Protein Family IF03596
Metagenome
Isolate
445
Members
310
Samples
217
Scaffolds
233.16
Avg Length
Representative Sequence
- ID
- 3300012805|Ga0160464_101291|Ga0160464_10129112
- Length
- 287 aa
- Sequence
- MAKLRVTAGLNELLSLVTFFAAAKKVTAAPHRGRANRPTRIQDSPKESQPENRKPKMLQVDNLNQYYGGSHILRDVKMTVPDGELTVLLGRNGVGKTTLLRCLMGVVPTKSGTINWRGNKISSMPTHARVANGLAYVPQGRDIFGRLTVEENLLVGAASRKAPSKIPDRIYDLFPVLRDMKNRRGGDLSGGQQQQLAIGRALMSEPQLLILDEPTEGIQPSIIRDIGRTLRQLVDEMGMTVLLVEQYYDFARELADRYWVMSRGEIVAGGAGSEMDAHGVRELIAV*
Sample Types
Isolate
51.2%
Metagenome
48.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.1%
Unclassified
14.6%
Elmidae
7.1%
Termitidae
5.8%
Curculionidae
5.1%
Culicidae
4.7%
Anthocoridae
4.7%
Muscidae
4.4%
Kalotermitidae
4.4%
Drosophilidae
3.4%
Armadillidiidae
2.0%
Rhinotermitidae
1.7%
Apidae
1.7%
Tenebrionidae
1.4%
Cerambycidae
1.0%
Calliphoridae
1.0%
Tephritidae
1.0%
Hydrophilidae
0.7%
Pentatomidae
0.7%
Berytidae
0.7%
Alydidae
0.7%
Aphididae
0.7%
Crambidae
0.7%
Largidae
0.7%
Formicidae
0.7%
Passalidae
0.3%
Hodotermitidae
0.3%
Thripidae
0.3%
Carabidae
0.3%
Sarcophagidae
0.3%
Termopsidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Plutellidae
0.3%
Siricidae
0.3%
Taxonomy
Archaea
0
Bacteria
401
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 3 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 4 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 5 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 6 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 7 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 8 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 9 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 10 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 11 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 12 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 13 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 14 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 15 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 16 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 17 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 18 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 22 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 26 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 27 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 28 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 29 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 30 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 31 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 32 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 33 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 34 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 41 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 42 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 43 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 44 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 45 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 46 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 47 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 48 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 49 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 50 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 51 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 52 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 53 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 54 | 2958255616 | Serratia marcescens TM | Isolate | |
| 55 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 56 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 57 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 58 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 59 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 60 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 63 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 64 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 65 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 66 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 67 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 68 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 69 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 70 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 71 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 72 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 73 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 74 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 75 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 76 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 77 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 78 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 79 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 80 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 81 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 82 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 83 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 84 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 85 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 86 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 87 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 88 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 89 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 90 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 91 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 92 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 93 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 94 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 95 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 96 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 97 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 98 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 99 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 100 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 101 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 102 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 103 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 104 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 105 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 106 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 107 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 108 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 109 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 110 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 111 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 112 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 113 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 114 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 115 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 116 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 117 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 118 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 119 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 120 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 121 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 122 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 123 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 124 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 125 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 126 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 127 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 128 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 129 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 130 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 131 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 132 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 133 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 134 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 135 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 136 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 137 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 138 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 139 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 140 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 141 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 142 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 143 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 144 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 145 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 146 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 147 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 148 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 149 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 150 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 151 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 152 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 153 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 154 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 155 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 156 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 157 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 158 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 159 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 160 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 161 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 162 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 163 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 164 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 165 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 166 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 167 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 168 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 169 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 170 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 171 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 172 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 173 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 174 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 175 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 176 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 177 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 178 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 179 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 