Protein Family IF07571
Metagenome
Isolate
270
Members
167
Samples
187
Scaffolds
142.09
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_441446|Ga0466711_441446_1743_2234
- Length
- 163 aa
- Sequence
- VKISTARRLSGSSANIRRYFFIMAKKVIGELKLQLPAGKATPAPPVGPALGQRGINIMEFVKQFNAKTADQVGMIIPVVITVYADRSFSFVMKTPPASVLLKKAAGKEKGSGVPNKNFVGKVSRKQVQEIAALKMVDLNAGSIEAAMRMVEGTARSMGVEITS
Sample Types
Isolate
30.7%
Metagenome
69.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Aphididae
28.8%
Unclassified
13.1%
Apidae
11.8%
Termitidae
9.8%
Formicidae
9.8%
Kalotermitidae
9.2%
Culicidae
2.6%
Termopsidae
2.6%
Armadillidiidae
2.6%
Elmidae
2.0%
Hormaphididae
1.3%
Rhinotermitidae
1.3%
Chrysomelidae
1.3%
Daphniidae
0.7%
Aphrophoridae
0.7%
Passalidae
0.7%
Hodotermitidae
0.7%
Curculionidae
0.7%
Hippoboscidae
0.7%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
36
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 2 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 3 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 4 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 5 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 6 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 7 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 8 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 9 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 10 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 13 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 17 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 18 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 19 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 23 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 26 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 27 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 28 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 29 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 35 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 36 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 37 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 38 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 39 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 40 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 41 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 42 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 43 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 44 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 45 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 52 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 53 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 54 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 55 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 56 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 57 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 58 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 61 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 62 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 63 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 64 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 65 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 66 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 67 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 68 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 69 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 70 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 71 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 72 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 73 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 74 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 75 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 76 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 77 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 78 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 79 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 80 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 81 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 82 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 83 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 84 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 85 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 86 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 87 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 88 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 89 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 90 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 91 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 92 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 93 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 94 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 95 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 96 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 97 