Protein Family IF09023
Metagenome
Metatranscriptome
Isolate
744
Members
181
Samples
665
Scaffolds
230.91
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_097984|Ga0466730_097984_14053_14745
- Length
- 205 aa
- Sequence
- MAKLTKKQKEALSKVEKGRIYNLEEGSALVKEVNTTKFDASVDIAVRLGVDPRKANQMVRGVVSLPHGTGKDVKVLALVTPDKEAEAKAAGADYVGLDEYLQKIKEGWTDVDVIVTMPAVMGKLGPLGRVVKAGKIDFKVDKYGIIHAGIGKVSFDAAKIKENAQELISTLIKMKPTAAKGTYVKSIYLSSTMSPGIAIDTKSVN
Sample Types
Isolate
10.6%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.5%
Blattidae
22.1%
Unclassified
11.0%
Kalotermitidae
8.6%
Formicidae
6.1%
Rhinotermitidae
4.3%
Elmidae
4.3%
Drosophilidae
3.1%
Armadillidiidae
2.5%
Termopsidae
2.5%
Culicidae
1.8%
Passalidae
1.8%
Hydrophilidae
1.8%
Tenebrionidae
1.2%
Daphniidae
1.2%
Cambaridae
1.2%
Aphididae
0.6%
Bombycidae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
0
Bacteria
674
Eukaryota
0
Viruses
0
Unclassified
70
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 3 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 4 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 5 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 6 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 7 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 8 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 9 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 13 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 14 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 15 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 16 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 21 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 22 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 23 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 24 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 25 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 26 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 27 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 28 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 29 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 30 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 34 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 35 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 36 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 37 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 45 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 46 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 47 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 48 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 49 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 50 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 51 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 52 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 53 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 54 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 55 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 58 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 59 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 60 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 61 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 62 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 63 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 64 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 65 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 68 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 69 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 70 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 71 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 72 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 73 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 74 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 75 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 76 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 77 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 78 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 79 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 82 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 83 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 84 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 85 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 86 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 87 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 88 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 89 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 90 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 91 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 92 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 93 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 94 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 95 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 96 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 97 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 98 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 99 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 100 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 101 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 102 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 103 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 104 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 105 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 106 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 107 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 108 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 109 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 110 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 111 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 112 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 113 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 114 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 115 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 116 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 117 