Protein Family IF06845
Metagenome
Isolate
463
Members
305
Samples
221
Scaffolds
487.07
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_165364|Ga0466722_165364_1863_3497
- Length
- 544 aa
- Sequence
- VAEYNDRRDAVLFHNFAEHSNRKASRRQFQIADTAVVKENQMNTKNLTFWFIIGSQFLYGAETLAQVEVDCRHMTDGMNEAGRMPWPIKLKGVMKTAAEIEKVCKEANNDDSCAGIITFCHTFSPSKMWIGGLAQLQKPWLHFHTQFNREIPNDAIDMDYMNLHQSAHGDREHGFIGARMRFPRKVVVGDWGDEKPQKKIAAWMRAAVGAAVSRDLKVMRFGDNMREVAVTEGDKVEAQIKLGWQVNTWPVGQLAEEMSAVTKAEIDELVEEYRTRYDFPDSAKKDASAAATAIVDTIRYQAREQIAMRKMLDAEACFAFTNTFQDLYGMKQLPGLATQDLMARGYGYGGEGDWKTAAMTALIKAMSAGTGEKALSGGTSFMEDYVYDFAAGLSLGAHMLEVCPSVASGKPRIEVHPLGIGDREPPARLVFEGKAGFATVYSLVDMGGRFRLIAQDIECVAPTQAMPNLPVARVMWRPMPDLERGAEAWILAGGAHHTTLSYDISADIMRDWARIMGIEFVYIDSETNPIALERDLMISSAVYR
Sample Types
Isolate
52.3%
Metagenome
47.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.3%
Apidae
22.9%
Blattidae
10.6%
Drosophilidae
7.5%
Termitidae
6.8%
Kalotermitidae
4.4%
Elmidae
3.8%
Tenebrionidae
2.4%
Curculionidae
1.7%
Scarabaeidae
1.7%
Rhinotermitidae
1.4%
Formicidae
1.4%
Armadillidiidae
1.0%
Passalidae
1.0%
Termopsidae
0.7%
Aphididae
0.7%
Cerambycidae
0.7%
Noctuidae
0.3%
Rhaphidophoridae
0.3%
Thripidae
0.3%
Nephropidae
0.3%
Dytiscidae
0.3%
Anthocoridae
0.3%
Libellulidae
0.3%
Rhopalidae
0.3%
Carabidae
0.3%
Hydrophilidae
0.3%
Daphniidae
0.3%
Thomisidae
0.3%
Bombycidae
0.3%
Culicidae
0.3%
Hodotermitidae
0.3%
Taxonomy
Archaea
0
Bacteria
449
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 2 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 3 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 4 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 5 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 6 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 7 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 8 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 9 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 10 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 11 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 12 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 13 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 14 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 15 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 16 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 17 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 18 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 19 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 20 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 21 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 22 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 23 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 24 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 27 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 28 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 29 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 30 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 31 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 36 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 37 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 38 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 39 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 40 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 41 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 42 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 43 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 44 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 45 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 46 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 47 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 48 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 49 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 50 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 51 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 52 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 53 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 54 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 55 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 56 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 57 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 58 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 59 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 60 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 63 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 64 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 65 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 66 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 67 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 68 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 69 | 3300007766 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut | Metagenome | Drosophilidae |
