Protein Family IF09315

Metagenome Isolate
251 Members
121 Samples
189 Scaffolds
310.75 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_034420|Ga0466704_034420_7517_8569
Length
350 aa
Sequence
LPDNPLGLFQNANYDQGSAGTEVSGEKDCHRLGKSDQKAGFSQFDILKKPDISVTIAGVRFKNPVIAASGTFGCGREYAGLLDVGALGGLCTKGLTLKPKTGNSGMRLHETPSGLMNSIGLENPGIPAFIEKDLPYMQELQKQGVVVIANLSGSSVEECAEGARILDMCCVDMVELNISCPNVTSGGMAFGLDPEAASSVTRLVRKALHKPLMVKLSPNAPDIIAVASACIAAGADALSLVNTFKAIAIDIEKRAPVFDNVSAGLSGPAIRPIAIRMVWELAGAVAVPIIGLGGIACANDALEFLLAGAKAVQVGTATFTNPVVTLEIIDGIAAYMEKKKISCIEDLSIR

πŸ“Š Sample Types

Isolate 24.7%
Metagenome 75.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 31.6%
Termitidae 28.2%
Kalotermitidae 11.1%
Pyralidae 5.1%
Elmidae 4.3%
Scarabaeidae 2.6%
Passalidae 2.6%
Blattidae 1.7%
Rhinotermitidae 1.7%
Bombycidae 1.7%
Nephropidae 0.9%
Ocypodidae 0.9%
Tenebrionidae 0.9%
Hodotermitidae 0.9%
Noctuidae 0.9%
Eresidae 0.9%
Culicidae 0.9%
Curculionidae 0.9%
Penaeidae 0.9%
Portunidae 0.9%
Termopsidae 0.9%

🌳 Taxonomy

Archaea 11
Bacteria 226
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
2 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
3 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
4 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
5 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
6 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
7 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
8 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
9 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
10 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2978778678 Bacillus cereus 25 Isolate Ocypodidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 2864909992 Bacillus velezensis S00166 Isolate Elmidae
24 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
25 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
26 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
27 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
28 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
29 2756170388 Methanimicrococcus blatticola DSM 13328 Isolate Blattidae
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
37 8073544309 Actinomadura sp. RB99 Isolate Termitidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
41 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
42 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
43 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
44 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
45 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
46 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
47 2698536704 Methanimicrococcus blatticola PA Isolate Blattidae
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
50 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
54 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
55 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
56 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
57 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 2864895409 Bacillus aerius S00152 Isolate Elmidae
61 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
62 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
63 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
64 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
65 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
66 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
67 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
68 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
69 8022725327 Bacillus sp. SN10 Isolate Eresidae
70 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
71 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
72 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
73 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
74 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
75 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