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 118 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 119 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 120 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 121 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 122 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 123 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 124 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 125 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 126 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 127 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 128 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 129 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 130 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 131 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 132 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 133 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 134 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 135 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 136 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 137 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 138 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 139 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 140 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 141 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 142 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 143 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 144 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 145 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 146 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 147 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 148 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 149 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 150 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 151 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 152 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 153 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 154 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 155 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 156 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 157 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 158 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 159 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 160 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 161 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 162 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 163 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 164 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 165 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 166 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 167 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 168 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 169 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 170 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 171 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 172 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 173 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 174 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 175 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 176 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 177 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 178 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 179 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 180 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 181 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10006099 | 3300010049 | Bacteria | 12228 |
| 2 | Ga0123356_10315530 | 3300010049 | Bacteria | 1674 |
| 3 | Ga0123356_11634119 | 3300010049 | Bacteria | 798 |
| 4 | Ga0123353_10218071 | 3300010167 | Bacteria | 2986 |
| 5 | Ga0123353_10252269 | 3300010167 | Bacteria | 2732 |
| 6 | Ga0123353_10368274 | 3300010167 | Bacteria | 2156 |
| 7 | Ga0466733_044280 | 3300042659 | Bacteria | 1395 |
| 8 | Ga0466733_139514 | 3300042659 | Bacteria | 6015 |
| 9 | Ga0466733_146149 | 3300042659 | Bacteria | 8985 |
| 10 | Ga0160459_100032 | 3300012831 | Bacteria | 260734 |
| 11 | Ga0255786_1001174 | 3300022815 | Unclassified | 6016 |
| 12 | Ga0265387_1002228 | 3300024582 | Bacteria | 2749 |
| 13 | Ga0466656_215450 | 3300042550 | Unclassified | 1361 |
| 14 | Ga0466656_255970 | 3300042550 | Bacteria | 1347 |
| 15 | Ga0466657_096080 | 3300042582 | Unclassified | 1930 |
| 16 | Ga0466690_323038 | 3300042590 | Bacteria | 27612 |
| 17 | Ga0466690_336432 | 3300042590 | Bacteria | 20810 |
| 18 | Ga0466691_157960 | 3300042593 | Bacteria | 19718 |
| 19 | Ga0466694_231321 | 3300042594 | Unclassified | 3882 |
| 20 | Ga0466696_062082 | 3300042596 | Bacteria | 2698 |
| 21 | Ga0466696_325258 | 3300042596 | Bacteria | 15299 |
| 22 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 23 | Ga0466699_139322 | 3300042597 | Bacteria | 3998 |
| 24 | Ga0466699_187978 | 3300042597 | Unclassified | 1908 |
| 25 | IMNBGM34_c002654 | 3300000036 | Bacteria | 2577 |
| 26 | IMNBL1DRAFT_c0001799 | 3300000062 | Bacteria | 15645 |
| 27 | IMNBL1DRAFT_c0003160 | 3300000062 | Bacteria | 10827 |
| 28 | IMNBL1DRAFT_c0006011 | 3300000062 | Bacteria | 6766 |
| 29 | JGI24702J35022_10012499 | 3300002462 | Bacteria | 4716 |
| 30 | JGI24702J35022_10094316 | 3300002462 | Bacteria | 1632 |
| 31 | JGI24702J35022_10116117 | 3300002462 | Bacteria | 1475 |
| 32 | JGI24705J35276_12190470 | 3300002504 | Bacteria | 1463 |
| 33 | JGI24699J35502_11133895 | 3300002509 | Bacteria | 18486 |
| 34 | CVPL010W_10000849 | 3300002931 | Unclassified | 34339 |
| 35 | Ga0104045_1005590 | 3300007085 | Bacteria | 5275 |
| 36 | Ga0104048_1004634 | 3300007143 | Unclassified | 8621 |
| 37 | Ga0103267_1000076 | 3300007190 | Bacteria | 37435 |
| 38 | Ga0103267_1000189 | 3300007190 | Bacteria | 24214 |
| 39 | Ga0466697_165782 | 3300042611 | Bacteria | 2777 |
| 40 | Ga0466697_263106 | 3300042611 | Bacteria | 1567 |
| 41 | Ga0466705_238951 | 3300042612 | Bacteria | 22893 |
