259 | 3300000062 | Bacteria | 19134 |
| 114 | Ga0063521_1000071 | 3300003973 | Bacteria | 83397 |
| 115 | Ga0074188_1000354 | 3300005318 | Bacteria | 41596 |
| 116 | Ga0103266_1000625 | 3300007067 | Bacteria | 7629 |
| 117 | Ga0102737_1003939 | 3300007142 | Bacteria | 3275 |
| 118 | Ga0103264_1000057 | 3300007188 | Bacteria | 130228 |
| 119 | Ga0103267_1000005 | 3300007190 | Bacteria | 104420 |
| 120 | Ga0103268_1000001 | 3300007192 | Bacteria | 136024 |
| 121 | Ga0105005_1039793 | 3300007505 | Unclassified | 13887 |
| 122 | Ga0123357_10003544 | 3300009784 | Bacteria | 17950 |
| 123 | Ga0466730_096842 | 3300042625 | Bacteria | 56272 |
| 124 | Ga0466704_238791 | 3300042643 | Bacteria | 33459 |
| 125 | Ga0466724_52883 | 3300042649 | Bacteria | 459297 |
| 126 | Ga0466725_335195 | 3300042654 | Bacteria | 81355 |
| 127 | Ga0562379_0108 | 3300056790 | Bacteria | 267639 |
| 128 | Ga0562377_0082 | 3300056842 | Bacteria | 346138 |
| 129 | Ga0160467_100024 | 3300012829 | Bacteria | 296626 |
| 130 | Ga0160467_103651 | 3300012829 | Bacteria | 2487 |
| 131 | Ga0160430_106783 | 3300012852 | Bacteria | 2392 |
| 132 | Ga0466657_021707 | 3300042582 | Bacteria | 36648 |
| 133 | Ga0466692_114694 | 3300042591 | Bacteria | 7676 |
| 134 | Ga0123355_10000763 | 3300009826 | Unclassified | 43969 |
| 135 | Ga0123356_10017581 | 3300010049 | Bacteria | 6802 |
| 136 | Ga0160465_102929 | 3300012803 | Unclassified | 3431 |
| 137 | Ga0160464_100072 | 3300012805 | Bacteria | 122094 |
| 138 | Ga0160442_101058 | 3300012806 | Unclassified | 3649 |
| 139 | Ga0466701_055071 | 3300042598 | Bacteria | 228045 |
| 140 | Ga0466701_077044 | 3300042598 | Bacteria | 440701 |
| 141 | Ga0466697_013668 | 3300042611 | Bacteria | 1711 |
| 142 | IMNBGM34_c000839 | 3300000036 | Bacteria | 6902 |
| 143 | Meta3P_1000353 | 3300002464 | Unclassified | 13480 |
| 144 | CVPL010W_10027566 | 3300002931 | Bacteria | 2515 |
| 145 | Ga0102734_1001374 | 3300007129 | Bacteria | 6056 |
| 146 | Ga0103260_1001175 | 3300007139 | Unclassified | 4758 |
| 147 | Ga0102740_1000449 | 3300007140 | Bacteria | 11414 |
| 148 | Ga0127656_102045 | 3300009453 | Bacteria | 51688 |
| 149 | Ga0123357_10000010 | 3300009784 | Bacteria | 190233 |
| 150 | Ga0123357_10000104 | 3300009784 | Bacteria | 69786 |
| 151 | Ga0466734_081958 | 3300042623 | Bacteria | 21984 |
| 152 | Ga0466709_298465 | 3300042648 | Bacteria | 3706 |
| 153 | Ga0466724_62290 | 3300042649 | Bacteria | 5775 |
| 154 | Ga0466724_63720 | 3300042649 | Bacteria | 129732 |
| 155 | Ga0160431_106472 | 3300012828 | Unclassified | 1775 |
| 156 | Ga0160443_100030 | 3300012848 | Bacteria | 361144 |
| 157 | Ga0160436_1005982 | 3300012861 | Unclassified | 2844 |
| 158 | Ga0264413_137554 | 3300024493 | Bacteria | 8002 |
| 159 | Ga0466657_137725 | 3300042582 | Bacteria | 60772 |