76 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
77 2864801025 Bacillus aerius S00042 Isolate Elmidae
78 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
79 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
80 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
81 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
82 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
83 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
84 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
85 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
86 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
87 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
88 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
89 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
90 2773857682 Unclassified Methanosarcinaceae Lab288P3bin112 Isolate Unclassified
91 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
92 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
93 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
94 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
95 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
96 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
97 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
98 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
99 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
100 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
101 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
102 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
103 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
104 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
105 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
106 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
107 8082023105 Niallia sp. Man26 Isolate Penaeidae
108 2969145278 Bacillus cereus 29 Isolate Portunidae
109 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
110 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
111 2537562000 Bacillus cereus HD73 Isolate Pyralidae
112 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
113 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
114 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
115 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
116 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
117 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
118 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
119 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
120 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
121 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_163322 3300042612 Bacteria 155241
2 Ga0466731_355270 3300042622 Bacteria 2844
3 Ga0466704_170656 3300042643 Bacteria 27574
4 Ga0265387_1003272 3300024582 Bacteria 2248
5 Ga0466690_039157 3300042590 Bacteria 9927
6 Ga0466690_158326 3300042590 Bacteria 3519
7 Ga0466693_341307 3300042592 Bacteria 9647
8 Ga0466693_431033 3300042592 Bacteria 1414
9 Ga0466691_027233 3300042593 Bacteria 26490
10 Ga0466691_214398 3300042593 Unclassified 2546
11 Ga0466694_365290 3300042594 Bacteria 1055
12 Ga0466712_314281 3300042614 Bacteria 47963
13 Ga0466718_053877 3300042617 Bacteria 29065
14 Ga0466726_223073 3300042619 Bacteria 10114
15 Ga0123356_10001789 3300010049 Bacteria 23449
16 Ga0123356_10009210 3300010049 Bacteria 9762
17 Ga0123353_10001579 3300010167 Bacteria 27992
18 Ga0123353_10574090 3300010167 Bacteria 1620
19 Ga0123354_10052020 3300010882 Bacteria 6176
20 Ga0466700_374841 3300042600 Bacteria 1181
21 Ga0466719_234538 3300042606 Bacteria 6720
22 Ga0466720_061600 3300042607 Bacteria 7572
23 JGI24700J35501_10930260 3300002508 Unclassified 12528
24 Ga0466705_114689 3300042612 Bacteria 2177
25 Ga0466705_338638 3300042612 Bacteria 11922
26 Ga0466729_315513 3300042621 Bacteria 7068
27 Ga0466704_142482 3300042643 Bacteria 18454
28 Ga0264413_120478 3300024493 Bacteria 5487