| 42 | Ga0466710_032469 | 3300042613 | Unclassified | 1213 |
| 43 | Ga0466711_182646 | 3300042615 | Bacteria | 12320 |
| 44 | Ga0466711_198310 | 3300042615 | Bacteria | 16707 |
| 45 | Ga0466715_185354 | 3300042616 | Bacteria | 6442 |
| 46 | Ga0466715_247827 | 3300042616 | Bacteria | 2061 |
| 47 | Ga0466715_271893 | 3300042616 | Bacteria | 43585 |
| 48 | Ga0466715_505413 | 3300042616 | Bacteria | 29515 |
| 49 | Ga0466715_609252 | 3300042616 | Bacteria | 3287 |
| 50 | Ga0466723_042823 | 3300042618 | Bacteria | 15809 |
| 51 | Ga0466723_307718 | 3300042618 | Bacteria | 90883 |
| 52 | Ga0466726_074187 | 3300042619 | Bacteria | 14508 |
| 53 | Ga0466726_085300 | 3300042619 | Bacteria | 28964 |
| 54 | Ga0466726_387681 | 3300042619 | Bacteria | 2019 |
| 55 | Ga0466728_110447 | 3300042620 | Bacteria | 1976 |
| 56 | Ga0466706_019580 | 3300042599 | Bacteria | 3095 |
| 57 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 58 | Ga0466700_109301 | 3300042600 | Bacteria | 1480 |
| 59 | Ga0466707_385579 | 3300042601 | Bacteria | 27845 |
| 60 | Ga0466713_041439 | 3300042602 | Bacteria | 39210 |
| 61 | Ga0466713_135469 | 3300042602 | Bacteria | 58117 |
| 62 | Ga0466714_129177 | 3300042603 | Bacteria | 2969 |
| 63 | Ga0466717_028261 | 3300042604 | Bacteria | 1078 |
| 64 | Ga0466717_210773 | 3300042604 | Bacteria | 1649 |
| 65 | Ga0466716_118364 | 3300042605 | Bacteria | 14527 |
| 66 | Ga0466716_214956 | 3300042605 | Bacteria | 15007 |
| 67 | Ga0466719_170534 | 3300042606 | Bacteria | 2067 |
| 68 | Ga0466719_210124 | 3300042606 | Bacteria | 10174 |
| 69 | Ga0466719_347488 | 3300042606 | Bacteria | 6993 |
| 70 | Ga0466721_141140 | 3300042608 | Bacteria | 1793 |
| 71 | Ga0466722_215146 | 3300042609 | Bacteria | 10662 |
| 72 | Ga0466729_273410 | 3300042621 | Bacteria | 19212 |
| 73 | Ga0466734_052784 | 3300042623 | Bacteria | 1677 |
| 74 | Ga0466734_168443 | 3300042623 | Unclassified | 1179 |
| 75 | Ga0466735_011567 | 3300042624 | Bacteria | 9019 |
| 76 | Ga0466735_019509 | 3300042624 | Bacteria | 1396 |
| 77 | Ga0466730_037458 | 3300042625 | Bacteria | 3936 |
| 78 | Ga0466730_038469 | 3300042625 | Unclassified | 1916 |
| 79 | Ga0466730_053884 | 3300042625 | Bacteria | 416658 |
| 80 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 81 | Ga0466703_154624 | 3300042636 | Bacteria | 2583 |
| 82 | Ga0466703_196736 | 3300042636 | Bacteria | 4722 |
| 83 | Ga0466703_268703 | 3300042636 | Bacteria | 10389 |
| 84 | Ga0466703_344027 | 3300042636 | Bacteria | 12646 |
| 85 | Ga0466703_394273 | 3300042636 | Bacteria | 22669 |
| 86 | Ga0466704_604929 | 3300042643 | Unclassified | 4655 |
| 87 | Ga0466709_109592 | 3300042648 | Unclassified | 15901 |
| 88 | Ga0466724_04760 | 3300042649 | Bacteria | 2812 |
| 89 | Ga0466708_106756 | 3300042652 | Unclassified | 4090 |
| 90 | Ga0466725_080611 | 3300042654 | Bacteria | 3004 |
| 91 | Ga0466727_044212 | 3300042655 | Bacteria | 34323 |
| 92 | Ga0466727_242249 | 3300042655 | Bacteria | 19089 |
| 93 | Ga0466727_249957 | 3300042655 | Bacteria | 36639 |
| 94 | Ga0123357_10025761 | 3300009784 | Bacteria | 7938 |
| 95 | Ga0123357_10319960 | 3300009784 | Bacteria | 1534 |
| 96 | Ga0123355_10512891 | 3300009826 | Bacteria | 1472 |
| 97 | Ga0123356_11065745 | 3300010049 | Bacteria | 977 |
| 98 | Ga0123353_10000550 | 3300010167 | Bacteria | 46223 |
| 99 | Ga0123353_10415100 | 3300010167 | Bacteria | 1997 |
| 100 | Ga0123353_11468095 | 3300010167 | Bacteria | 871 |
| 101 | Ga0160464_100302 | 3300012805 | Bacteria | 43315 |
| 102 | Ga0466733_032449 | 3300042659 | Bacteria | 75954 |
| 103 | Ga0160468_100100 | 3300012819 | Bacteria | 98045 |
| 104 | Ga0255809_1021950 | 3300022820 | Bacteria | 3499 |
| 105 | Ga0264413_154551 | 3300024493 | Unclassified | 1477 |
| 106 | Ga0466657_230724 | 3300042582 | Bacteria | 3880 |
| 107 | Ga0466690_050653 | 3300042590 | Bacteria | 29405 |
| 108 | Ga0466690_149721 | 3300042590 | Bacteria | 14494 |
| 109 | Ga0466693_004276 | 3300042592 | Bacteria | 5180 |
| 110 | Ga0466695_316896 | 3300042595 | Bacteria | 5066 |
| 111 | Ga0466695_324220 | 3300042595 | Bacteria | 2835 |
| 112 | Ga0466696_018441 | 3300042596 | Bacteria | 8962 |
| 113 | Ga0466696_046873 | 3300042596 | Unclassified | 2953 |
| 114 | Ga0466696_053520 | 3300042596 | Bacteria | 3485 |
| 115 | Ga0466696_160212 | 3300042596 | Bacteria | 32381 |
| 116 | Ga0466696_437708 | 3300042596 | Bacteria | 5021 |
| 117 | IMNBGM34_c000018 | 3300000036 | Bacteria | 45044 |
| 118 | IMNBL1DRAFT_c0011347 | 3300000062 | Bacteria | 4170 |
| 119 | JGI24699J35502_11132622 | 3300002509 | Bacteria | 7228 |
| 120 | Ga0068305_10986398 | 3300005083 | Bacteria | 1413 |
| 121 | Ga0072941_1283004 | 3300005201 | Bacteria | 1779 |
| 122 | Ga0104045_1004632 | 3300007085 | Bacteria | 12811 |
| 123 | Ga0104050_1210243 | 3300007153 | Bacteria | 983 |
| 124 | Ga0466697_268972 | 3300042611 | Bacteria | 1284 |
| 125 | Ga0466705_133082 | 3300042612 | Bacteria | 14815 |
| 126 | Ga0466705_441618 | 3300042612 | Bacteria | 2492 |
| 127 | Ga0466710_270682 | 3300042613 | Bacteria | 1919 |
| 128 | Ga0466710_347805 | 3300042613 | Bacteria | 1526 |
| 129 | Ga0466711_072009 | 3300042615 | Bacteria | 29547 |
| 130 | Ga0466711_160067 | 3300042615 | Unclassified | 15532 |
| 131 | Ga0466711_323186 | 3300042615 | Bacteria | 17765 |
| 132 | Ga0466715_123796 | 3300042616 | Bacteria | 41840 |
| 133 | Ga0466715_165538 | 3300042616 | Bacteria | 16153 |
| 134 | Ga0466723_215078 | 3300042618 | Bacteria | 15293 |
| 135 | Ga0466726_071920 | 3300042619 | Bacteria | 12800 |
| 136 | Ga0466728_093817 | 3300042620 | Bacteria | 21218 |
| 137 | Ga0466729_139818 | 3300042621 | Bacteria | 7606 |
| 138 | Ga0466701_038229 | 3300042598 | Bacteria | 61272 |
| 139 | Ga0466706_077836 | 3300042599 | Bacteria | 10751 |
| 140 | Ga0466706_155952 | 3300042599 | Bacteria | 22107 |
| 141 | Ga0466700_066795 | 3300042600 | Bacteria | 8239 |
| 142 | Ga0466700_247399 | 3300042600 | Bacteria | 1271 |
| 143 | Ga0466707_166239 | 3300042601 | Bacteria | 5626 |
| 144 | Ga0466707_354361 | 3300042601 | Bacteria | 4805 |
| 145 | Ga0466713_041013 | 3300042602 | Bacteria | 31505 |
| 146 | Ga0466713_148811 | 3300042602 | Bacteria | 2811 |
| 147 | Ga0466714_137357 | 3300042603 | Bacteria | 4435 |