| 70 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 71 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 74 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 75 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 76 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 77 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 78 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 79 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 80 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 81 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 82 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 83 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 84 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 85 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 86 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 87 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 88 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 89 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 90 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 91 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 92 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 93 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 94 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 95 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 96 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 97 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 98 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 99 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 100 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 101 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 102 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 103 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 104 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 105 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 106 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 107 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 108 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 109 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 110 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 111 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 112 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 113 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 114 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 115 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 116 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 117 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 118 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 119 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 120 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 121 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 122 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 123 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 124 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 125 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 126 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 127 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 128 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 129 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 130 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 131 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 132 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 133 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 134 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 135 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 136 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 137 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 138 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 139 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 140 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 141 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 142 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 143 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 144 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 145 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 146 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 147 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 148 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 149 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 150 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 151 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 152 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 153 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 154 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 155 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 156 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 157 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 158 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 159 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 160 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 161 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 162 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 163 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 164 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 165 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 166 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 167 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 168 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 169 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 170 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 171 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 172 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 173 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 174 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 175 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 176 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 177 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 178 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 179 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 180 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 181 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 182 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 183 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 184 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 185 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 186 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 187 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 188 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 189 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 190 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 191 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 192 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 193 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 194 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 195 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 196 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 197 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 198 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 199 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 200 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 201 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 202 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 203 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 204 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 205 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 206 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 207 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 208 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 209 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 210 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 211 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 212 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 213 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 214 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 215 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 216 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 217 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 218 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 219 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 220 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 221 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 222 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 223 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 224 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 225 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 226 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 227 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 228 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 229 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 230 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 231 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 232 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 233 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 234 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 235 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 236 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 237 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 238 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 239 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 240 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 241 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 242 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 243 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 244 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 245 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 246 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 247 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 248 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 249 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 250 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 251 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 252 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 253 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 254 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 255 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 256 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 257 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 258 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 259 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 