29 Ga0466657_028240 3300042582 Bacteria 3411
30 Ga0466694_303729 3300042594 Bacteria 1329
31 Ga0466710_181444 3300042613 Bacteria 9331
32 Ga0466726_179765 3300042619 Bacteria 27564
33 Ga0123357_10114559 3300009784 Bacteria 3422
34 Ga0123355_10001032 3300009826 Bacteria 38573
35 Ga0123355_10108140 3300009826 Bacteria 4355
36 Ga0123356_10000135 3300010049 Bacteria 82454
37 Ga0466701_031433 3300042598 Bacteria 1443
38 Ga0466719_349150 3300042606 Bacteria 4027
39 Ga0466722_033417 3300042609 Bacteria 1614
40 AustNasuHG_c1017518 3300000089 Archaea 2381
41 JGI24695J34938_10001297 3300002450 Unclassified 21884
42 JGI24703J35330_11748873 3300002501 Bacteria 177009
43 JGI24700J35501_10930477 3300002508 Unclassified 14577
44 Ga0466705_072725 3300042612 Bacteria 8077
45 Ga0466702_150026 3300042635 Bacteria 2475
46 Ga0264413_103735 3300024493 Bacteria 21704
47 Ga0466694_309147 3300042594 Bacteria 26210
48 Ga0466718_033010 3300042617 Bacteria 6831
49 Ga0466723_021746 3300042618 Bacteria 41971
50 Ga0466726_135731 3300042619 Bacteria 1503
51 Ga0123357_10006096 3300009784 Bacteria 14601
52 Ga0123355_10005324 3300009826 Unclassified 18808
53 Ga0123355_10099972 3300009826 Bacteria 4569
54 Ga0123356_10001251 3300010049 Bacteria 28117
55 Ga0123356_10001256 3300010049 Bacteria 28066
56 Ga0123356_10007979 3300010049 Bacteria 10536
57 Ga0123356_10014169 3300010049 Bacteria 7669
58 Ga0123356_10046652 3300010049 Bacteria 4031
59 Ga0123353_10028496 3300010167 Bacteria 8583
60 Ga0466706_032211 3300042599 Bacteria 1851
61 Ga0466706_069357 3300042599 Bacteria 1839
62 Ga0466706_165561 3300042599 Bacteria 6767
63 Ga0466719_032536 3300042606 Bacteria 1739
64 Ga0466719_291384 3300042606 Bacteria 1461
65 AustNasuHG_c1010498 3300000089 Bacteria 3225
66 JGI24695J34938_10003963 3300002450 Bacteria 9979
67 JGI24695J34938_10004985 3300002450 Bacteria 8468
68 JGI24695J34938_10008212 3300002450 Bacteria 5982
69 JGI24703J35330_11741366 3300002501 Bacteria 3539
70 Ga0068305_10916223 3300005083 Bacteria 1250
71 Ga0466705_141412 3300042612 Bacteria 1668
72 Ga0466703_060305 3300042636 Bacteria 16685
73 Ga0466704_549791 3300042643 Bacteria 30983
74 Ga0466708_017543 3300042652 Bacteria 5658
75 Ga0264413_126017 3300024493 Bacteria 3271
76 Ga0466657_030507 3300042582 Archaea 9664
77 Ga0466696_150719 3300042596 Unclassified 2919
78 Ga0466710_220489 3300042613 Bacteria 3614
79 Ga0466715_517576 3300042616 Bacteria 14317
80 Ga0466723_122529 3300042618 Bacteria 3240
81 Ga0123355_10001359 3300009826 Bacteria 34025
82 Ga0123356_10059151 3300010049 Bacteria 3574
83 Ga0123353_10000027 3300010167 Bacteria 167513
84 Ga0123353_10038853 3300010167 Bacteria 7485
85 Ga0123353_10161405 3300010167 Bacteria 3568
86 Ga0123353_11014058 3300010167 Bacteria 1113
87 Ga0466714_059919 3300042603 Bacteria 5489
88 Ga0466721_171226 3300042608 Bacteria 1202
89 Ga0466722_088365 3300042609 Bacteria 1914
90 Ga0466698_003595 3300042610 Bacteria 1540
91 2227080824 2225789004 Archaea 10115
92 JGI24698J34947_10030627 3300002449 Bacteria 2837
93 JGI24695J34938_10000348 3300002450 Bacteria 45575
94 JGI24695J34938_10000863 3300002450 Bacteria 28076
95 JGI24705J35276_12238186 3300002504 Bacteria 17039
96 Ga0063521_1000084 3300003973 Bacteria 78254
97 Ga0074263_104121 3300005485 Bacteria 2065
98 Ga0466733_151776 3300042659 Archaea 103599
99 Ga0466703_019085 3300042636 Bacteria 3691
100 Ga0466704_034420 3300042643 Bacteria 35079
101 Ga0466709_169986 3300042648 Bacteria 2280
102 Ga0415639_066280 3300038395 Bacteria 6955
103 Ga0466693_014638 3300042592 Bacteria 1753
104 Ga0123355_10000944 3300009826 Bacteria 40240
105 Ga0123356_10015636 3300010049 Bacteria 7269
106 Ga0466701_031789 3300042598 Bacteria 2902
107 AustNasuHG_c1007882 3300000089 Bacteria 3777
108 JGI24695J34938_10015102 3300002450 Bacteria 3974
109 JGI24703J35330_11739360 3300002501 Unclassified 3288
110 Ga0466703_272487 3300042636 Bacteria 15484