| 148 | Ga0466716_201587 | 3300042605 | Bacteria | 2415 |
| 149 | Ga0466716_238887 | 3300042605 | Bacteria | 28802 |
| 150 | Ga0466722_015704 | 3300042609 | Bacteria | 71312 |
| 151 | Ga0466698_278541 | 3300042610 | Bacteria | 4838 |
| 152 | Ga0466698_453572 | 3300042610 | Bacteria | 2955 |
| 153 | Ga0466734_061766 | 3300042623 | Bacteria | 1300 |
| 154 | Ga0466735_093362 | 3300042624 | Bacteria | 1177 |
| 155 | Ga0466735_138703 | 3300042624 | Bacteria | 3325 |
| 156 | Ga0466702_177790 | 3300042635 | Unclassified | 1509 |
| 157 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 158 | Ga0466703_320865 | 3300042636 | Bacteria | 24807 |
| 159 | Ga0466703_378604 | 3300042636 | Bacteria | 14079 |
| 160 | Ga0466704_300674 | 3300042643 | Bacteria | 22977 |
| 161 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 162 | Ga0466709_365596 | 3300042648 | Bacteria | 29138 |
| 163 | Ga0466724_30555 | 3300042649 | Bacteria | 6318 |
| 164 | Ga0466708_228295 | 3300042652 | Bacteria | 20202 |
| 165 | Ga0466725_035410 | 3300042654 | Bacteria | 15741 |
| 166 | Ga0466727_194661 | 3300042655 | Bacteria | 11133 |
| 167 | Ga0466727_310288 | 3300042655 | Bacteria | 1460 |
| 168 | Ga0466727_340326 | 3300042655 | Bacteria | 11504 |
| 169 | Ga0123357_10016001 | 3300009784 | Bacteria | 9852 |
| 170 | Ga0123355_10000772 | 3300009826 | Bacteria | 43687 |
| 171 | Ga0123356_11258934 | 3300010049 | Unclassified | 904 |
| 172 | Ga0123353_10320117 | 3300010167 | Bacteria | 2354 |
| 173 | Ga0123353_11111150 | 3300010167 | Bacteria | 1048 |
| 174 | Ga0123354_10000799 | 3300010882 | Bacteria | 34399 |
| 175 | Ga0123354_10116419 | 3300010882 | Bacteria | 3486 |
| 176 | Ga0123354_10219815 | 3300010882 | Bacteria | 2023 |
| 177 | Ga0123354_10416757 | 3300010882 | Unclassified | 1120 |
| 178 | Ga0466733_038854 | 3300042659 | Bacteria | 18337 |
| 179 | Ga0160469_100054 | 3300012824 | Bacteria | 198457 |
| 180 | Ga0160460_100029 | 3300012845 | Bacteria | 324685 |
| 181 | Ga0466656_093233 | 3300042550 | Bacteria | 1531 |
| 182 | Ga0466656_326079 | 3300042550 | Bacteria | 2765 |
| 183 | Ga0466657_242066 | 3300042582 | Bacteria | 3290 |
| 184 | Ga0466690_079526 | 3300042590 | Bacteria | 19077 |
| 185 | Ga0466690_092689 | 3300042590 | Bacteria | 81043 |
| 186 | Ga0466690_102171 | 3300042590 | Bacteria | 8384 |
| 187 | Ga0466690_137591 | 3300042590 | Unclassified | 2706 |
| 188 | Ga0466692_064075 | 3300042591 | Bacteria | 26726 |
| 189 | Ga0466693_001327 | 3300042592 | Unclassified | 1715 |
| 190 | Ga0466691_155305 | 3300042593 | Bacteria | 5444 |
| 191 | Ga0466696_211147 | 3300042596 | Bacteria | 2216 |
| 192 | Ga0466696_361353 | 3300042596 | Bacteria | 10716 |
| 193 | 2227486592 | 2225789004 | Bacteria | 4230 |
| 194 | IMNBL1DRAFT_c0044120 | 3300000062 | Bacteria | 1468 |
| 195 | JGI24695J34938_10169613 | 3300002450 | Bacteria | 900 |
| 196 | JGI24702J35022_10004002 | 3300002462 | Bacteria | 8839 |
| 197 | JGI24702J35022_10009093 | 3300002462 | Bacteria | 5595 |
| 198 | JGI24702J35022_10141749 | 3300002462 | Bacteria | 1341 |
| 199 | Ga0068305_10177526 | 3300005083 | Unclassified | 3790 |
| 200 | Ga0072941_1193281 | 3300005201 | Bacteria | 2756 |
| 201 | Ga0072941_1402472 | 3300005201 | Bacteria | 827 |
| 202 | Ga0102735_1000025 | 3300007080 | Bacteria | 93479 |
| 203 | Ga0102739_1000590 | 3300007095 | Bacteria | 7198 |
| 204 | Ga0102734_1004060 | 3300007129 | Bacteria | 3293 |
| 205 | Ga0105005_1013882 | 3300007505 | Bacteria | 2937 |
| 206 | Ga0127649_100534 | 3300009460 | Bacteria | 84789 |
| 207 | Ga0123357_10000935 | 3300009784 | Bacteria | 29731 |
| 208 | Ga0466697_128616 | 3300042611 | Bacteria | 1335 |
| 209 | Ga0466705_313440 | 3300042612 | Bacteria | 3210 |
| 210 | Ga0466710_054984 | 3300042613 | Bacteria | 6591 |
| 211 | Ga0466710_251374 | 3300042613 | Bacteria | 2988 |
| 212 | Ga0466710_316785 | 3300042613 | Bacteria | 2298 |
| 213 | Ga0466710_422935 | 3300042613 | Bacteria | 2583 |
| 214 | Ga0466712_051956 | 3300042614 | Bacteria | 1013 |
| 215 | Ga0466715_257341 | 3300042616 | Bacteria | 23626 |
| 216 | Ga0466723_087930 | 3300042618 | Unclassified | 12826 |
| 217 | Ga0466723_118143 | 3300042618 | Bacteria | 49080 |
| 218 | Ga0466723_168647 | 3300042618 | Bacteria | 10942 |
| 219 | Ga0466723_194396 | 3300042618 | Unclassified | 3081 |
| 220 | Ga0466726_343709 | 3300042619 | Bacteria | 12383 |
| 221 | Ga0466729_151595 | 3300042621 | Bacteria | 3308 |
| 222 | Ga0466706_216759 | 3300042599 | Bacteria | 37972 |
| 223 | Ga0466707_167629 | 3300042601 | Bacteria | 52999 |
| 224 | Ga0466713_005670 | 3300042602 | Bacteria | 17868 |
| 225 | Ga0466713_069048 | 3300042602 | Bacteria | 26937 |
| 226 | Ga0466713_073650 | 3300042602 | Bacteria | 22168 |
| 227 | Ga0466714_121115 | 3300042603 | Bacteria | 1305 |
| 228 | Ga0466714_124429 | 3300042603 | Bacteria | 3250 |
| 229 | Ga0466716_043954 | 3300042605 | Bacteria | 10814 |
| 230 | Ga0466719_040334 | 3300042606 | Bacteria | 9091 |
| 231 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 232 | Ga0466697_055453 | 3300042611 | Bacteria | 1211 |
| 233 | Ga0466729_220223 | 3300042621 | Bacteria | 5662 |
| 234 | Ga0466731_226272 | 3300042622 | Bacteria | 5562 |
| 235 | Ga0466735_163792 | 3300042624 | Bacteria | 15548 |
| 236 | Ga0466735_189330 | 3300042624 | Bacteria | 1262 |
| 237 | Ga0466735_204570 | 3300042624 | Bacteria | 1433 |
| 238 | Ga0466730_090637 | 3300042625 | Unclassified | 2689 |
| 239 | Ga0466703_022452 | 3300042636 | Bacteria | 11702 |
| 240 | Ga0466703_249613 | 3300042636 | Unclassified | 1856 |
| 241 | Ga0466703_262133 | 3300042636 | Bacteria | 48736 |
| 242 | Ga0466704_020964 | 3300042643 | Bacteria | 3642 |
| 243 | Ga0466704_423430 | 3300042643 | Bacteria | 43182 |
| 244 | Ga0466709_179015 | 3300042648 | Bacteria | 32482 |
| 245 | Ga0466708_357814 | 3300042652 | Bacteria | 6224 |
| 246 | Ga0466708_435851 | 3300042652 | Bacteria | 53327 |
| 247 | Ga0123357_10579059 | 3300009784 | Bacteria | 876 |
| 248 | Ga0123356_10050915 | 3300010049 | Bacteria | 3853 |
| 249 | Ga0123356_10246757 | 3300010049 | Bacteria | 1860 |
| 250 | Ga0123353_10574512 | 3300010167 | Bacteria | 1619 |
| 251 | Ga0123353_10700232 | 3300010167 | Unclassified | 1422 |