260 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 261 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 262 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 263 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 264 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 265 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 266 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 267 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 268 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 269 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 270 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 271 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 272 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 273 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 274 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 275 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 276 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 277 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 278 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 279 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 280 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 281 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 282 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 283 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 284 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 285 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 286 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 287 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 288 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 289 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 290 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 291 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 292 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 293 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 294 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 295 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 296 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 297 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 298 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 299 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 300 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 301 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 302 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 303 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 304 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 305 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_090286 | 3300042659 | Bacteria | 40500 |
| 2 | Ga0562379_0014 | 3300056790 | Bacteria | 1325122 |
| 3 | Ga0562379_0082 | 3300056790 | Bacteria | 350556 |
| 4 | Ga0562379_0091 | 3300056790 | Bacteria | 324047 |
| 5 | Ga0562378_0682 | 3300056814 | Unclassified | 49755 |
| 6 | Ga0562377_0011 | 3300056842 | Bacteria | 1259346 |
| 7 | Ga0562376_2748 | 3300056857 | Unclassified | 19984 |
| 8 | Ga0562374_0066 | 3300057007 | Bacteria | 347609 |
| 9 | Ga0466715_026138 | 3300042616 | Bacteria | 10500 |
| 10 | Ga0466723_014909 | 3300042618 | Bacteria | 24657 |
| 11 | Ga0466729_017412 | 3300042621 | Bacteria | 2569 |
| 12 | Ga0123353_10184244 | 3300010167 | Bacteria | 3302 |
| 13 | Ga0160445_101610 | 3300012847 | Bacteria | 6145 |
| 14 | Ga0316159_11020 | 3300030930 | Bacteria | 9996 |
| 15 | Ga0415639_020641 | 3300038395 | Bacteria | 6636 |
| 16 | 2227080766 | 2225789004 | Bacteria | 378528 |
| 17 | SCG598L16_135910 | 3300000490 | Bacteria | 90714 |
| 18 | JGI24702J35022_10011185 | 3300002462 | Bacteria | 4999 |
| 19 | Ga0072941_1101622 | 3300005201 | Bacteria | 10776 |
| 20 | Ga0466706_264431 | 3300042599 | Bacteria | 4579 |
| 21 | Ga0466707_238278 | 3300042601 | Bacteria | 1942 |
| 22 | Ga0466707_420286 | 3300042601 | Bacteria | 8397 |
| 23 | Ga0466713_104174 | 3300042602 | Bacteria | 30691 |
| 24 | Ga0466719_135358 | 3300042606 | Bacteria | 2541 |
| 25 | Ga0466722_008975 | 3300042609 | Bacteria | 5444 |
| 26 | Ga0466722_168463 | 3300042609 | Unclassified | 2725 |
| 27 | Ga0466730_040220 | 3300042625 | Bacteria | 15233 |
| 28 | Ga0466704_188928 | 3300042643 | Bacteria | 4523 |
| 29 | Ga0466705_298798 | 3300042612 | Bacteria | 1923 |
| 30 | Ga0466733_184370 | 3300042659 | Bacteria | 9974 |
| 31 | Ga0562379_0249 | 3300056790 | Bacteria | 145772 |
| 32 | Ga0562379_0340 | 3300056790 | Unclassified | 114300 |
| 33 | Ga0562379_2098 | 3300056790 | Bacteria | 18218 |
| 34 | Ga0562378_0221 | 3300056814 | Unclassified | 133873 |
| 35 | Ga0562377_1655 | 3300056842 | Unclassified | 21244 |
| 36 | Ga0466705_501698 | 3300042612 | Bacteria | 2435 |
| 37 | Ga0123355_10066053 | 3300009826 | Bacteria | 5824 |
| 38 | Ga0123356_10000376 | 3300010049 | Bacteria | 50874 |
| 39 | Ga0123356_10014587 | 3300010049 | Unclassified | 7552 |
| 40 | Ga0123356_10036952 | 3300010049 | Bacteria | 4558 |
| 41 | Ga0123353_10036137 | 3300010167 | Bacteria | 7737 |
| 42 | Ga0123353_10274283 | 3300010167 | Bacteria | 2596 |
| 43 | Ga0265387_1001459 | 3300024582 | Bacteria | 3467 |
| 44 | Ga0415639_001178 | 3300038395 | Bacteria | 47687 |
| 45 | Ga0415639_004806 | 3300038395 | Bacteria | 37095 |
