Protein Family IF07563
Metagenome
Isolate
480
Members
374
Samples
185
Scaffolds
207.03
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_415000|Ga0466711_415000_61_795
- Length
- 244 aa
- Sequence
- MMRTVPGPDHPLLPHHPCRRYPATLNHPTTMAQFFSLHPASPQLRLIRQTVAIIRNGGLVAFPTDSAYALGGRLGDAALLDRIRRLRQVDERHHFTLLCRDLSQIATFARVDNVQYRLLKATTPGPYTFILEGTRELPRRILHPRRKTIGLRVPEHAVVAALLEELGEPLLSSTLLLPSEVSPLTDAAEIRARLEQDIELVIEAGPCGAEMTTVIDLSSGAPELVRAGRGKLQPFGLTAPQSMA
Sample Types
Isolate
61.5%
Metagenome
38.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
31.2%
Unclassified
26.7%
Drosophilidae
6.1%
Termitidae
5.8%
Anthocoridae
5.8%
Kalotermitidae
3.9%
Culicidae
2.2%
Aphididae
1.7%
Tenebrionidae
1.4%
Curculionidae
1.4%
Rhinotermitidae
0.8%
Talitridae
0.8%
Formicidae
0.8%
Pteromalidae
0.8%
Termopsidae
0.8%
Tephritidae
0.8%
Calliphoridae
0.6%
Elmidae
0.6%
Palinuridae
0.6%
Armadillidiidae
0.6%
Hydrophilidae
0.6%
Pentatomidae
0.6%
Cerambycidae
0.6%
Siricidae
0.3%
Passalidae
0.3%
Ixodidae
0.3%
Aleyrodidae
0.3%
Daphniidae
0.3%
Hodotermitidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Glossinidae
0.3%
Carabidae
0.3%
Thripidae
0.3%
Artemiidae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Plutellidae
0.3%
Majidae
0.3%
Taxonomy
Archaea
0
Bacteria
454
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 4 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 5 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 6 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 7 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 8 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 9 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 10 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 11 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 12 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 13 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 14 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 15 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 16 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 17 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 18 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 21 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 22 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 23 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 24 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 25 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 26 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 27 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 28 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 29 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 30 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 31 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 32 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 33 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 34 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 35 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 36 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 37 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 38 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 39 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 40 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 41 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 42 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 43 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 44 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 45 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 46 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 47 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 48 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 49 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 50 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 51 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 52 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 53 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 54 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 55 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 56 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 57 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 58 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 59 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 60 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 61 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 62 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 63 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 64 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 65 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 66 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 67 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 68 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 69 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 70 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 71 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 72 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 73 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 74 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 75 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 76 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 77 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 78 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 79 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 80 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 81 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 82 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 83 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 84 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 85 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 86 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 87 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 88 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 89 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 90 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 91 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 92 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 93 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 94 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 95 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 96 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 97 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 98 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 99 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 100 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 101 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 