| 252 | Ga0123354_10000184 | 3300010882 | Bacteria | 52522 |
| 253 | Ga0123354_10059047 | 3300010882 | Bacteria | 5692 |
| 254 | Ga0123354_10062052 | 3300010882 | Bacteria | 5508 |
| 255 | Ga0123354_10211952 | 3300010882 | Bacteria | 2090 |
| 256 | Ga0123354_10262503 | 3300010882 | Bacteria | 1721 |
| 257 | Ga0466732_175664 | 3300042656 | Bacteria | 44852 |
| 258 | Ga0466733_048785 | 3300042659 | Bacteria | 21900 |
| 259 | Ga0466733_185684 | 3300042659 | Bacteria | 3188 |
| 260 | Ga0160441_100017 | 3300012825 | Bacteria | 294372 |
| 261 | Ga0160431_101327 | 3300012828 | Bacteria | 7248 |
| 262 | Ga0415639_275667 | 3300038395 | Bacteria | 1443 |
| 263 | Ga0466656_125946 | 3300042550 | Bacteria | 2546 |
| 264 | Ga0466657_027615 | 3300042582 | Bacteria | 1678 |
| 265 | Ga0466657_367041 | 3300042582 | Unclassified | 1149 |
| 266 | Ga0466690_188044 | 3300042590 | Bacteria | 53126 |
| 267 | Ga0466690_227552 | 3300042590 | Bacteria | 11759 |
| 268 | Ga0466690_256751 | 3300042590 | Bacteria | 42016 |
| 269 | Ga0466690_421471 | 3300042590 | Bacteria | 34577 |
| 270 | Ga0466692_077125 | 3300042591 | Bacteria | 15957 |
| 271 | Ga0466692_109269 | 3300042591 | Bacteria | 1559 |
| 272 | Ga0466692_131466 | 3300042591 | Bacteria | 1970 |
| 273 | Ga0466692_172495 | 3300042591 | Bacteria | 15440 |
| 274 | Ga0466692_198826 | 3300042591 | Bacteria | 12014 |
| 275 | Ga0466693_438442 | 3300042592 | Bacteria | 1634 |
| 276 | Ga0466691_050587 | 3300042593 | Bacteria | 28945 |
| 277 | Ga0466691_102040 | 3300042593 | Bacteria | 39028 |
| 278 | Ga0466695_226325 | 3300042595 | Unclassified | 1559 |
| 279 | Ga0466701_015492 | 3300042598 | Bacteria | 1066 |
| 280 | 2227244698 | 2225789004 | Unclassified | 1332 |
| 281 | 2227545199 | 2225789004 | Bacteria | 2931 |
| 282 | IMNBGM34_c010939 | 3300000036 | Unclassified | 1143 |
| 283 | IMNBL1DRAFT_c0006259 | 3300000062 | Bacteria | 6537 |
| 284 | JGI24702J35022_10002246 | 3300002462 | Bacteria | 11872 |
| 285 | JGI24702J35022_10042681 | 3300002462 | Bacteria | 2415 |
| 286 | JGI24705J35276_12223395 | 3300002504 | Bacteria | 2505 |
| 287 | Ga0068302_10204672 | 3300005071 | Bacteria | 1840 |
| 288 | Ga0072941_1084245 | 3300005201 | Bacteria | 4292 |
| 289 | Ga0072941_1367038 | 3300005201 | Unclassified | 1655 |
| 290 | Ga0104048_1170001 | 3300007143 | Bacteria | 1792 |
| 291 | Ga0104050_1005810 | 3300007153 | Unclassified | 3883 |
| 292 | Ga0103268_1000160 | 3300007192 | Unclassified | 22132 |
| 293 | Ga0466697_158559 | 3300042611 | Bacteria | 1222 |
| 294 | Ga0466705_041128 | 3300042612 | Bacteria | 36311 |
| 295 | Ga0466705_246551 | 3300042612 | Bacteria | 20411 |
| 296 | Ga0466705_404689 | 3300042612 | Bacteria | 7094 |
| 297 | Ga0466705_428014 | 3300042612 | Bacteria | 2226 |
| 298 | Ga0466710_288791 | 3300042613 | Bacteria | 1615 |
| 299 | Ga0466711_078892 | 3300042615 | Bacteria | 7996 |
| 300 | Ga0466711_145823 | 3300042615 | Bacteria | 4827 |
| 301 | Ga0466711_458464 | 3300042615 | Bacteria | 2790 |
| 302 | Ga0466715_487040 | 3300042616 | Bacteria | 22856 |
| 303 | Ga0466723_076184 | 3300042618 | Bacteria | 1408 |
| 304 | Ga0466726_231996 | 3300042619 | Bacteria | 8066 |
| 305 | Ga0466728_108902 | 3300042620 | Unclassified | 1013 |
| 306 | Ga0466728_361132 | 3300042620 | Bacteria | 3869 |
| 307 | Ga0466729_072533 | 3300042621 | Bacteria | 11377 |
| 308 | Ga0466706_023837 | 3300042599 | Bacteria | 19821 |
| 309 | Ga0466700_127138 | 3300042600 | Bacteria | 2683 |
| 310 | Ga0466700_158672 | 3300042600 | Bacteria | 66427 |
| 311 | Ga0466707_015141 | 3300042601 | Bacteria | 8571 |
| 312 | Ga0466707_027733 | 3300042601 | Bacteria | 2040 |
| 313 | Ga0466707_161001 | 3300042601 | Bacteria | 8272 |
| 314 | Ga0466713_130066 | 3300042602 | Bacteria | 7412 |
| 315 | Ga0466713_131613 | 3300042602 | Bacteria | 10477 |
| 316 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 317 | Ga0466714_069898 | 3300042603 | Unclassified | 2268 |
| 318 | Ga0466714_087290 | 3300042603 | Bacteria | 2681 |
| 319 | Ga0466717_195481 | 3300042604 | Bacteria | 1336 |
| 320 | Ga0466717_226714 | 3300042604 | Unclassified | 1498 |
| 321 | Ga0466716_163313 | 3300042605 | Bacteria | 6326 |
| 322 | Ga0466716_456732 | 3300042605 | Bacteria | 12328 |
| 323 | Ga0466720_191270 | 3300042607 | Bacteria | 1951 |
| 324 | Ga0466722_171131 | 3300042609 | Bacteria | 2122 |
| 325 | Ga0466698_349759 | 3300042610 | Bacteria | 3672 |
| 326 | Ga0466731_042557 | 3300042622 | Unclassified | 3316 |
| 327 | Ga0466731_150827 | 3300042622 | Bacteria | 1009 |
| 328 | Ga0466734_020517 | 3300042623 | Bacteria | 2604 |
| 329 | Ga0466734_158024 | 3300042623 | Bacteria | 2822 |
| 330 | Ga0466703_114436 | 3300042636 | Bacteria | 1034 |
| 331 | Ga0466703_281595 | 3300042636 | Bacteria | 16908 |
| 332 | Ga0466704_296153 | 3300042643 | Bacteria | 75272 |
| 333 | Ga0466709_117007 | 3300042648 | Unclassified | 3887 |
| 334 | Ga0466709_240515 | 3300042648 | Unclassified | 2785 |
| 335 | Ga0466709_288082 | 3300042648 | Bacteria | 89530 |
| 336 | Ga0466708_007634 | 3300042652 | Bacteria | 16863 |
| 337 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 338 | Ga0466727_105114 | 3300042655 | Bacteria | 1109 |
| 339 | Ga0466727_131064 | 3300042655 | Bacteria | 28730 |
| 340 | Ga0123357_10065545 | 3300009784 | Bacteria | 4849 |
| 341 | Ga0123357_10268007 | 3300009784 | Bacteria | 1790 |
| 342 | Ga0123357_10330485 | 3300009784 | Bacteria | 1490 |
| 343 | Ga0123356_10013608 | 3300010049 | Bacteria | 7842 |
| 344 | Ga0123356_10412311 | 3300010049 | Bacteria | 1491 |
| 345 | Ga0123356_11203518 | 3300010049 | Bacteria | 924 |
| 346 | Ga0123353_10358451 | 3300010167 | Bacteria | 2193 |
| 347 | Ga0123353_11070208 | 3300010167 | Bacteria | 1075 |
| 348 | Ga0466732_043199 | 3300042656 | Bacteria | 1398 |
| 349 | Ga0466732_152457 | 3300042656 | Bacteria | 2940 |
| 350 | Ga0466733_004607 | 3300042659 | Bacteria | 2756 |
| 351 | Ga0466733_032117 | 3300042659 | Bacteria | 41731 |
| 352 | Ga0466733_087723 | 3300042659 | Unclassified | 1797 |
| 353 | Ga0466733_091640 | 3300042659 | Bacteria | 10478 |
| 354 | Ga0466733_167185 | 3300042659 | Bacteria | 2871 |