| 160 | Ga0466701_001368 | 3300042598 | Bacteria | 8163 |
| 161 | Ga0123357_10095528 | 3300009784 | Unclassified | 3853 |
| 162 | Ga0123354_10265086 | 3300010882 | Bacteria | 1705 |
| 163 | Ga0160470_100079 | 3300012813 | Bacteria | 126806 |
| 164 | Ga0466707_246632 | 3300042601 | Bacteria | 3188 |
| 165 | DPOL_contig16473 | 2035918003 | Bacteria | 29051 |
| 166 | Ga0063521_1000781 | 3300003973 | Bacteria | 11504 |
| 167 | Ga0102739_1000730 | 3300007095 | Unclassified | 6058 |
| 168 | Ga0103264_1046212 | 3300007188 | Bacteria | 2957 |
| 169 | Ga0123357_10001564 | 3300009784 | Bacteria | 24420 |
| 170 | Ga0466734_139817 | 3300042623 | Bacteria | 3760 |
| 171 | Ga0466730_036567 | 3300042625 | Bacteria | 48575 |
| 172 | Ga0466724_17582 | 3300042649 | Bacteria | 122637 |
| 173 | Ga0466724_17781 | 3300042649 | Bacteria | 5544 |
| 174 | Ga0466724_19435 | 3300042649 | Unclassified | 2210 |
| 175 | Ga0160472_100002 | 3300012839 | Bacteria | 878838 |
| 176 | Ga0160472_101510 | 3300012839 | Unclassified | 6656 |
| 177 | Ga0160433_104620 | 3300012846 | Unclassified | 2194 |
| 178 | Ga0160457_1004238 | 3300012858 | Unclassified | 2331 |
| 179 | Ga0466693_083855 | 3300042592 | Bacteria | 2447 |
| 180 | Ga0466696_295563 | 3300042596 | Bacteria | 5500 |
| 181 | Ga0136160_1000095 | 3300010225 | Bacteria | 227703 |
| 182 | Ga0123354_10000077 | 3300010882 | Bacteria | 75058 |
| 183 | Ga0123354_10010778 | 3300010882 | Unclassified | 14104 |
| 184 | Ga0160442_100004 | 3300012806 | Bacteria | 629819 |
| 185 | Ga0466701_035794 | 3300042598 | Bacteria | 2429 |
| 186 | Ga0466701_056032 | 3300042598 | Unclassified | 55945 |
| 187 | Ga0466717_076383 | 3300042604 | Unclassified | 1670 |
| 188 | DPO_contig06816 | 2032320009 | Unclassified | 10977 |
| 189 | SPBB_contig10581 | 2044078006 | Bacteria | 82009 |
| 190 | FGTW_contig30891 | 2065487013 | Unclassified | 7935 |
| 191 | HBC_ctgsDRAFT_1002152 | 3300000333 | Bacteria | 4455 |
| 192 | JGI24702J35022_10005239 | 3300002462 | Unclassified | 7603 |
| 193 | Meta3P_1000352 | 3300002464 | Bacteria | 49629 |
| 194 | CVPL005L_10000195 | 3300002938 | Bacteria | 55018 |
| 195 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 196 | Ga0063521_1000023 | 3300003973 | Bacteria | 132266 |
| 197 | Ga0102738_1000182 | 3300007141 | Bacteria | 14527 |
| 198 | Ga0103264_1000215 | 3300007188 | Bacteria | 32999 |
| 199 | Ga0103264_1000261 | 3300007188 | Bacteria | 62554 |
| 200 | Ga0103267_1001118 | 3300007190 | Unclassified | 8913 |
| 201 | Ga0466730_012123 | 3300042625 | Bacteria | 56347 |
| 202 | Ga0466724_12489 | 3300042649 | Bacteria | 79172 |
| 203 | Ga0466724_46154 | 3300042649 | Bacteria | 5642 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 51 | 490 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.