102 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 103 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 104 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 105 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 106 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 107 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 108 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 109 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 110 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 111 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 112 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 113 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 114 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 115 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 116 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 117 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 118 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 119 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 120 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 121 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 122 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 123 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 124 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 125 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 126 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 127 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 128 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 129 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 130 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 131 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 132 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 133 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 134 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 135 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 136 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 137 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 138 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 139 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 140 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 141 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 142 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 143 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 144 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 145 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 146 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 147 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 148 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 149 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 150 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 151 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 152 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 153 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 154 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 155 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 156 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 157 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 158 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 159 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 160 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 161 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 162 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 163 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 164 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 165 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 166 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 167 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 168 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 169 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 170 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 171 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 172 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 173 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 174 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 175 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 176 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 177 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 178 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 179 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 180 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 181 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 182 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 183 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 184 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 185 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 186 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 187 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 188 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 189 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 190 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 191 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 192 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 193 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 194 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 195 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 196 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 197 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 198 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 199 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 200 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 201 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 202 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 203 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 204 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 205 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 206 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 207 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 208 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 209 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 210 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 211 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 212 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 213 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 214 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 215 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 216 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 217 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 218 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 219 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 220 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 221 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 222 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 223 | 2958255616 | Serratia marcescens TM | Isolate | |