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 98 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 99 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 100 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 101 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 102 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 103 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 104 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 105 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 106 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 107 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 108 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 109 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 110 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 111 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 112 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 113 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 114 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 115 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 116 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 117 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 118 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 119 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 120 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 121 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 122 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 123 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 124 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 125 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 126 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 127 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 128 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 129 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 130 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 131 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 132 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 133 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 134 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 135 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 136 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 137 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 138 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 139 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 140 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 141 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 142 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 143 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 144 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 145 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 146 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 147 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 148 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 149 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 150 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 151 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 152 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 153 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 154 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 155 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 156 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 157 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 158 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 159 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 160 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 161 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 162 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 163 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 164 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 165 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 166 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 167 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_139440 | 3300042612 | Bacteria | 13706 |
| 2 | Ga0466705_270456 | 3300042612 | Bacteria | 2553 |
| 3 | Ga0123353_10068371 | 3300010167 | Bacteria | 5704 |
| 4 | Ga0160435_1010598 | 3300012857 | Unclassified | 1907 |
| 5 | Ga0466691_045400 | 3300042593 | Bacteria | 23167 |
| 6 | Ga0466696_253683 | 3300042596 | Bacteria | 2727 |
| 7 | Ga0466711_404612 | 3300042615 | Bacteria | 4922 |
| 8 | Ga0466715_025300 | 3300042616 | Unclassified | 14834 |
| 9 | Ga0466723_161996 | 3300042618 | Bacteria | 10035 |
| 10 | Ga0466723_256764 | 3300042618 | Bacteria | 27733 |
| 11 | Ga0466726_305285 | 3300042619 | Bacteria | 4160 |
| 12 | Ga0466728_038839 | 3300042620 | Unclassified | 9729 |
| 13 | Ga0466728_442707 | 3300042620 | Unclassified | 1376 |
| 14 | Ga0466716_143209 | 3300042605 | Bacteria | 24217 |
| 15 | Ga0466716_506413 | 3300042605 | Bacteria | 11245 |
| 16 | Ga0466703_048013 | 3300042636 | Bacteria | 219350 |