| 46 | Ga0415639_004807 | 3300038395 | Bacteria | 11211 |
| 47 | Ga0466696_060286 | 3300042596 | Bacteria | 3613 |
| 48 | AglaG_contig16328 | 2084038013 | Bacteria | 2953 |
| 49 | IMNBL1DRAFT_c0003319 | 3300000062 | Bacteria | 10448 |
| 50 | HBC_ctgsDRAFT_1004500 | 3300000333 | Bacteria | 3233 |
| 51 | Ga0466706_101037 | 3300042599 | Bacteria | 60617 |
| 52 | Ga0466706_151109 | 3300042599 | Bacteria | 4600 |
| 53 | Ga0466719_232345 | 3300042606 | Bacteria | 9311 |
| 54 | Ga0466721_160537 | 3300042608 | Bacteria | 71411 |
| 55 | Ga0466704_078117 | 3300042643 | Bacteria | 17167 |
| 56 | Ga0466705_239374 | 3300042612 | Bacteria | 6175 |
| 57 | Ga0466733_142961 | 3300042659 | Bacteria | 8282 |
| 58 | Ga0562379_0080 | 3300056790 | Bacteria | 355260 |
| 59 | Ga0562376_0061 | 3300056857 | Bacteria | 279319 |
| 60 | Ga0562376_2505 | 3300056857 | Unclassified | 21655 |
| 61 | Ga0466711_080006 | 3300042615 | Bacteria | 15829 |
| 62 | Ga0466711_343023 | 3300042615 | Bacteria | 14665 |
| 63 | Ga0123353_10037051 | 3300010167 | Bacteria | 7646 |
| 64 | Ga0123353_10061252 | 3300010167 | Bacteria | 6034 |
| 65 | Ga0160455_100036 | 3300012837 | Bacteria | 302007 |
| 66 | Ga0466692_066493 | 3300042591 | Bacteria | 67113 |
| 67 | JGI24702J35022_10006316 | 3300002462 | Bacteria | 6857 |
| 68 | Ga0466706_131506 | 3300042599 | Bacteria | 17038 |
| 69 | Ga0466707_041950 | 3300042601 | Bacteria | 16644 |
| 70 | Ga0466713_063713 | 3300042602 | Bacteria | 3816 |
| 71 | Ga0466721_251483 | 3300042608 | Bacteria | 13592 |
| 72 | Ga0466703_299081 | 3300042636 | Bacteria | 9073 |
| 73 | Ga0466708_348418 | 3300042652 | Bacteria | 9517 |
| 74 | Ga0466725_102954 | 3300042654 | Bacteria | 2406 |
| 75 | Ga0466705_064741 | 3300042612 | Bacteria | 5009 |
| 76 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 77 | Ga0562377_0041 | 3300056842 | Bacteria | 609183 |
| 78 | Ga0562376_0004 | 3300056857 | Bacteria | 3026470 |
| 79 | Ga0562376_2518 | 3300056857 | Bacteria | 21580 |
| 80 | Ga0466715_291897 | 3300042616 | Bacteria | 12223 |
| 81 | Ga0466726_469545 | 3300042619 | Bacteria | 4772 |
| 82 | Ga0466728_483276 | 3300042620 | Bacteria | 11461 |
| 83 | Ga0123356_10019480 | 3300010049 | Bacteria | 6432 |
| 84 | Ga0123353_10003276 | 3300010167 | Bacteria | 20423 |
| 85 | Ga0123353_10048071 | 3300010167 | Bacteria | 6791 |
| 86 | Ga0123353_10142866 | 3300010167 | Bacteria | 3832 |
| 87 | Ga0123353_10145596 | 3300010167 | Bacteria | 3788 |
| 88 | Ga0160464_100733 | 3300012805 | Bacteria | 18722 |
| 89 | Ga0415639_035017 | 3300038395 | Bacteria | 6304 |
| 90 | Ga0415639_054092 | 3300038395 | Bacteria | 8250 |
| 91 | gam1t_NODE_477064_length=9976_GC=34_5_Contigs=2 | 2189573031 | Bacteria | 9986 |
| 92 | 2227590446 | 2225789004 | Bacteria | 2427 |
| 93 | JGI24702J35022_10010430 | 3300002462 | Bacteria | 5192 |
| 94 | Ga0063521_1000029 | 3300003973 | Bacteria | 122497 |
| 95 | Ga0074278_119027 | 3300005721 | Bacteria | 2264 |
| 96 | Ga0105003_1001603 | 3300007766 | Bacteria | 15183 |
| 97 | Ga0466706_155123 | 3300042599 | Bacteria | 22471 |
| 98 | Ga0466706_162695 | 3300042599 | Bacteria | 3289 |
| 99 | Ga0466706_256711 | 3300042599 | Bacteria | 60836 |
| 100 | Ga0466700_492821 | 3300042600 | Bacteria | 1433 |
| 101 | Ga0466714_000898 | 3300042603 | Bacteria | 3551 |
| 102 | Ga0466716_065457 | 3300042605 | Bacteria | 11284 |
| 103 | Ga0466702_103055 | 3300042635 | Bacteria | 5194 |
| 104 | Ga0466705_370902 | 3300042612 | Bacteria | 9129 |
| 105 | Ga0562377_0231 | 3300056842 | Bacteria | 134767 |
| 106 | Ga0562377_0241 | 3300056842 | Bacteria | 129113 |
| 107 | Ga0562375_4261 | 3300056856 | Bacteria | 11181 |
| 108 | Ga0562374_0015 | 3300057007 | Bacteria | 1219565 |
| 109 | Ga0466711_118770 | 3300042615 | Bacteria | 5932 |
| 110 | Ga0466715_095440 | 3300042616 | Bacteria | 7487 |
| 111 | Ga0466715_202870 | 3300042616 | Bacteria | 11932 |
| 112 | Ga0466715_317474 | 3300042616 | Bacteria | 28415 |
| 113 | Ga0123355_10000107 | 3300009826 | Bacteria | 91810 |
| 114 | Ga0123356_10011679 | 3300010049 | Bacteria | 8554 |
| 115 | Ga0123353_10000148 | 3300010167 | Bacteria | 87348 |
| 116 | Ga0123353_10003322 | 3300010167 | Bacteria | 20296 |
| 117 | Ga0123353_10032877 | 3300010167 | Bacteria | 8064 |
| 118 | Ga0123353_10165952 | 3300010167 | Bacteria | 3510 |
| 119 | Ga0123354_10214380 | 3300010882 | Bacteria | 2068 |
| 120 | Ga0466692_145300 | 3300042591 | Bacteria | 19445 |
| 121 | Ga0466696_020824 | 3300042596 | Bacteria | 5183 |
| 122 | Ga0466701_009529 | 3300042598 | Bacteria | 375690 |
| 123 | Ga0466706_058454 | 3300042599 | Bacteria | 2386 |
| 124 | Ga0466706_082448 | 3300042599 | Bacteria | 44969 |
| 125 | Ga0466700_117029 | 3300042600 | Bacteria | 6171 |
| 126 | Ga0466707_138885 | 3300042601 | Bacteria | 24067 |
| 127 | Ga0466714_092303 | 3300042603 | Bacteria | 10748 |
| 128 | Ga0466717_104782 | 3300042604 | Bacteria | 5216 |
| 129 | Ga0466719_333140 | 3300042606 | Bacteria | 5225 |
| 130 | Ga0466722_023094 | 3300042609 | Bacteria | 3440 |
| 131 | Ga0466722_055864 | 3300042609 | Bacteria | 14778 |
| 132 | Ga0466722_165364 | 3300042609 | Bacteria | 6792 |
| 133 | Ga0466734_005875 | 3300042623 | Bacteria | 4159 |
| 134 | Ga0466704_294219 | 3300042643 | Bacteria | 55450 |
| 135 | Ga0466727_312825 | 3300042655 | Bacteria | 1893 |
