Protein Family IF10711
Metagenome
Isolate
518
Members
458
Samples
154
Scaffolds
258.01
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2501651205|2501715100|
- Length
- 262 aa
- Sequence
- MLARRIIPCLDVKDGKVVKGIQFRNHEIIGDIVPLAQKYAKAGADELVFYDITASSDGRVVDKSWVSRIAEVIDIPFCVAGGIKSAADAKEILMMGADKISINSPALQDPELITRLADIFGQQCIVVGVDSFYNKEANAGKGEYQVYQFTGDEKRTKQTGWTTFDWIEKVVSLGAGEIVLNCMNQDGVRQGYDIVQLKQARAVCNVPLIASGGAGTMAHFSDVYQQADVDGALAASVFHKGVIAIKELKNYLKTQRIEVRPC
Sample Types
Isolate
70.3%
Metagenome
29.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
26.8%
Unclassified
22.6%
Aphididae
6.3%
Drosophilidae
5.1%
Anthocoridae
4.9%
Formicidae
4.0%
Culicidae
3.3%
Muscidae
3.0%
Termitidae
2.6%
Tenebrionidae
2.6%
Curculionidae
2.6%
Calliphoridae
2.1%
Armadillidiidae
1.9%
Elmidae
1.4%
Tephritidae
1.2%
Cerambycidae
0.9%
Palinuridae
0.7%
Talitridae
0.7%
Kalotermitidae
0.5%
Sarcophagidae
0.5%
Pentatomidae
0.5%
Passalidae
0.5%
Cicadellidae
0.5%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Nephropidae
0.2%
Chrysomelidae
0.2%
Lysianassidae
0.2%
Daphniidae
0.2%
Aphrophoridae
0.2%
Rhinotermitidae
0.2%
Hodotermitidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Artemiidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Triozidae
0.2%
Crambidae
0.2%
Pteromalidae
0.2%
Majidae
0.2%
Plutellidae
0.2%
Hormaphididae
0.2%
Taxonomy
Archaea
0
Bacteria
494
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 3 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 4 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 5 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 6 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 7 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 8 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 9 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 10 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 11 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 12 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 13 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 14 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 15 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 16 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 17 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 18 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 19 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 20 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 21 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 22 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 23 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 24 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 25 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 26 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 27 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 28 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 29 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 30 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 31 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 32 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 33 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 34 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 35 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 38 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 39 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 40 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 41 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 42 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 43 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 44 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 45 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 46 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 47 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 48 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 49 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 50 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 51 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 52 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 53 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 54 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 55 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 56 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 57 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 58 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 59 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 60 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 61 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 62 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 63 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 64 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 65 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 66 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 67 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 68 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 69 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 70 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 71 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 72 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 73 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 74 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 75 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 76 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 77 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 78 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 79 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 80 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 81 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 82 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 83 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 84 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 85 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 86 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 87 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 88 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 89 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 90 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 91 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 92 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 93 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 94 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 95 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 96 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 97 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 98 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 99 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 100 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 101 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 102 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 103 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 104 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 105 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 106 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 107 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 108 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 109 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 110 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 111 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 112 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 113 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 114 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 115 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 116 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 117 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 118 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 119 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 120 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 121 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 122 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 123 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 124 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 125 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 126 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 127 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 128 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 129 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 130 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 131 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 132 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 133 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 134 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 135 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 136 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 137 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 138 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 139 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 140 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 141 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 142 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 143 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 144 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 145 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 146 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 147 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 148 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 149 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 150 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 151 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 152 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 153 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 154 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 155 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 156 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 157 | 2958255616 | Serratia marcescens TM | Isolate | |