| 224 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 225 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 226 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 227 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 228 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 229 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 230 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 231 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 232 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 233 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 234 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 235 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 236 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 237 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 238 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 239 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 240 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 241 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 242 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 243 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 244 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 245 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 246 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 247 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 248 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 249 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 250 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 251 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 252 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 253 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 254 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 255 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 256 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 257 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 258 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 259 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 260 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 261 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 262 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 263 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 264 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 265 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 266 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 267 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 268 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 269 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 270 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 271 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 272 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 273 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 274 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 275 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 276 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 277 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 278 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 279 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 280 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 281 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 282 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 283 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 284 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 285 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 286 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 287 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 288 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 289 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 290 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 291 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 292 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 293 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 294 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 295 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 296 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 297 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 298 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 299 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 300 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 301 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 302 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 303 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 304 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 305 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 306 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 307 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 308 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 309 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 310 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 311 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 312 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 313 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 314 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 315 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 316 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 317 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 318 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 319 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 320 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 321 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 322 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 323 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 324 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 325 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 326 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 327 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 328 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 329 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 330 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 331 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 332 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 333 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 334 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 335 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 336 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 337 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 338 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 339 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 340 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 341 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 342 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 343 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 344 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 345 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 346 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 347 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 348 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 349 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 350 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 351 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 352 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 353 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 354 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 355 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 356 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 357 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 358 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 359 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 360 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 361 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 362 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 363 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 364 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 365 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 366 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 367 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 368 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 369 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 370 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 371 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 372 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 373 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 374 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10101777 | 3300002462 | Bacteria | 1573 |
| 2 | JGI24705J35276_12203648 | 3300002504 | Unclassified | 1660 |
| 3 | Ga0063521_1000751 | 3300003973 | Unclassified | 11873 |
| 4 | Ga0072941_1405382 | 3300005201 | Bacteria | 1288 |
| 5 | Ga0105005_1136634 | 3300007505 | Bacteria | 5090 |
| 6 | Ga0466717_154441 | 3300042604 | Bacteria | 5304 |
| 7 | Ga0466722_004603 | 3300042609 | Bacteria | 2742 |
| 8 | Ga0466722_135915 | 3300042609 | Bacteria | 11590 |
| 9 | Ga0466704_221815 | 3300042643 | Bacteria | 33662 |
| 10 | Ga0466704_357108 | 3300042643 | Bacteria | 4815 |
| 11 | Ga0466704_495470 | 3300042643 | Bacteria | 40942 |
| 12 | Ga0466724_13761 | 3300042649 | Bacteria | 395579 |
| 13 | Ga0466708_296884 | 3300042652 | Bacteria | 11410 |
| 14 | Ga0123355_10588777 | 3300009826 | Unclassified | 1326 |
| 15 | Ga0123354_10014731 | 3300010882 | Bacteria | 12178 |
| 16 | Ga0466711_415000 | 3300042615 | Bacteria | 3090 |
| 17 | Ga0466718_144346 | 3300042617 | Bacteria | 4217 |
| 18 | Ga0466729_100790 | 3300042621 | Bacteria | 3579 |
| 19 | Ga0160447_111524 | 3300012849 | Bacteria | 1862 |
| 20 | Ga0466657_172417 | 3300042582 | Bacteria | 10373 |
| 21 | gam1t_NODE_568178_length=44303_GC=32_3_Contigs=9 | 2189573031 | Bacteria | 44383 |
| 22 | gam1t_NODE_619036_length=2196_GC=32_4_Contigs=1 | 2189573031 | Unclassified | 2196 |
| 23 | HBC_ctgsDRAFT_1000318 | 3300000333 | Bacteria | 11013 |
| 24 | SCG598L16_135253 | 3300000490 | Unclassified | 5914 |
| 25 | Ga0063521_1000429 | 3300003973 | Bacteria | 21878 |
| 26 | Ga0074278_103900 | 3300005721 | Unclassified | 2019 |
| 27 | Ga0074278_122195 | 3300005721 | Unclassified | 3488 |
| 28 | Ga0104051_1101808 | 3300007078 | Bacteria | 3186 |
| 29 | Ga0466707_129641 | 3300042601 | Bacteria | 97865 |
| 30 | Ga0466707_197629 | 3300042601 | Bacteria | 11537 |
| 31 | Ga0466707_221850 | 3300042601 | Bacteria | 14171 |
| 32 | Ga0466713_014808 | 3300042602 | Bacteria | 349625 |
| 33 | Ga0466719_570752 | 3300042606 | Bacteria | 1833 |
| 34 | Ga0466722_213137 | 3300042609 | Bacteria | 28731 |
| 35 | Ga0466705_118030 | 3300042612 | Bacteria | 13216 |
| 36 | Ga0466730_031191 | 3300042625 | Unclassified | 10923 |
| 37 | Ga0466704_555969 | 3300042643 | Bacteria | 1975 |
| 38 | Ga0466724_46373 | 3300042649 | Unclassified | 2682 |
| 39 | Ga0466708_026128 | 3300042652 | Bacteria | 9495 |
| 40 | Ga0466725_175937 | 3300042654 | Bacteria | 1896 |
| 41 | Ga0466727_200306 | 3300042655 | Bacteria | 58409 |
| 42 | Ga0123356_10027280 | 3300010049 | Bacteria | 5353 |
| 43 | Ga0123356_10666613 | 3300010049 | Unclassified | 1208 |
| 44 | Ga0466710_213604 | 3300042613 | Bacteria | 2759 |
| 45 | Ga0466715_645740 | 3300042616 | Bacteria | 2062 |
| 46 | Ga0160467_100026 | 3300012829 | Bacteria | 283547 |
| 47 | Ga0466657_118906 | 3300042582 | Bacteria | 1334 |
| 48 | Ga0466690_297639 | 3300042590 | Bacteria | 53281 |
| 49 | Ga0466692_056817 | 3300042591 | Bacteria | 8362 |
| 50 | Ga0466691_041548 | 3300042593 | Bacteria | 11408 |
| 51 | Ga0466696_016303 | 3300042596 | Bacteria | 9023 |
| 52 | Ga0466732_302890 | 3300042656 | Bacteria | 1696 |
| 53 | Ga0562377_0066 | 3300056842 | Bacteria | 455762 |
| 54 | SWWA_contig25674__length_2897___numreads_40 | 2100351016 | Bacteria | 2897 |
| 55 | 2227507945 | 2225789004 | Bacteria | 72134 |
| 56 | Meta3P_1001985 | 3300002464 | Bacteria | 33851 |
| 57 | Ga0072941_1131144 | 3300005201 | Bacteria | 1660 |
| 58 | Ga0466719_015117 | 3300042606 | Bacteria | 1640 |
| 59 | Ga0466730_006645 | 3300042625 | Unclassified | 8721 |
| 60 | Ga0466730_035129 | 3300042625 | Bacteria | 2325 |
| 61 | Ga0466704_062894 | 3300042643 | Bacteria | 1987 |
| 62 | Ga0466709_042412 | 3300042648 | Bacteria | 17925 |
| 63 | Ga0466725_004460 | 3300042654 | Bacteria | 4328 |
| 64 | Ga0466727_250719 | 3300042655 | Bacteria | 6002 |
| 65 | Ga0466712_288391 | 3300042614 | Bacteria | 4973 |
| 66 | Ga0466715_430234 | 3300042616 | Bacteria | 2564 |
| 67 | Ga0247290_00066 | 3300035364 | Unclassified | 35770 |
| 68 | Ga0466657_108045 | 3300042582 | Bacteria | 3451 |
| 69 | Ga0466657_292134 | 3300042582 | Bacteria | 26838 |
| 70 | Ga0466690_126731 | 3300042590 | Bacteria | 8853 |
| 71 | Meta3P_1001152 | 3300002464 | Bacteria | 15604 |
| 72 | WW0001_100270 | 3300002732 | Bacteria | 10473 |
| 73 | Ga0072941_1101831 | 3300005201 | Bacteria | 11931 |
| 74 | Ga0104041_1002194 | 3300007106 | Unclassified | 8338 |
| 75 | Ga0466707_309533 | 3300042601 | Unclassified | 2230 |