| 17 | Ga0466703_303287 | 3300042636 | Unclassified | 1052 |
| 18 | Ga0466704_036871 | 3300042643 | Bacteria | 192493 |
| 19 | Ga0466709_084883 | 3300042648 | Bacteria | 22322 |
| 20 | Ga0466727_077387 | 3300042655 | Unclassified | 2544 |
| 21 | CVPL010L_1000002 | 3300002932 | Bacteria | 371144 |
| 22 | Ga0074278_106458 | 3300005721 | Bacteria | 1706 |
| 23 | Ga0102739_1016794 | 3300007095 | Unclassified | 945 |
| 24 | Ga0103264_1000014 | 3300007188 | Bacteria | 121992 |
| 25 | Ga0103264_1000421 | 3300007188 | Bacteria | 21971 |
| 26 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 27 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 28 | Ga0466733_096004 | 3300042659 | Bacteria | 1054 |
| 29 | Ga0466733_141957 | 3300042659 | Bacteria | 10292 |
| 30 | Ga0123356_10461713 | 3300010049 | Bacteria | 1420 |
| 31 | Ga0123356_13450366 | 3300010049 | Unclassified | 548 |
| 32 | Ga0160443_101703 | 3300012848 | Bacteria | 6489 |
| 33 | Ga0466690_344848 | 3300042590 | Bacteria | 13223 |
| 34 | Ga0466696_248758 | 3300042596 | Bacteria | 1214 |
| 35 | Ga0466696_317089 | 3300042596 | Bacteria | 6902 |
| 36 | Ga0466696_452473 | 3300042596 | Bacteria | 3266 |
| 37 | Ga0466711_168400 | 3300042615 | Unclassified | 2785 |
| 38 | Ga0466715_517576 | 3300042616 | Bacteria | 14317 |
| 39 | Ga0466715_520179 | 3300042616 | Bacteria | 9946 |
| 40 | Ga0466723_032722 | 3300042618 | Bacteria | 17727 |
| 41 | Ga0466723_170864 | 3300042618 | Bacteria | 1965 |
| 42 | Ga0466723_212793 | 3300042618 | Bacteria | 4126 |
| 43 | Ga0466728_075114 | 3300042620 | Bacteria | 1192 |
| 44 | Ga0466722_126977 | 3300042609 | Bacteria | 24638 |
| 45 | Ga0466703_101066 | 3300042636 | Bacteria | 2585 |
| 46 | Ga0466704_262059 | 3300042643 | Bacteria | 3030 |
| 47 | HBC_ctgsDRAFT_1024280 | 3300000333 | Unclassified | 1486 |
| 48 | Ga0074278_109712 | 3300005721 | Unclassified | 3641 |
| 49 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 50 | Ga0127649_109107 | 3300009460 | Bacteria | 19207 |
| 51 | Ga0127530_109138 | 3300009468 | Bacteria | 2480 |
| 52 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 53 | Ga0123355_10047574 | 3300009826 | Bacteria | 6975 |
| 54 | Ga0466691_037054 | 3300042593 | Bacteria | 9805 |
| 55 | Ga0466691_042151 | 3300042593 | Unclassified | 1144 |
| 56 | Ga0466691_089260 | 3300042593 | Unclassified | 6162 |
| 57 | Ga0466711_322030 | 3300042615 | Bacteria | 2074 |
| 58 | Ga0466715_599013 | 3300042616 | Bacteria | 3913 |
| 59 | Ga0466723_292549 | 3300042618 | Bacteria | 8877 |
| 60 | Ga0466723_310851 | 3300042618 | Bacteria | 4978 |
| 61 | Ga0466729_155944 | 3300042621 | Bacteria | 3962 |
| 62 | Ga0466706_131639 | 3300042599 | Bacteria | 1455 |
| 63 | Ga0466719_193965 | 3300042606 | Unclassified | 4892 |
| 64 | Ga0466704_269261 | 3300042643 | Unclassified | 2608 |
| 65 | Ga0466709_096367 | 3300042648 | Bacteria | 6538 |
| 66 | Ga0466709_136583 | 3300042648 | Unclassified | 1811 |
| 67 | Ga0466709_420699 | 3300042648 | Bacteria | 3105 |
| 68 | Ga0466727_011289 | 3300042655 | Bacteria | 2872 |
| 69 | JGI24698J34947_10052165 | 3300002449 | Bacteria | 2053 |
| 70 | CVPL005W_1000507 | 3300002934 | Bacteria | 14992 |
| 71 | Ga0068305_10199692 | 3300005083 | Bacteria | 5559 |
| 72 | Ga0127656_110073 | 3300009453 | Bacteria | 8841 |
| 73 | Ga0466705_249934 | 3300042612 | Bacteria | 4139 |
| 74 | Ga0123356_13112218 | 3300010049 | Unclassified | 578 |
| 75 | Ga0123353_10255223 | 3300010167 | Unclassified | 2712 |
| 76 | Ga0136160_1000047 | 3300010225 | Bacteria | 637579 |
| 77 | Ga0160455_103455 | 3300012837 | Unclassified | 2400 |
| 78 | Ga0160472_100083 | 3300012839 | Bacteria | 154330 |
| 79 | Ga0160448_110237 | 3300012854 | Unclassified | 1991 |
| 80 | Ga0309904_1000026 | 3300029810 | Bacteria | 33267 |
| 81 | Ga0466656_364019 | 3300042550 | Bacteria | 1100 |
| 82 | Ga0466711_029711 | 3300042615 | Bacteria | 4400 |
| 83 | Ga0466711_080340 | 3300042615 | Bacteria | 24032 |
| 84 | Ga0466711_495378 | 3300042615 | Bacteria | 3533 |
| 85 | Ga0466715_298660 | 3300042616 | Bacteria | 7345 |
| 86 | Ga0466715_353489 | 3300042616 | Bacteria | 21802 |
| 87 | Ga0466726_161838 | 3300042619 | Unclassified | 1090 |
| 88 | Ga0466713_097467 | 3300042602 | Bacteria | 3813 |
| 89 | Ga0466713_145164 | 3300042602 | Unclassified | 1082 |
| 90 | Ga0466735_170744 | 3300042624 | Bacteria | 3181 |
| 91 | Ga0466708_275872 | 3300042652 | Bacteria | 3583 |
| 92 | Ga0466708_362965 | 3300042652 | Bacteria | 4488 |
| 93 | Ga0063521_1001493 | 3300003973 | Bacteria | 6323 |
| 94 | Ga0068302_10023954 | 3300005071 | Bacteria | 3598 |
| 95 | Ga0072941_1307163 | 3300005201 | Unclassified | 1926 |
| 96 | Ga0074278_135239 | 3300005721 | Unclassified | 8947 |
| 97 | Ga0102738_1000016 | 3300007141 | Bacteria | 88310 |
| 98 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 99 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 100 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 101 | Ga0466705_309277 | 3300042612 | Bacteria | 2548 |
| 102 | Ga0160433_100747 | 3300012846 | Bacteria | 12077 |