| 158 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 159 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 160 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 161 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 162 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 163 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 164 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 165 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 166 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 167 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 168 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 169 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 170 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 171 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 172 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 173 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 174 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 175 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 176 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 177 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 178 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 179 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 180 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 181 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 182 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 183 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 184 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 185 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 186 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 187 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 188 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 189 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 190 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 191 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 192 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 193 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 194 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 195 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 196 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 197 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 198 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 199 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 200 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 201 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 202 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 203 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 204 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 205 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 206 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 207 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 208 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 209 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 210 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 211 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 212 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 213 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 214 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 215 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 216 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 217 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 218 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 219 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 220 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 221 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 222 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 223 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 224 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 225 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 226 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 227 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 228 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 229 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 230 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 231 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 232 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 233 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 234 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 235 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 236 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 237 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 238 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 239 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 240 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 241 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 242 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 243 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 244 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 245 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 246 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 247 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 248 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 249 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 250 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 251 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 252 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 253 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 254 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 255 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 256 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 257 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 258 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 259 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 260 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 261 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 262 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 263 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 264 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 265 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 266 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 267 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 268 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 269 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 270 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 271 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 272 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 273 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 274 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 275 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 276 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 277 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 278 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 279 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 280 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 281 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 282 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 283 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 284 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 285 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 286 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 287 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 288 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 289 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 290 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 291 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 292 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 293 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 294 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 295 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 296 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 297 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 298 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 299 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 300 