| 136 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 137 | Ga0562375_0089 | 3300056856 | Bacteria | 285665 |
| 138 | Ga0562376_0538 | 3300056857 | Unclassified | 67118 |
| 139 | Ga0562374_0021 | 3300057007 | Bacteria | 1089448 |
| 140 | Ga0562374_1076 | 3300057007 | Bacteria | 35494 |
| 141 | Ga0466723_178323 | 3300042618 | Bacteria | 48138 |
| 142 | Ga0123353_10004052 | 3300010167 | Bacteria | 18773 |
| 143 | Ga0123353_10004976 | 3300010167 | Bacteria | 17312 |
| 144 | Ga0123353_10007420 | 3300010167 | Bacteria | 14804 |
| 145 | Ga0123353_10076834 | 3300010167 | Bacteria | 5365 |
| 146 | Ga0160464_100120 | 3300012805 | Bacteria | 87811 |
| 147 | Ga0466692_041886 | 3300042591 | Bacteria | 2838 |
| 148 | Ga0466691_006485 | 3300042593 | Bacteria | 33041 |
| 149 | Ga0466691_129586 | 3300042593 | Bacteria | 12504 |
| 150 | Ga0466691_166097 | 3300042593 | Bacteria | 2777 |
| 151 | Ga0466696_021329 | 3300042596 | Bacteria | 5395 |
| 152 | IMNBGM34_c000074 | 3300000036 | Bacteria | 27929 |
| 153 | HBC_ctgsDRAFT_1000482 | 3300000333 | Bacteria | 8989 |
| 154 | JGI24697J35500_11252134 | 3300002507 | Bacteria | 2569 |
| 155 | Ga0466706_024450 | 3300042599 | Bacteria | 4086 |
| 156 | Ga0466706_040556 | 3300042599 | Bacteria | 25217 |
| 157 | Ga0466706_137579 | 3300042599 | Bacteria | 14478 |
| 158 | Ga0466706_142220 | 3300042599 | Bacteria | 2493 |
| 159 | Ga0466706_260041 | 3300042599 | Bacteria | 4219 |
| 160 | Ga0466706_284061 | 3300042599 | Bacteria | 2650 |
| 161 | Ga0466713_087161 | 3300042602 | Bacteria | 3886 |
| 162 | Ga0466719_246062 | 3300042606 | Bacteria | 4556 |
| 163 | Ga0466704_148568 | 3300042643 | Bacteria | 3750 |
| 164 | Ga0466704_255109 | 3300042643 | Bacteria | 3634 |
| 165 | Ga0466724_15447 | 3300042649 | Bacteria | 123877 |
| 166 | Ga0466727_264367 | 3300042655 | Bacteria | 2588 |
| 167 | Ga0562377_0085 | 3300056842 | Unclassified | 338239 |
| 168 | Ga0562376_0519 | 3300056857 | Bacteria | 69115 |
| 169 | Ga0466715_032121 | 3300042616 | Bacteria | 36016 |
| 170 | Ga0466715_204496 | 3300042616 | Bacteria | 4386 |
| 171 | Ga0466715_219681 | 3300042616 | Bacteria | 43032 |
| 172 | Ga0466715_308005 | 3300042616 | Bacteria | 2192 |
| 173 | Ga0466723_350569 | 3300042618 | Bacteria | 4188 |
| 174 | Ga0466728_260281 | 3300042620 | Bacteria | 6738 |
| 175 | Ga0123355_10262018 | 3300009826 | Bacteria | 2416 |
| 176 | Ga0123356_10030680 | 3300010049 | Bacteria | 5031 |
| 177 | Ga0123356_10124859 | 3300010049 | Bacteria | 2511 |
| 178 | Ga0123356_10565758 | 3300010049 | Bacteria | 1299 |
| 179 | Ga0123353_10000793 | 3300010167 | Bacteria | 38470 |
| 180 | Ga0123353_10044442 | 3300010167 | Bacteria | 7041 |
| 181 | Ga0123353_10276270 | 3300010167 | Bacteria | 2584 |
| 182 | Ga0466696_450448 | 3300042596 | Bacteria | 1748 |
| 183 | Ga0105003_1110279 | 3300007766 | Unclassified | 4402 |
| 184 | Ga0466706_005338 | 3300042599 | Bacteria | 20328 |
| 185 | Ga0466706_060437 | 3300042599 | Bacteria | 8251 |
| 186 | Ga0466706_060661 | 3300042599 | Bacteria | 15441 |
| 187 | Ga0466706_078936 | 3300042599 | Bacteria | 21989 |
| 188 | Ga0466706_081679 | 3300042599 | Bacteria | 15818 |
| 189 | Ga0466706_158562 | 3300042599 | Bacteria | 26434 |
| 190 | Ga0466706_270850 | 3300042599 | Bacteria | 22715 |
| 191 | Ga0466707_290265 | 3300042601 | Bacteria | 80468 |
| 192 | Ga0466719_222600 | 3300042606 | Bacteria | 12601 |
| 193 | Ga0466704_090815 | 3300042643 | Bacteria | 2723 |
| 194 | Ga0466704_109943 | 3300042643 | Bacteria | 4502 |
| 195 | Ga0466708_082024 | 3300042652 | Bacteria | 17983 |
| 196 | Ga0466705_296496 | 3300042612 | Bacteria | 7833 |
| 197 | Ga0562379_1115 | 3300056790 | Unclassified | 35583 |
| 198 | Ga0562375_1791 | 3300056856 | Unclassified | 26829 |
| 199 | Ga0562376_0422 | 3300056857 | Bacteria | 79165 |
| 200 | Ga0562374_0007 | 3300057007 | Bacteria | 2074405 |
| 201 | Ga0466715_027967 | 3300042616 | Bacteria | 5024 |
| 202 | Ga0466728_181482 | 3300042620 | Bacteria | 3258 |
| 203 | Ga0123355_10078187 | 3300009826 | Bacteria | 5286 |
| 204 | Ga0123353_10017449 | 3300010167 | Bacteria | 10555 |
| 205 | Ga0123353_10027958 | 3300010167 | Bacteria | 8653 |
| 206 | Ga0123353_10086497 | 3300010167 | Bacteria | 5048 |
| 207 | Ga0160467_100101 | 3300012829 | Bacteria | 125088 |
| 208 | Ga0160472_100002 | 3300012839 | Bacteria | 878838 |
| 209 | Ga0415639_044848 | 3300038395 | Bacteria | 11460 |
| 210 | Ga0466692_051337 | 3300042591 | Bacteria | 2058 |
| 211 | IMNBL1DRAFT_c0000018 | 3300000062 | Bacteria | 172634 |
| 212 | AustNasuHG_c1000471 | 3300000089 | Bacteria | 14140 |
| 213 | Ga0063521_1016853 | 3300003973 | Bacteria | 1766 |
| 214 | Ga0074278_142887 | 3300005721 | Unclassified | 9986 |
| 215 | Ga0466706_130214 | 3300042599 | Bacteria | 48191 |
| 216 | Ga0466706_283842 | 3300042599 | Bacteria | 2241 |
| 217 | Ga0466714_041576 | 3300042603 | Bacteria | 1671 |
| 218 | Ga0466719_289755 | 3300042606 | Bacteria | 12208 |
| 219 | Ga0466734_172717 | 3300042623 | Bacteria | 10560 |
| 220 | Ga0466730_097202 | 3300042625 | Bacteria | 63992 |
| 221 | Ga0466703_155970 | 3300042636 | Bacteria | 14448 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02610 | GO:0008733 | L-arabinose isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.