| 103 | Ga0160457_1000059 | 3300012858 | Bacteria | 178122 |
| 104 | Ga0160436_1050831 | 3300012861 | Unclassified | 620 |
| 105 | Ga0466696_013869 | 3300042596 | Unclassified | 2426 |
| 106 | Ga0466711_318578 | 3300042615 | Bacteria | 44149 |
| 107 | Ga0466715_458123 | 3300042616 | Bacteria | 3362 |
| 108 | Ga0466715_576135 | 3300042616 | Bacteria | 16833 |
| 109 | Ga0466718_029327 | 3300042617 | Bacteria | 33406 |
| 110 | Ga0466723_228377 | 3300042618 | Bacteria | 3057 |
| 111 | Ga0466726_065607 | 3300042619 | Bacteria | 18562 |
| 112 | Ga0466728_171771 | 3300042620 | Bacteria | 11353 |
| 113 | Ga0466728_223368 | 3300042620 | Unclassified | 3596 |
| 114 | Ga0466708_364329 | 3300042652 | Bacteria | 54307 |
| 115 | Ga0466708_439833 | 3300042652 | Bacteria | 4199 |
| 116 | Ga0103268_1107179 | 3300007192 | Unclassified | 692 |
| 117 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 118 | Ga0466705_017437 | 3300042612 | Bacteria | 17644 |
| 119 | Ga0466733_009011 | 3300042659 | Bacteria | 5230 |
| 120 | Ga0466733_022421 | 3300042659 | Bacteria | 8374 |
| 121 | Ga0255572_1000174 | 3300026175 | Bacteria | 57360 |
| 122 | Ga0415639_214391 | 3300038395 | Bacteria | 1563 |
| 123 | Ga0466691_209111 | 3300042593 | Bacteria | 3432 |
| 124 | Ga0466694_182043 | 3300042594 | Bacteria | 34136 |
| 125 | Ga0466705_522563 | 3300042612 | Bacteria | 1343 |
| 126 | Ga0466711_421355 | 3300042615 | Unclassified | 6727 |
| 127 | Ga0466715_442488 | 3300042616 | Bacteria | 1635 |
| 128 | Ga0466723_143722 | 3300042618 | Bacteria | 1550 |
| 129 | Ga0466723_297790 | 3300042618 | Bacteria | 19421 |
| 130 | Ga0466723_358684 | 3300042618 | Bacteria | 2716 |
| 131 | Ga0466713_057693 | 3300042602 | Bacteria | 2029 |
| 132 | Ga0466714_034475 | 3300042603 | Bacteria | 25200 |
| 133 | Ga0466716_106156 | 3300042605 | Bacteria | 6274 |
| 134 | Ga0466734_037257 | 3300042623 | Bacteria | 18332 |
| 135 | Ga0466735_216816 | 3300042624 | Bacteria | 2124 |
| 136 | Ga0466708_097984 | 3300042652 | Bacteria | 5932 |
| 137 | Ga0466708_434085 | 3300042652 | Bacteria | 4897 |
| 138 | CVPL010W_10003310 | 3300002931 | Bacteria | 18569 |
| 139 | CVPL010L_1005601 | 3300002932 | Bacteria | 1646 |
| 140 | CVPL005W_1007376 | 3300002934 | Unclassified | 1813 |
| 141 | Ga0068302_10001157 | 3300005071 | Bacteria | 17398 |
| 142 | Ga0103266_1026567 | 3300007067 | Bacteria | 721 |
| 143 | Ga0102734_1000376 | 3300007129 | Bacteria | 37229 |
| 144 | Ga0102734_1008901 | 3300007129 | Unclassified | 2303 |
| 145 | Ga0127657_100003 | 3300009457 | Bacteria | 550482 |
| 146 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 147 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 148 | Ga0127651_100210 | 3300009483 | Bacteria | 383772 |
| 149 | Ga0309903_100010 | 3300029809 | Bacteria | 52591 |
| 150 | Ga0466657_107181 | 3300042582 | Bacteria | 1786 |
| 151 | Ga0466690_060584 | 3300042590 | Bacteria | 5464 |
| 152 | Ga0466693_203748 | 3300042592 | Bacteria | 8477 |
| 153 | Ga0466696_167469 | 3300042596 | Bacteria | 11721 |
| 154 | Ga0466711_090993 | 3300042615 | Bacteria | 4242 |
| 155 | Ga0466723_282185 | 3300042618 | Bacteria | 1116 |
| 156 | Ga0466726_124852 | 3300042619 | Bacteria | 79186 |
| 157 | Ga0466726_449585 | 3300042619 | Bacteria | 4545 |
| 158 | Ga0466707_249881 | 3300042601 | Bacteria | 1759 |
| 159 | Ga0466714_134169 | 3300042603 | Bacteria | 1002 |
| 160 | Ga0466719_172765 | 3300042606 | Bacteria | 5051 |
| 161 | Ga0466719_536468 | 3300042606 | Unclassified | 1559 |
| 162 | Ga0466703_059314 | 3300042636 | Bacteria | 22828 |
| 163 | Ga0466708_263625 | 3300042652 | Bacteria | 7302 |
| 164 | IMNBGM34_c016259 | 3300000036 | Bacteria | 927 |
| 165 | JGI24695J34938_10369184 | 3300002450 | Bacteria | 634 |
| 166 | CVPL005L_10012553 | 3300002938 | Bacteria | 6277 |
| 167 | Ga0103266_1000123 | 3300007067 | Unclassified | 33491 |
| 168 | Ga0103264_1000023 | 3300007188 | Bacteria | 103062 |
| 169 | Ga0103264_1001032 | 3300007188 | Unclassified | 12623 |
| 170 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 171 | Ga0123356_11529736 | 3300010049 | Bacteria | 824 |
| 172 | Ga0316159_10688 | 3300030930 | Bacteria | 9425 |
| 173 | Ga0466690_356350 | 3300042590 | Unclassified | 2009 |
| 174 | Ga0466691_149870 | 3300042593 | Bacteria | 4195 |
| 175 | Ga0466696_476914 | 3300042596 | Bacteria | 16349 |
| 176 | Ga0466711_441446 | 3300042615 | Bacteria | 3302 |
| 177 | Ga0466715_366385 | 3300042616 | Bacteria | 7763 |
| 178 | Ga0466715_467748 | 3300042616 | Bacteria | 41560 |
| 179 | Ga0466726_050501 | 3300042619 | Bacteria | 15900 |
| 180 | Ga0466728_011959 | 3300042620 | Bacteria | 2494 |
| 181 | Ga0466735_069402 | 3300042624 | Unclassified | 2042 |
| 182 | Ga0466703_256633 | 3300042636 | Bacteria | 21532 |
| 183 | Ga0466708_164328 | 3300042652 | Bacteria | 13919 |
| 184 | Ga0466708_241130 | 3300042652 | Bacteria | 3644 |
| 185 | Ga0127530_100232 | 3300009468 | Bacteria | 26084 |
| 186 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 187 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.