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 301 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 302 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 303 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 304 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 305 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 306 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 307 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 308 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 309 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 310 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 311 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 312 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 313 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 314 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 315 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 316 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 317 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 318 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 319 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 320 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 321 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 322 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 323 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 324 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 325 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 326 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 327 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 328 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 329 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 330 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 331 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 332 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 333 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 334 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 335 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 336 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 337 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 338 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 339 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 340 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 341 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 342 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 343 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 344 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 345 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 346 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 347 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 348 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 349 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 350 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 351 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 352 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 353 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 354 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 355 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 356 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 357 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 358 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 359 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 360 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 361 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 362 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 363 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 364 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 365 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 366 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 367 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 368 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 369 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 370 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 371 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 372 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 373 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 374 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 375 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 376 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 377 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 378 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 379 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 380 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 381 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 382 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 383 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 384 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 385 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 386 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 387 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 388 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 389 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 390 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 391 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 392 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 393 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 394 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 395 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 396 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 397 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 398 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 399 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 400 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 401 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 402 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 403 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 404 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 405 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 406 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 407 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 408 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 409 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 410 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 411 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 412 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 413 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 414 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 415 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 416 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 417 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 418 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 419 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 420 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 421 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 422 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 423 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 424 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 425 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 426 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 427 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 428 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 429 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 430 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 431 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 432 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 433 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 434 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 435 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 436 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 437 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 438 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 439 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 440 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 441 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 442 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 443 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 444 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 445 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 446 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 447 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 448 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 449 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 450 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 451 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 452 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 453 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 454 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 455 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 456 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 457 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 458 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160453_100028 | 3300012814 | Bacteria | 203379 |