111 Ga0466704_079423 3300042643 Bacteria 74491
112 Ga0466704_602232 3300042643 Bacteria 47506
113 Ga0466709_391029 3300042648 Bacteria 17378
114 Ga0264413_101235 3300024493 Bacteria 17687
115 Ga0264413_123431 3300024493 Unclassified 4884
116 Ga0415639_003553 3300038395 Bacteria 12999
117 Ga0466691_219991 3300042593 Bacteria 33482
118 Ga0466696_116330 3300042596 Bacteria 7460
119 Ga0466718_003641 3300042617 Bacteria 67531
120 Ga0466718_084891 3300042617 Bacteria 9639
121 Ga0466723_150957 3300042618 Unclassified 3039
122 Ga0466728_109200 3300042620 Bacteria 5310
123 Ga0123356_10000198 3300010049 Bacteria 69577
124 Ga0123356_10000577 3300010049 Bacteria 40782
125 Ga0123353_10000238 3300010167 Archaea 69529
126 Ga0123353_10097848 3300010167 Bacteria 4729
127 Ga0123353_10353938 3300010167 Bacteria 2211
128 Ga0123353_10810031 3300010167 Bacteria 1291
129 Ga0466706_284736 3300042599 Bacteria 3663
130 Ga0466719_126681 3300042606 Bacteria 2243
131 Ga0466698_141609 3300042610 Bacteria 36101
132 Ga0466698_474178 3300042610 Bacteria 5874
133 2227044267 2225789003 Unclassified 4079
134 2227477983 2225789004 Unclassified 4553
135 JGI24695J34938_10005868 3300002450 Unclassified 7546
136 JGI24702J35022_10001066 3300002462 Bacteria 17110
137 Ga0530661_000038 3300056564 Bacteria 151110
138 Ga0264413_126137 3300024493 Bacteria 2811
139 Ga0466690_189355 3300042590 Bacteria 4556
140 Ga0466694_045763 3300042594 Bacteria 12159
141 Ga0466696_032692 3300042596 Bacteria 10317
142 Ga0466718_118840 3300042617 Bacteria 21868
143 Ga0123355_10001308 3300009826 Bacteria 34772
144 Ga0123355_10031833 3300009826 Unclassified 8559
145 Ga0123356_10029115 3300010049 Bacteria 5173
146 Ga0123356_10045253 3300010049 Bacteria 4095
147 Ga0123356_10178678 3300010049 Bacteria 2142
148 Ga0123356_10184120 3300010049 Bacteria 2113
149 Ga0123356_10399576 3300010049 Bacteria 1511
150 Ga0123353_10195958 3300010167 Bacteria 3184
151 FAAS_10002399 3300001880 Bacteria 1890
152 JGI24698J34947_10004978 3300002449 Bacteria 7280
153 JGI24695J34938_10000294 3300002450 Bacteria 49200
154 JGI24703J35330_11746579 3300002501 Unclassified 5402
155 Ga0074263_116653 3300005485 Bacteria 1493
156 Ga0530661_000001 3300056564 Bacteria 684835
157 Ga0466704_597064 3300042643 Bacteria 48603
158 Ga0466725_301720 3300042654 Bacteria 1676
159 Ga0264413_107347 3300024493 Bacteria 11425
160 Ga0415639_020548 3300038395 Bacteria 9715
161 Ga0415639_088138 3300038395 Bacteria 2307
162 Ga0415639_192860 3300038395 Bacteria 2475
163 Ga0466691_185067 3300042593 Bacteria 34627
164 Ga0466694_374185 3300042594 Bacteria 30567
165 Ga0466696_032648 3300042596 Bacteria 3988
166 Ga0466711_053941 3300042615 Bacteria 1337
167 Ga0466711_466070 3300042615 Bacteria 3426
168 Ga0466715_102710 3300042616 Bacteria 18213
169 Ga0466718_057713 3300042617 Bacteria 10901
170 Ga0123357_10021359 3300009784 Bacteria 8666
171 Ga0123357_10307410 3300009784 Bacteria 1589
172 Ga0123357_10382021 3300009784 Bacteria 1306
173 Ga0123355_10007419 3300009826 Bacteria 16429
174 Ga0123355_10143477 3300009826 Bacteria 3647
175 Ga0123355_10205554 3300009826 Bacteria 2866
176 Ga0123355_10527839 3300009826 Bacteria 1440
177 Ga0123356_10002501 3300010049 Bacteria 19623
178 Ga0123356_10021173 3300010049 Bacteria 6142
179 Ga0123356_10052566 3300010049 Bacteria 3790
180 Ga0123353_10148577 3300010167 Bacteria 3744
181 Ga0466707_133327 3300042601 Bacteria 17075
182 Ga0466717_072840 3300042604 Bacteria 1390
183 Ga0466721_252701 3300042608 Archaea 2344
184 Ga0466722_259308 3300042609 Bacteria 6387
185 2212577976 2209111004 Bacteria 9507
186 2227128029 2225789004 Archaea 9021
187 IMNBL1DRAFT_c0000721 3300000062 Archaea 26227
188 JGI24695J34938_10000399 3300002450 Bacteria 42471
189 JGI24695J34938_10018950 3300002450 Bacteria 3425

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01180 DHO_dh Dihydroorotate dehydrogenase 53 336 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.