| 355 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 356 | Ga0160443_100027 | 3300012848 | Bacteria | 369940 |
| 357 | Ga0160443_104267 | 3300012848 | Unclassified | 2195 |
| 358 | Ga0223687_112456 | 3300021217 | Unclassified | 1271 |
| 359 | Ga0265387_1006102 | 3300024582 | Bacteria | 1620 |
| 360 | Ga0456237_0017415 | 3300041968 | Unclassified | 1009 |
| 361 | Ga0466657_068017 | 3300042582 | Bacteria | 1648 |
| 362 | Ga0466657_361063 | 3300042582 | Bacteria | 1783 |
| 363 | Ga0466690_063433 | 3300042590 | Bacteria | 19681 |
| 364 | Ga0466691_012676 | 3300042593 | Bacteria | 25732 |
| 365 | Ga0466695_236847 | 3300042595 | Bacteria | 2518 |
| 366 | Ga0466696_173937 | 3300042596 | Bacteria | 3614 |
| 367 | 2227516308 | 2225789004 | Bacteria | 17630 |
| 368 | 2227622155 | 2225789004 | Bacteria | 2180 |
| 369 | IMNBL1DRAFT_c0001329 | 3300000062 | Bacteria | 18611 |
| 370 | JGI24702J35022_10003759 | 3300002462 | Bacteria | 9121 |
| 371 | JGI24702J35022_10010998 | 3300002462 | Bacteria | 5047 |
| 372 | Meta3P_1004289 | 3300002464 | Bacteria | 6284 |
| 373 | JGI24699J35502_11133854 | 3300002509 | Bacteria | 17140 |
| 374 | Ga0068305_10010491 | 3300005083 | Bacteria | 4121 |
| 375 | Ga0068305_10025899 | 3300005083 | Bacteria | 21025 |
| 376 | Ga0072941_1441725 | 3300005201 | Bacteria | 1254 |
| 377 | Ga0102735_1002106 | 3300007080 | Bacteria | 3161 |
| 378 | Ga0102734_1000031 | 3300007129 | Bacteria | 55117 |
| 379 | Ga0104048_1005368 | 3300007143 | Unclassified | 5864 |
| 380 | Ga0103267_1000093 | 3300007190 | Bacteria | 34923 |
| 381 | Ga0466697_105408 | 3300042611 | Bacteria | 2231 |
| 382 | Ga0466697_270836 | 3300042611 | Bacteria | 3358 |
| 383 | Ga0466705_091456 | 3300042612 | Bacteria | 20257 |
| 384 | Ga0466705_196047 | 3300042612 | Bacteria | 14005 |
| 385 | Ga0466705_278201 | 3300042612 | Bacteria | 13432 |
| 386 | Ga0466710_045644 | 3300042613 | Bacteria | 14150 |
| 387 | Ga0466710_261518 | 3300042613 | Bacteria | 1028 |
| 388 | Ga0466711_035602 | 3300042615 | Bacteria | 27116 |
| 389 | Ga0466715_254794 | 3300042616 | Bacteria | 22233 |
| 390 | Ga0466723_281374 | 3300042618 | Bacteria | 18481 |
| 391 | Ga0466729_189381 | 3300042621 | Bacteria | 5018 |
| 392 | Ga0466706_036251 | 3300042599 | Bacteria | 1673 |
| 393 | Ga0466706_068671 | 3300042599 | Bacteria | 3243 |
| 394 | Ga0466706_192785 | 3300042599 | Bacteria | 6041 |
| 395 | Ga0466706_225350 | 3300042599 | Bacteria | 8817 |
| 396 | Ga0466700_381792 | 3300042600 | Bacteria | 1604 |
| 397 | Ga0466707_015416 | 3300042601 | Bacteria | 12912 |
| 398 | Ga0466707_358841 | 3300042601 | Bacteria | 13443 |
| 399 | Ga0466713_009753 | 3300042602 | Bacteria | 19425 |
| 400 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 401 | Ga0466713_049002 | 3300042602 | Bacteria | 11333 |
| 402 | Ga0466713_123387 | 3300042602 | Bacteria | 10600 |
| 403 | Ga0466714_009901 | 3300042603 | Bacteria | 2670 |
| 404 | Ga0466716_128626 | 3300042605 | Bacteria | 2630 |
| 405 | Ga0466716_222371 | 3300042605 | Bacteria | 20247 |
| 406 | Ga0466719_076192 | 3300042606 | Bacteria | 17216 |
| 407 | Ga0466722_099014 | 3300042609 | Bacteria | 1286 |
| 408 | Ga0466722_232470 | 3300042609 | Bacteria | 73289 |
| 409 | Ga0466735_044240 | 3300042624 | Bacteria | 5840 |
| 410 | Ga0466703_056502 | 3300042636 | Bacteria | 16463 |
| 411 | Ga0466703_060828 | 3300042636 | Bacteria | 8175 |
| 412 | Ga0466704_202585 | 3300042643 | Bacteria | 23604 |
| 413 | Ga0466704_258054 | 3300042643 | Bacteria | 19952 |
| 414 | Ga0466704_394785 | 3300042643 | Unclassified | 1349 |
| 415 | Ga0466727_344452 | 3300042655 | Bacteria | 7840 |
| 416 | Ga0123357_10006569 | 3300009784 | Bacteria | 14225 |
| 417 | Ga0123356_10278233 | 3300010049 | Bacteria | 1767 |
| 418 | Ga0123356_10340958 | 3300010049 | Bacteria | 1619 |
| 419 | Ga0123353_10250099 | 3300010167 | Bacteria | 2746 |
| 420 | Ga0123353_10300103 | 3300010167 | Bacteria | 2453 |
| 421 | Ga0123353_10547378 | 3300010167 | Bacteria | 1670 |
| 422 | Ga0123354_10017108 | 3300010882 | Bacteria | 11357 |
| 423 | Ga0123354_10085842 | 3300010882 | Bacteria | 4405 |
| 424 | Ga0123354_10361581 | 3300010882 | Bacteria | 1279 |
| 425 | Ga0466732_425360 | 3300042656 | Bacteria | 3871 |
| 426 | Ga0466733_019794 | 3300042659 | Bacteria | 9549 |
| 427 | Ga0466733_022299 | 3300042659 | Bacteria | 1321 |
| 428 | Ga0466733_098966 | 3300042659 | Bacteria | 5823 |
| 429 | Ga0466733_107072 | 3300042659 | Unclassified | 3373 |
| 430 | Ga0466733_141502 | 3300042659 | Bacteria | 1992 |
| 431 | Ga0160432_100016 | 3300012818 | Bacteria | 326439 |
| 432 | Ga0255809_1005906 | 3300022820 | Bacteria | 950 |
| 433 | Ga0466657_143616 | 3300042582 | Bacteria | 1791 |
| 434 | Ga0466690_372681 | 3300042590 | Bacteria | 7177 |
| 435 | Ga0466690_407298 | 3300042590 | Bacteria | 9434 |
| 436 | Ga0466691_167604 | 3300042593 | Bacteria | 26057 |
| 437 | Ga0466694_197625 | 3300042594 | Unclassified | 1057 |
| 438 | Ga0466696_055372 | 3300042596 | Bacteria | 2428 |
| 439 | Ga0466696_077127 | 3300042596 | Bacteria | 17382 |
| 440 | Ga0466701_011726 | 3300042598 | Bacteria | 33085 |
| 441 | 2227465201 | 2225789004 | Bacteria | 5204 |
| 442 | 2227513528 | 2225789004 | Bacteria | 18058 |
| 443 | IMNBL1DRAFT_c0002427 | 3300000062 | Bacteria | 12971 |
| 444 | IMNBL1DRAFT_c0038925 | 3300000062 | Bacteria | 1628 |
| 445 | JGI24698J34947_10007360 | 3300002449 | Bacteria | 6053 |
| 446 | JGI24698J34947_10134434 | 3300002449 | Bacteria | 1052 |
| 447 | JGI24695J34938_10039511 | 3300002450 | Unclassified | 2131 |
| 448 | JGI24702J35022_10047527 | 3300002462 | Bacteria | 2284 |
| 449 | JGI24705J35276_12234556 | 3300002504 | Bacteria | 5628 |
| 450 | JGI24696J40584_12960894 | 3300002834 | Bacteria | 9126 |
| 451 | Ga0068302_10196194 | 3300005071 | Bacteria | 2161 |
| 452 | Ga0068305_10001980 | 3300005083 | Bacteria | 22123 |
| 453 | Ga0103263_100193 | 3300007042 | Unclassified | 9710 |
| 454 | Ga0103265_1000080 | 3300007068 | Bacteria | 14099 |
| 455 | Ga0102739_1000113 | 3300007095 | Bacteria | 23232 |
| 456 | Ga0102734_1000792 | 3300007129 | Unclassified | 8454 |
| 457 | Ga0104048_1005013 | 3300007143 | Bacteria | 1929 |
| 458 | Ga0466705_091743 | 3300042612 | Bacteria | 1231 |