| 2 | Ga0160472_100136 | 3300012839 | Bacteria | 112379 |
| 3 | Ga0160433_100145 | 3300012846 | Bacteria | 61189 |
| 4 | Ga0160448_100114 | 3300012854 | Bacteria | 39022 |
| 5 | Ga0265387_1000944 | 3300024582 | Bacteria | 4364 |
| 6 | Ga0247290_00009 | 3300035364 | Bacteria | 82427 |
| 7 | Ga0120204_000112 | 3300038942 | Bacteria | 3897 |
| 8 | FGTW_contig15317 | 2065487013 | Bacteria | 10234 |
| 9 | HBC_ctgsDRAFT_1031779 | 3300000333 | Bacteria | 1298 |
| 10 | Ga0074188_1039469 | 3300005318 | Bacteria | 24939 |
| 11 | Ga0074278_107917 | 3300005721 | Unclassified | 5497 |
| 12 | Ga0074278_128980 | 3300005721 | Unclassified | 78604 |
| 13 | Ga0102736_1000453 | 3300007052 | Bacteria | 8387 |
| 14 | Ga0103260_1000080 | 3300007139 | Bacteria | 26178 |
| 15 | Ga0103260_1002759 | 3300007139 | Bacteria | 2915 |
| 16 | Ga0102738_1000791 | 3300007141 | Bacteria | 5031 |
| 17 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 18 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 19 | Ga0466730_019645 | 3300042625 | Bacteria | 30027 |
| 20 | Ga0466730_050849 | 3300042625 | Bacteria | 52724 |
| 21 | Ga0466725_174234 | 3300042654 | Bacteria | 28041 |
| 22 | Ga0123354_10000002 | 3300010882 | Bacteria | 317342 |
| 23 | Ga0160441_100184 | 3300012825 | Bacteria | 67229 |
| 24 | Ga0160455_102062 | 3300012837 | Bacteria | 4675 |
| 25 | Ga0160460_100302 | 3300012845 | Bacteria | 36626 |
| 26 | gam1t_NODE_639127_length=8118_GC=37_9_Contigs=6 | 2189573031 | Unclassified | 8168 |
| 27 | Ga0063521_1000105 | 3300003973 | Bacteria | 65293 |
| 28 | Ga0103266_1008755 | 3300007067 | Bacteria | 1220 |
| 29 | Ga0102734_1000060 | 3300007129 | Bacteria | 35008 |
| 30 | Ga0466730_053240 | 3300042625 | Bacteria | 6323 |
| 31 | Ga0466724_16064 | 3300042649 | Bacteria | 12192 |
| 32 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 33 | Ga0562377_0620 | 3300056842 | Bacteria | 53738 |
| 34 | Ga0466701_039425 | 3300042598 | Unclassified | 2835 |
| 35 | Ga0466701_100213 | 3300042598 | Bacteria | 245657 |
| 36 | Ga0466706_065880 | 3300042599 | Bacteria | 2819 |
| 37 | Ga0123357_10263984 | 3300009784 | Unclassified | 1814 |
| 38 | Ga0160456_100645 | 3300012820 | Bacteria | 10177 |
| 39 | Ga0160430_100001 | 3300012852 | Bacteria | 595720 |
| 40 | Ga0160457_1000051 | 3300012858 | Bacteria | 188725 |
| 41 | Ga0316159_12367 | 3300030930 | Unclassified | 2044 |
| 42 | Ga0247290_00061 | 3300035364 | Bacteria | 37802 |
| 43 | Ga0247290_00674 | 3300035364 | Unclassified | 5399 |
| 44 | IMNBL1DRAFT_c0032338 | 3300000062 | Bacteria | 1888 |
| 45 | SCG598B02_11602 | 3300000472 | Bacteria | 63387 |
| 46 | Meta3P_1000055 | 3300002464 | Bacteria | 91103 |
| 47 | Ga0063521_1004621 | 3300003973 | Bacteria | 3253 |
| 48 | Ga0103263_100028 | 3300007042 | Bacteria | 33706 |
| 49 | Ga0103265_1000025 | 3300007068 | Bacteria | 22786 |
| 50 | Ga0102739_1000009 | 3300007095 | Bacteria | 70252 |
| 51 | Ga0102740_1000009 | 3300007140 | Bacteria | 106515 |
| 52 | Ga0102738_1003431 | 3300007141 | Bacteria | 2306 |
| 53 | Ga0105553_1113447 | 3300007767 | Unclassified | 4092 |
| 54 | Ga0127655_1000574 | 3300009459 | Bacteria | 112022 |
| 55 | Ga0127653_100020 | 3300009471 | Bacteria | 389096 |
| 56 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 57 | Ga0466734_163820 | 3300042623 | Bacteria | 1075 |
| 58 | Ga0466724_68702 | 3300042649 | Bacteria | 40617 |
| 59 | Ga0562379_0716 | 3300056790 | Unclassified | 55843 |
| 60 | Ga0562375_0125 | 3300056856 | Bacteria | 231900 |
| 61 | Ga0466713_149103 | 3300042602 | Bacteria | 2670 |
| 62 | Ga0160472_100019 | 3300012839 | Bacteria | 338828 |
| 63 | Ga0160434_101318 | 3300012850 | Bacteria | 4744 |
| 64 | Ga0160435_1000148 | 3300012857 | Bacteria | 39041 |
| 65 | Ga0466657_096422 | 3300042582 | Bacteria | 19060 |
| 66 | gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 | 2189573031 | Bacteria | 78604 |
| 67 | 2227080783 | 2225789004 | Bacteria | 156181 |
| 68 | SCG598I20_12281 | 3300000473 | Bacteria | 7098 |
| 69 | CVPL010W_10006743 | 3300002931 | Bacteria | 11617 |
| 70 | Ga0063521_1000230 | 3300003973 | Bacteria | 38724 |
| 71 | Ga0074278_110334 | 3300005721 | Bacteria | 8168 |
| 72 | Ga0104041_1000095 | 3300007106 | Bacteria | 6936 |
| 73 | Ga0104042_1034818 | 3300007130 | Bacteria | 5286 |
| 74 | Ga0102737_1000077 | 3300007142 | Bacteria | 29542 |
| 75 | Ga0466730_003892 | 3300042625 | Bacteria | 17313 |
| 76 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 77 | Ga0466707_156141 | 3300042601 | Bacteria | 86986 |
| 78 | Ga0160458_100003 | 3300012832 | Bacteria | 774753 |
| 79 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 80 | SPBB_contig01803 | 2044078006 | Unclassified | 1525 |
| 81 | gam1t_NODE_566721_length=9032_GC=38_7_Contigs=3 | 2189573031 | Unclassified | 9052 |
| 82 | gam1t_NODE_673954_length=5497_GC=37_5_Contigs=1 | 2189573031 | Bacteria | 5497 |
| 83 | SCG598I22_11011 | 3300000462 | Unclassified | 17987 |
| 84 | CVPL010L_1000019 | 3300002932 | Bacteria | 107242 |
| 85 | Ga0063521_1000079 | 3300003973 | Bacteria | 79802 |
| 86 | Ga0103261_1000052 | 3300007083 | Bacteria | 33831 |
| 87 | Ga0103267_1021870 | 3300007190 | Bacteria | 2107 |
| 88 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 89 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 90 | Ga0466705_183613 | 3300042612 | Bacteria | 88189 |
| 91 | Ga0466724_32728 | 3300042649 | Unclassified | 12194 |
| 92 | Ga0466724_67353 | 3300042649 | Bacteria | 40151 |
| 93 | Ga0562374_0373 | 3300057007 | Bacteria | 82846 |
| 94 | Ga0466701_050252 | 3300042598 | Bacteria | 107300 |
| 95 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 96 | Ga0160434_100075 | 3300012850 | Bacteria | 69288 |
| 97 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 98 | SCG598L16_135897 | 3300000490 | Unclassified | 24327 |
| 99 | CVPL010L_1000646 | 3300002932 | Bacteria | 9052 |
| 100 | Ga0074302_1138059 | 3300005316 | Bacteria | 1402 |
| 101 | Ga0102736_1000072 | 3300007052 | Bacteria | 25803 |
| 102 | Ga0103260_1000876 | 3300007139 | Bacteria | 5621 |
| 103 | Ga0102738_1000012 | 3300007141 | Bacteria | 104606 |
| 104 | Ga0102737_1005525 | 3300007142 | Bacteria | 2509 |
| 105 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 106 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 107 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 108 | Ga0466730_051086 | 3300042625 | Bacteria | 12230 |
| 109 | Ga0466724_22167 | 3300042649 | Bacteria | 3439 |
| 110 | Ga0530661_001025 | 3300056564 | Bacteria | 16273 |
| 111 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 112 | Ga0466717_234040 | 3300042604 | Bacteria | 5997 |
| 113 | Ga0136159_1000005 | 3300010217 | Bacteria | 637387 |
| 114 | Ga0160467_100096 | 3300012829 | Bacteria | 128198 |
| 115 | Ga0160459_109493 | 3300012831 | Bacteria | 1182 |
| 116 | Ga0160444_100244 | 3300012841 | Bacteria | 45218 |
| 117 | Ga0160433_104268 | 3300012846 | Bacteria | 2332 |
| 118 | Ga0160435_1000158 | 3300012857 | Bacteria | 36168 |
| 119 | Ga0265387_1000026 | 3300024582 | Bacteria | 60790 |
| 120 | Ga0466692_106521 | 3300042591 | Bacteria | 11823 |
| 121 | DPOL_contig07314 | 2035918003 | Bacteria | 15303 |
| 122 | gam1t_NODE_50498_length=29940_GC=34_1_Contigs=3 | 2189573031 | Unclassified | 29960 |
| 123 | SCG598L16_135224 | 3300000490 | Unclassified | 7308 |
| 124 | CVPL010L_1003932 | 3300002932 | Unclassified | 1887 |
| 125 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 126 | Ga0063521_1001219 | 3300003973 | Bacteria | 7548 |
| 127 | Ga0103261_1001222 | 3300007083 | Bacteria | 4101 |
| 128 | Ga0102737_1001115 | 3300007142 | Bacteria | 7868 |
| 129 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 130 | Ga0466710_123129 | 3300042613 | Bacteria | 13992 |
| 131 | Ga0466697_262098 | 3300042611 | Bacteria | 8369 |
| 132 | Ga0466734_009507 | 3300042623 | Bacteria | 6739 |
| 133 | Ga0466724_39237 | 3300042649 | Bacteria | 244464 |
| 134 | Ga0466724_44946 | 3300042649 | Unclassified | 3873 |
| 135 | Ga0466701_039467 | 3300042598 | Bacteria | 1885 |
| 136 | Ga0160469_100074 | 3300012824 | Bacteria | 164586 |
| 137 | Ga0160452_109335 | 3300012834 | Unclassified | 1232 |
| 138 | Ga0160472_104891 | 3300012839 | Bacteria | 2250 |
| 139 | Ga0160443_100144 | 3300012848 | Bacteria | 102936 |
| 140 | Ga0160436_1003917 | 3300012861 | Bacteria | 3600 |
| 141 | Ga0247290_00036 | 3300035364 | Bacteria | 50973 |
| 142 | DPOL_contig04183 | 2035918003 | Unclassified | 1397 |
| 143 | FGTW_contig17593 | 2065487013 | Unclassified | 1819 |
| 144 | FGTW_contig31030 | 2065487013 | Unclassified | 6714 |
| 145 | Meta3P_1000035 | 3300002464 | Bacteria | 60883 |
| 146 | Ga0063521_1001040 | 3300003973 | Bacteria | 8688 |
| 147 | Ga0074278_136412 | 3300005721 | Bacteria | 29960 |
| 148 | Ga0074278_143383 | 3300005721 | Unclassified | 9052 |
| 149 | Ga0104042_1119685 | 3300007130 | Bacteria | 2905 |
| 150 | Ga0105005_1025648 | 3300007505 | Unclassified | 4530 |
| 151 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 152 | Ga0127651_100210 | 3300009483 | Bacteria | 383772 |
| 153 | Ga0466715_342506 | 3300042616 | Bacteria | 110263 |
| 154 | Ga0466730_101737 | 3300042625 | Bacteria | 1454 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.