| 76 | Ga0466717_032773 | 3300042604 | Unclassified | 3216 |
| 77 | Ga0466719_037830 | 3300042606 | Bacteria | 2698 |
| 78 | Ga0466705_208939 | 3300042612 | Bacteria | 37731 |
| 79 | Ga0466730_001186 | 3300042625 | Unclassified | 6625 |
| 80 | Ga0466703_405083 | 3300042636 | Bacteria | 11075 |
| 81 | Ga0123357_10282904 | 3300009784 | Bacteria | 1709 |
| 82 | Ga0123354_10000081 | 3300010882 | Bacteria | 72300 |
| 83 | Ga0466710_322278 | 3300042613 | Bacteria | 3701 |
| 84 | Ga0466715_562243 | 3300042616 | Bacteria | 19739 |
| 85 | Ga0265387_1001126 | 3300024582 | Bacteria | 3935 |
| 86 | Ga0466656_054845 | 3300042550 | Bacteria | 3285 |
| 87 | Ga0466657_180858 | 3300042582 | Bacteria | 1838 |
| 88 | Ga0466657_183290 | 3300042582 | Unclassified | 4126 |
| 89 | Ga0466692_019684 | 3300042591 | Bacteria | 8362 |
| 90 | Ga0466691_027423 | 3300042593 | Bacteria | 19121 |
| 91 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 92 | HBC_ctgsDRAFT_1033134 | 3300000333 | Bacteria | 1270 |
| 93 | Ga0063521_1000029 | 3300003973 | Bacteria | 122497 |
| 94 | Ga0063521_1000155 | 3300003973 | Bacteria | 51752 |
| 95 | Ga0063521_1000203 | 3300003973 | Bacteria | 42518 |
| 96 | Ga0074302_1136760 | 3300005316 | Bacteria | 1709 |
| 97 | Ga0103264_1000010 | 3300007188 | Bacteria | 126108 |
| 98 | Ga0127645_141406 | 3300009461 | Bacteria | 5760 |
| 99 | Ga0466707_128421 | 3300042601 | Bacteria | 14269 |
| 100 | Ga0466713_053355 | 3300042602 | Bacteria | 8138 |
| 101 | Ga0466716_458968 | 3300042605 | Bacteria | 1277 |
| 102 | Ga0466719_114827 | 3300042606 | Bacteria | 7199 |
| 103 | Ga0466722_119774 | 3300042609 | Bacteria | 2006 |
| 104 | Ga0466705_201516 | 3300042612 | Bacteria | 2188 |
| 105 | Ga0466734_083908 | 3300042623 | Bacteria | 6804 |
| 106 | Ga0466734_119519 | 3300042623 | Bacteria | 2306 |
| 107 | Ga0466724_50843 | 3300042649 | Bacteria | 30150 |
| 108 | Ga0466725_467732 | 3300042654 | Bacteria | 5600 |
| 109 | Ga0123355_10266960 | 3300009826 | Bacteria | 2384 |
| 110 | Ga0123356_10213320 | 3300010049 | Bacteria | 1981 |
| 111 | Ga0123353_10014040 | 3300010167 | Bacteria | 11521 |
| 112 | Ga0466728_245303 | 3300042620 | Bacteria | 4091 |
| 113 | Ga0160472_101558 | 3300012839 | Bacteria | 6474 |
| 114 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 115 | Ga0466690_392698 | 3300042590 | Bacteria | 23066 |
| 116 | Ga0466733_005245 | 3300042659 | Bacteria | 84543 |
| 117 | Ga0074306_1117418 | 3300005309 | Bacteria | 4439 |
| 118 | Ga0104041_1014268 | 3300007106 | Unclassified | 2300 |
| 119 | Ga0105008_1228784 | 3300007507 | Bacteria | 1112 |
| 120 | Ga0127657_130478 | 3300009457 | Bacteria | 3134 |
| 121 | Ga0466706_023417 | 3300042599 | Bacteria | 4103 |
| 122 | Ga0466707_229655 | 3300042601 | Bacteria | 71770 |
| 123 | Ga0466729_232375 | 3300042621 | Bacteria | 60363 |
| 124 | Ga0466730_002125 | 3300042625 | Bacteria | 10073 |
| 125 | Ga0466724_42980 | 3300042649 | Unclassified | 11654 |
| 126 | Ga0466724_51681 | 3300042649 | Bacteria | 3165 |
| 127 | Ga0466724_52342 | 3300042649 | Bacteria | 99496 |
| 128 | Ga0123354_10109601 | 3300010882 | Bacteria | 3657 |
| 129 | Ga0466710_128528 | 3300042613 | Bacteria | 48275 |
| 130 | Ga0466711_017340 | 3300042615 | Bacteria | 3883 |
| 131 | Ga0466711_399986 | 3300042615 | Bacteria | 16613 |
| 132 | Ga0466715_323318 | 3300042616 | Bacteria | 36977 |
| 133 | Ga0466726_108318 | 3300042619 | Bacteria | 5028 |
| 134 | Ga0247290_00253 | 3300035364 | Bacteria | 13784 |
| 135 | Ga0466693_082461 | 3300042592 | Bacteria | 19359 |
| 136 | Ga0466691_193454 | 3300042593 | Bacteria | 1655 |
| 137 | Ga0562377_0585 | 3300056842 | Unclassified | 55457 |
| 138 | DPOL_contig02280 | 2035918003 | Unclassified | 11004 |
| 139 | gam1t_NODE_104069_length=177687_GC=33_4_Contigs=3 | 2189573031 | Bacteria | 177707 |
| 140 | HBC_ctgsDRAFT_1032863 | 3300000333 | Unclassified | 1275 |
| 141 | Ga0074302_1022968 | 3300005316 | Bacteria | 1330 |
| 142 | Ga0105553_1033752 | 3300007767 | Bacteria | 32403 |
| 143 | Ga0123357_10001248 | 3300009784 | Bacteria | 26720 |
| 144 | Ga0466701_028792 | 3300042598 | Bacteria | 67562 |
| 145 | Ga0466730_002890 | 3300042625 | Bacteria | 43265 |
| 146 | Ga0466703_188386 | 3300042636 | Bacteria | 18424 |
| 147 | Ga0466709_011112 | 3300042648 | Bacteria | 2606 |
| 148 | Ga0466725_185781 | 3300042654 | Bacteria | 43935 |
| 149 | Ga0123355_10010650 | 3300009826 | Bacteria | 14120 |
| 150 | Ga0123356_10159229 | 3300010049 | Bacteria | 2252 |
| 151 | Ga0466710_090187 | 3300042613 | Bacteria | 82809 |
| 152 | Ga0466715_067535 | 3300042616 | Bacteria | 3738 |
| 153 | Ga0466723_255605 | 3300042618 | Bacteria | 17178 |
| 154 | Ga0466729_154782 | 3300042621 | Bacteria | 3172 |
| 155 | Ga0160467_100001 | 3300012829 | Bacteria | 1734829 |
| 156 | Ga0160472_100002 | 3300012839 | Bacteria | 878838 |
| 157 | Ga0160460_100967 | 3300012845 | Bacteria | 12147 |
| 158 | Ga0265387_1000002 | 3300024582 | Bacteria | 132289 |
| 159 | DPOL_contig14399 | 2035918003 | Bacteria | 76515 |
| 160 | FGTW_contig05739 | 2065487013 | Bacteria | 2016 |
| 161 | SCG598B02_13315 | 3300000472 | Bacteria | 42566 |
| 162 | CVPL010L_1000031 | 3300002932 | Bacteria | 107385 |
| 163 | Ga0074278_116547 | 3300005721 | Unclassified | 2196 |
| 164 | Ga0104042_1120323 | 3300007130 | Bacteria | 2185 |
| 165 | Ga0123357_10000062 | 3300009784 | Bacteria | 85501 |
| 166 | Ga0466701_055169 | 3300042598 | Bacteria | 24384 |
| 167 | Ga0466707_305408 | 3300042601 | Bacteria | 3231 |
| 168 | Ga0466713_078712 | 3300042602 | Bacteria | 310725 |
| 169 | Ga0466717_056595 | 3300042604 | Bacteria | 1604 |
| 170 | Ga0466719_009170 | 3300042606 | Bacteria | 6778 |
| 171 | Ga0466719_200830 | 3300042606 | Bacteria | 1898 |
| 172 | Ga0466719_560722 | 3300042606 | Unclassified | 9657 |
| 173 | Ga0466735_029860 | 3300042624 | Bacteria | 1183 |
| 174 | Ga0466704_418521 | 3300042643 | Bacteria | 1442 |
| 175 | Ga0466709_375204 | 3300042648 | Bacteria | 18441 |
| 176 | Ga0466725_061032 | 3300042654 | Bacteria | 120083 |
| 177 | Ga0123353_10708589 | 3300010167 | Bacteria | 1411 |
| 178 | Ga0136159_1000161 | 3300010217 | Unclassified | 10996 |
| 179 | Ga0466723_051820 | 3300042618 | Bacteria | 14825 |
| 180 | Ga0466723_162830 | 3300042618 | Bacteria | 6489 |
| 181 | Ga0160433_103989 | 3300012846 | Unclassified | 2464 |
| 182 | Ga0160447_121904 | 3300012849 | Bacteria | 1000 |
| 183 | Ga0466657_205200 | 3300042582 | Bacteria | 23284 |
| 184 | Ga0466657_206637 | 3300042582 | Bacteria | 7393 |
| 185 | Ga0466692_112435 | 3300042591 | Bacteria | 72698 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01300 | Sua5_yciO_yrdC | Telomere recombination | 53 | 228 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01300 | GO:0003725 | double-stranded RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.