| 459 | Ga0466705_404549 | 3300042612 | Bacteria | 7310 |
| 460 | Ga0466710_230156 | 3300042613 | Bacteria | 1405 |
| 461 | Ga0466712_152430 | 3300042614 | Bacteria | 3877 |
| 462 | Ga0466711_114673 | 3300042615 | Bacteria | 26019 |
| 463 | Ga0466711_125896 | 3300042615 | Bacteria | 8224 |
| 464 | Ga0466711_140047 | 3300042615 | Bacteria | 6511 |
| 465 | Ga0466711_413274 | 3300042615 | Bacteria | 6092 |
| 466 | Ga0466715_048473 | 3300042616 | Bacteria | 50619 |
| 467 | Ga0466715_169547 | 3300042616 | Bacteria | 17957 |
| 468 | Ga0466715_446053 | 3300042616 | Bacteria | 21540 |
| 469 | Ga0466715_595541 | 3300042616 | Bacteria | 19555 |
| 470 | Ga0466723_139489 | 3300042618 | Bacteria | 11970 |
| 471 | Ga0466723_231227 | 3300042618 | Bacteria | 13556 |
| 472 | Ga0466723_241657 | 3300042618 | Bacteria | 29912 |
| 473 | Ga0466723_325833 | 3300042618 | Bacteria | 3912 |
| 474 | Ga0466726_334105 | 3300042619 | Bacteria | 7656 |
| 475 | Ga0466726_455886 | 3300042619 | Bacteria | 2386 |
| 476 | Ga0466728_172522 | 3300042620 | Bacteria | 21138 |
| 477 | Ga0466728_387610 | 3300042620 | Bacteria | 7426 |
| 478 | Ga0466700_368898 | 3300042600 | Bacteria | 3090 |
| 479 | Ga0466707_167144 | 3300042601 | Bacteria | 17624 |
| 480 | Ga0466707_256860 | 3300042601 | Bacteria | 2543 |
| 481 | Ga0466707_352844 | 3300042601 | Bacteria | 26463 |
| 482 | Ga0466707_388330 | 3300042601 | Bacteria | 11315 |
| 483 | Ga0466714_012380 | 3300042603 | Bacteria | 2280 |
| 484 | Ga0466714_041611 | 3300042603 | Bacteria | 8359 |
| 485 | Ga0466714_119143 | 3300042603 | Bacteria | 1437 |
| 486 | Ga0466714_140200 | 3300042603 | Bacteria | 35773 |
| 487 | Ga0466717_069192 | 3300042604 | Bacteria | 1233 |
| 488 | Ga0466716_525306 | 3300042605 | Bacteria | 5994 |
| 489 | Ga0466719_073827 | 3300042606 | Bacteria | 8983 |
| 490 | Ga0466719_507653 | 3300042606 | Unclassified | 2535 |
| 491 | Ga0466729_243854 | 3300042621 | Bacteria | 3433 |
| 492 | Ga0466734_026243 | 3300042623 | Bacteria | 2768 |
| 493 | Ga0466703_320533 | 3300042636 | Bacteria | 31058 |
| 494 | Ga0466703_348168 | 3300042636 | Bacteria | 8397 |
| 495 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 496 | Ga0466704_032859 | 3300042643 | Bacteria | 10876 |
| 497 | Ga0466704_079908 | 3300042643 | Bacteria | 14298 |
| 498 | Ga0466704_226601 | 3300042643 | Bacteria | 45308 |
| 499 | Ga0466704_237222 | 3300042643 | Bacteria | 9148 |
| 500 | Ga0466704_398314 | 3300042643 | Bacteria | 12888 |
| 501 | Ga0466704_620071 | 3300042643 | Bacteria | 1869 |
| 502 | Ga0466709_086078 | 3300042648 | Bacteria | 4530 |
| 503 | Ga0466709_190184 | 3300042648 | Bacteria | 38440 |
| 504 | Ga0466708_013558 | 3300042652 | Bacteria | 23219 |
| 505 | Ga0466725_019546 | 3300042654 | Bacteria | 15954 |
| 506 | Ga0123357_10025320 | 3300009784 | Bacteria | 8001 |
| 507 | Ga0123355_10165866 | 3300009826 | Bacteria | 3315 |
| 508 | Ga0123356_10123605 | 3300010049 | Bacteria | 2522 |
| 509 | Ga0123353_10195686 | 3300010167 | Bacteria | 3187 |
| 510 | Ga0123353_10535923 | 3300010167 | Unclassified | 1693 |
| 511 | Ga0123354_10420689 | 3300010882 | Bacteria | 1110 |
| 512 | Ga0466732_144794 | 3300042656 | Unclassified | 4547 |
| 513 | Ga0466732_197388 | 3300042656 | Bacteria | 1757 |
| 514 | Ga0466733_010912 | 3300042659 | Bacteria | 47437 |
| 515 | Ga0160468_100060 | 3300012819 | Bacteria | 151929 |
| 516 | Ga0466657_195074 | 3300042582 | Bacteria | 2966 |
| 517 | Ga0466657_204420 | 3300042582 | Bacteria | 55080 |
| 518 | Ga0466690_015278 | 3300042590 | Bacteria | 11552 |
| 519 | Ga0466690_022347 | 3300042590 | Bacteria | 26423 |
| 520 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 521 | Ga0466693_212964 | 3300042592 | Bacteria | 1708 |
| 522 | Ga0466691_004508 | 3300042593 | Bacteria | 44771 |
| 523 | Ga0466695_351127 | 3300042595 | Bacteria | 15582 |
| 524 | Ga0466696_124193 | 3300042596 | Bacteria | 7956 |
| 525 | Ga0466696_131555 | 3300042596 | Bacteria | 5983 |
| 526 | Ga0466699_063114 | 3300042597 | Unclassified | 3365 |
| 527 | 2227547988 | 2225789004 | Bacteria | 2891 |
| 528 | IMNBGM34_c002869 | 3300000036 | Bacteria | 2442 |
| 529 | JGI24698J34947_10070651 | 3300002449 | Bacteria | 1679 |
| 530 | JGI24702J35022_10001351 | 3300002462 | Bacteria | 15229 |
| 531 | JGI24699J35502_11134041 | 3300002509 | Bacteria | 26254 |
| 532 | Ga0072941_1380078 | 3300005201 | Bacteria | 1619 |
| 533 | Ga0104043_1012977 | 3300007058 | Unclassified | 1511 |
| 534 | Ga0102734_1000854 | 3300007129 | Bacteria | 8053 |
| 535 | Ga0102740_1000259 | 3300007140 | Bacteria | 15017 |
| 536 | Ga0466705_144303 | 3300042612 | Unclassified | 2172 |
| 537 | Ga0466711_043128 | 3300042615 | Bacteria | 56831 |
| 538 | Ga0466715_007590 | 3300042616 | Bacteria | 27073 |
| 539 | Ga0466715_060486 | 3300042616 | Bacteria | 10198 |
| 540 | Ga0466715_134918 | 3300042616 | Bacteria | 16436 |
| 541 | Ga0466715_401573 | 3300042616 | Bacteria | 13876 |
| 542 | Ga0466715_435015 | 3300042616 | Bacteria | 4061 |
| 543 | Ga0466723_363665 | 3300042618 | Bacteria | 1379 |
| 544 | Ga0466728_202737 | 3300042620 | Bacteria | 14768 |
| 545 | Ga0466728_255251 | 3300042620 | Bacteria | 107081 |
| 546 | Ga0466729_010781 | 3300042621 | Bacteria | 16724 |
| 547 | Ga0466729_108663 | 3300042621 | Bacteria | 6139 |
| 548 | Ga0466701_031657 | 3300042598 | Bacteria | 1834 |
| 549 | Ga0466706_010686 | 3300042599 | Bacteria | 53689 |
| 550 | Ga0466706_028806 | 3300042599 | Bacteria | 10264 |
| 551 | Ga0466706_036814 | 3300042599 | Bacteria | 5066 |
| 552 | Ga0466707_046647 | 3300042601 | Bacteria | 2986 |
| 553 | Ga0466707_088047 | 3300042601 | Bacteria | 21486 |
| 554 | Ga0466707_180005 | 3300042601 | Bacteria | 12771 |
| 555 | Ga0466713_011844 | 3300042602 | Bacteria | 15961 |
| 556 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 557 | Ga0466713_058214 | 3300042602 | Bacteria | 26989 |
| 558 | Ga0466713_104757 | 3300042602 | Bacteria | 74823 |
| 559 | Ga0466717_211110 | 3300042604 | Bacteria | 4301 |
| 560 | Ga0466716_514970 | 3300042605 | Bacteria | 14004 |
| 561 | Ga0466719_011424 | 3300042606 | Unclassified | 10997 |
| 562 | Ga0466719_028770 | 3300042606 | Bacteria | 10194 |
| 563 | Ga0466719_513672 | 3300042606 | Bacteria | 11415 |
| 564 | Ga0466721_186390 | 3300042608 | Bacteria | 7274 |
| 565 | Ga0466722_074712 | 3300042609 | Bacteria | 6756 |
| 566 | Ga0466722_101228 | 3300042609 | Bacteria | 13354 |
| 567 | Ga0466722_145157 | 3300042609 | Bacteria | 5331 |
| 568 | Ga0466722_148707 | 3300042609 | Bacteria | 7298 |
| 569 | Ga0466722_195473 | 3300042609 | Bacteria | 14303 |
| 570 | Ga0466698_187939 | 3300042610 | Bacteria | 3857 |
| 571 | Ga0466698_447578 | 3300042610 | Bacteria | 6273 |
| 572 | Ga0466731_391608 | 3300042622 | Bacteria | 1271 |
| 573 | Ga0466735_001533 | 3300042624 | Bacteria | 10722 |
| 574 | Ga0466735_125092 | 3300042624 | Bacteria | 2338 |
| 575 | Ga0466735_206840 | 3300042624 | Bacteria | 5054 |
| 576 | Ga0466703_276921 | 3300042636 | Bacteria | 1573 |
| 577 | Ga0466704_441760 | 3300042643 | Bacteria | 59239 |
| 578 | Ga0466709_309597 | 3300042648 | Bacteria | 40669 |
| 579 | Ga0466708_138795 | 3300042652 | Bacteria | 9903 |
| 580 | Ga0466708_182354 | 3300042652 | Bacteria | 36083 |
| 581 | Ga0466727_010825 | 3300042655 | Bacteria | 5495 |
| 582 | Ga0466727_033607 | 3300042655 | Unclassified | 4935 |
| 583 | Ga0466727_044867 | 3300042655 | Unclassified | 8766 |
| 584 | Ga0466727_276319 | 3300042655 | Bacteria | 1990 |
| 585 | Ga0123357_10100933 | 3300009784 | Bacteria | 3721 |
| 586 | Ga0123356_10188983 | 3300010049 | Bacteria | 2088 |
| 587 | Ga0123356_10209328 | 3300010049 | Bacteria | 1997 |
| 588 | Ga0123356_10422200 | 3300010049 | Bacteria | 1476 |
| 589 | Ga0123356_10478811 | 3300010049 | Bacteria | 1397 |
| 590 | Ga0123353_10808947 | 3300010167 | Unclassified | 1292 |
| 591 | Ga0123354_10085230 | 3300010882 | Bacteria | 4428 |
| 592 | Ga0123354_10127290 | 3300010882 | Bacteria | 3243 |
| 593 | Ga0160464_103831 | 3300012805 | Bacteria | 2040 |
| 594 | Ga0466733_009224 | 3300042659 | Bacteria | 2387 |
| 595 | Ga0466733_010054 | 3300042659 | Bacteria | 17175 |
| 596 | Ga0466733_010750 | 3300042659 | Bacteria | 35772 |
| 597 | Ga0466733_049043 | 3300042659 | Bacteria | 1218 |
| 598 | Ga0160453_100034 | 3300012814 | Bacteria | 178692 |
| 599 | Ga0160445_107606 | 3300012847 | Bacteria | 1705 |
| 600 | Ga0223675_1002019 | 3300021237 | Bacteria | 2239 |
| 601 | Ga0466657_278935 | 3300042582 | Bacteria | 1386 |
| 602 | Ga0466690_021422 | 3300042590 | Bacteria | 41181 |
| 603 | Ga0466692_030052 | 3300042591 | Bacteria | 80804 |
| 604 | Ga0466692_169555 | 3300042591 | Bacteria | 1772 |
| 605 | Ga0466693_432662 | 3300042592 | Bacteria | 3597 |
| 606 | Ga0466691_000897 | 3300042593 | Bacteria | 25654 |
| 607 | Ga0466691_076024 | 3300042593 | Bacteria | 14619 |
| 608 | Ga0466691_179325 | 3300042593 | Unclassified | 1131 |
| 609 | Ga0466694_087318 | 3300042594 | Unclassified | 2275 |
| 610 | Ga0466694_188511 | 3300042594 | Bacteria | 1990 |
| 611 | Ga0466696_427115 | 3300042596 | Unclassified | 3687 |
| 612 | Ga0466696_447293 | 3300042596 | Bacteria | 24793 |
| 613 | 2227223598 | 2225789004 | Bacteria | 1382 |
| 614 | IMNBL1DRAFT_c0000519 | 3300000062 | Bacteria | 31668 |
| 615 | IMNBL1DRAFT_c0000530 | 3300000062 | Bacteria | 31244 |
| 616 | IMNBL1DRAFT_c0001671 | 3300000062 | Bacteria | 16384 |
| 617 | IMNBL1DRAFT_c0024023 | 3300000062 | Bacteria | 2372 |
| 618 | JGI24698J34947_10012845 | 3300002449 | Unclassified | 4579 |
| 619 | JGI24699J35502_10870280 | 3300002509 | Bacteria | 988 |
| 620 | Ga0072940_1221128 | 3300005200 | Unclassified | 1461 |
| 621 | Ga0103266_1000116 | 3300007067 | Bacteria | 28163 |
| 622 | Ga0102734_1000819 | 3300007129 | Bacteria | 8274 |
| 623 | Ga0102734_1002993 | 3300007129 | Bacteria | 8287 |
| 624 | Ga0104050_1004451 | 3300007153 | Bacteria | 11267 |
| 625 | Ga0103267_1000457 | 3300007190 | Unclassified | 12836 |
| 626 | Ga0466697_156725 | 3300042611 | Bacteria | 2397 |
| 627 | Ga0466697_196526 | 3300042611 | Unclassified | 1918 |
| 628 | Ga0466705_327310 | 3300042612 | Bacteria | 4205 |
| 629 | Ga0466705_513279 | 3300042612 | Bacteria | 3043 |
| 630 | Ga0466705_523510 | 3300042612 | Bacteria | 13534 |
| 631 | Ga0466710_266877 | 3300042613 | Bacteria | 7625 |
| 632 | Ga0466710_352286 | 3300042613 | Bacteria | 1353 |
| 633 | Ga0466711_093162 | 3300042615 | Bacteria | 19638 |
| 634 | Ga0466711_190614 | 3300042615 | Bacteria | 11338 |
| 635 | Ga0466711_194622 | 3300042615 | Bacteria | 2367 |
| 636 | Ga0466715_120325 | 3300042616 | Bacteria | 14164 |
| 637 | Ga0466715_299034 | 3300042616 | Bacteria | 37987 |
| 638 | Ga0466728_354368 | 3300042620 | Bacteria | 15571 |
| 639 | Ga0466701_053727 | 3300042598 | Bacteria | 58706 |
| 640 | Ga0466706_125379 | 3300042599 | Bacteria | 20523 |
| 641 | Ga0466706_145688 | 3300042599 | Bacteria | 20534 |
| 642 | Ga0466713_028689 | 3300042602 | Bacteria | 1844 |
| 643 | Ga0466713_117216 | 3300042602 | Bacteria | 74221 |
| 644 | Ga0466713_120331 | 3300042602 | Bacteria | 12025 |
| 645 | Ga0466714_028666 | 3300042603 | Bacteria | 89946 |
| 646 | Ga0466714_059109 | 3300042603 | Bacteria | 3629 |
| 647 | Ga0466714_084536 | 3300042603 | Bacteria | 52454 |
| 648 | Ga0466716_026911 | 3300042605 | Bacteria | 7598 |
| 649 | Ga0466719_129534 | 3300042606 | Bacteria | 13143 |
| 650 | Ga0466721_158115 | 3300042608 | Bacteria | 1109 |
| 651 | Ga0466722_113217 | 3300042609 | Bacteria | 2402 |
| 652 | Ga0466734_051725 | 3300042623 | Bacteria | 2478 |
| 653 | Ga0466735_030119 | 3300042624 | Bacteria | 2906 |
| 654 | Ga0466735_072871 | 3300042624 | Bacteria | 6769 |
| 655 | Ga0466735_141394 | 3300042624 | Unclassified | 1754 |
| 656 | Ga0466735_145076 | 3300042624 | Bacteria | 15467 |
| 657 | Ga0466735_180301 | 3300042624 | Bacteria | 4161 |
| 658 | Ga0466703_173046 | 3300042636 | Bacteria | 32889 |
| 659 | Ga0466703_395390 | 3300042636 | Bacteria | 7570 |
| 660 | Ga0466704_076372 | 3300042643 | Bacteria | 18331 |
| 661 | Ga0466704_436606 | 3300042643 | Unclassified | 4357 |
| 662 | Ga0466709_110644 | 3300042648 | Bacteria | 26395 |
| 663 | Ga0466709_117347 | 3300042648 | Bacteria | 10931 |
| 664 | Ga0466708_060247 | 3300042652 | Bacteria | 12959 |
| 665 | Ga0466708_088165 | 3300042652 | Bacteria | 40724 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 131 | 195 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.