180 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 181 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 182 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 183 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 184 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 185 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 186 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 187 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 188 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 189 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 190 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 191 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 192 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 193 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 194 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 195 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 196 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 197 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 198 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 199 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 200 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 201 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 202 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 203 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 204 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 205 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 206 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 207 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 208 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 209 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 210 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 211 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 212 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 213 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 214 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 215 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 216 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 217 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 218 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 219 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 220 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 221 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 222 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 223 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 224 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 225 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 226 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 227 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 228 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 229 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 230 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 231 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 232 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 233 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 234 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 235 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 236 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 237 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 238 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 239 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 240 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 241 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 242 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 243 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 244 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 245 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 246 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 247 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 248 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 249 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 250 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 251 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 252 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 253 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 254 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 255 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 256 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 257 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 258 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 259 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 260 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 261 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 262 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 263 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 264 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 265 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 266 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 267 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 268 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 269 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 270 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 271 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 272 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 273 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 274 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 275 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 276 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 277 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 278 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 279 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 280 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 281 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 282 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 283 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 284 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 285 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 286 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 287 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 288 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 289 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 290 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 291 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 292 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 293 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 294 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 295 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 296 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 297 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 298 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 299 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 300 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 301 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 302 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 303 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 304 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 305 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 306 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 307 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 308 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 309 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 310 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_040634 | 3300042656 | Bacteria | 6771 |
| 2 | Ga0160454_100758 | 3300012798 | Bacteria | 6630 |
| 3 | Ga0160470_102470 | 3300012813 | Bacteria | 3473 |
| 4 | Ga0160446_104595 | 3300012835 | Bacteria | 2042 |
| 5 | Ga0160472_100020 | 3300012839 | Bacteria | 337940 |
| 6 | Ga0160433_111575 | 3300012846 | Unclassified | 1123 |
| 7 | Ga0160436_1035721 | 3300012861 | Unclassified | 817 |
| 8 | Ga0160436_1037437 | 3300012861 | Bacteria | 786 |
| 9 | Ga0264413_113468 | 3300024493 | Bacteria | 1988 |
| 10 | Ga0466719_154425 | 3300042606 | Bacteria | 6003 |
| 11 | Ga0466720_152176 | 3300042607 | Unclassified | 5208 |
| 12 | Ga0466722_086403 | 3300042609 | Bacteria | 19129 |
| 13 | Ga0466722_203167 | 3300042609 | Bacteria | 6229 |
| 14 | Ga0466704_291603 | 3300042643 | Bacteria | 24945 |
| 15 | Ga0466709_029042 | 3300042648 | Bacteria | 12034 |
| 16 | Ga0466724_33858 | 3300042649 | Unclassified | 4994 |
| 17 | Ga0466708_123811 | 3300042652 | Bacteria | 17627 |
| 18 | DPO_contig09148 | 2032320009 | Unclassified | 54196 |
| 19 | 2230954182 | 2228664003 | Bacteria | 42398 |
| 20 | HBC_ctgsDRAFT_1064587 | 3300000333 | Bacteria | 879 |
| 21 | JGI24698J34947_10002097 | 3300002449 | Bacteria | 10661 |
| 22 | JGI24698J34947_10048585 | 3300002449 | Bacteria | 2148 |
| 23 | JGI24695J34938_10047171 | 3300002450 | Unclassified | 1903 |
| 24 | Ga0063521_1000213 | 3300003973 | Bacteria | 41439 |
| 25 | Ga0074263_106388 | 3300005485 | Unclassified | 1783 |
| 26 | Ga0074263_110517 | 3300005485 | Bacteria | 1958 |
| 27 | Ga0105005_1292631 | 3300007505 | Bacteria | 1292 |
| 28 | Ga0466711_044045 | 3300042615 | Bacteria | 5020 |
| 29 | Ga0466718_058064 | 3300042617 | Bacteria | 2186 |
| 30 | Ga0466723_002933 | 3300042618 | Bacteria | 27474 |
| 31 | Ga0466723_038098 | 3300042618 | Bacteria | 10693 |
| 32 | Ga0562375_0033 | 3300056856 | Bacteria | 624816 |
| 33 | Ga0160465_100343 | 3300012803 | Bacteria | 27065 |
| 34 | Ga0160464_101291 | 3300012805 | Bacteria | 9577 |
| 35 | Ga0466716_277550 | 3300042605 | Bacteria | 108232 |
| 36 | Ga0466716_368511 | 3300042605 | Bacteria | 2038 |
| 37 | Ga0466720_034181 | 3300042607 | Bacteria | 7208 |
| 38 | Ga0466730_059980 | 3300042625 | Bacteria | 1805 |
| 39 | Ga0466730_060345 | 3300042625 | Bacteria | 1741 |
| 40 | Ga0466708_153505 | 3300042652 | Bacteria | 10382 |
| 41 | DPO_contig03135 | 2032320009 | Unclassified | 1827 |
| 42 | DPOL_contig15137 | 2035918003 | Unclassified | 33949 |
| 43 | IMNBGM34_c001393 | 3300000036 | Bacteria | 4236 |
| 44 | JGI24695J34938_10035349 | 3300002450 | Bacteria | 2285 |
| 45 | Ga0063521_1000037 | 3300003973 | Bacteria | 114288 |
| 46 | Ga0104049_1131405 | 3300007103 | Bacteria | 2572 |
| 47 | Ga0104040_1039770 | 3300007149 | Bacteria | 1908 |
| 48 | Ga0105005_1021267 | 3300007505 | Unclassified | 2790 |
| 49 | Ga0466705_489346 | 3300042612 | Bacteria | 1950 |
| 50 | Ga0466711_150978 | 3300042615 | Bacteria | 1422 |
| 51 | Ga0466711_420752 | 3300042615 | Bacteria | 1557 |
| 52 | Ga0466715_409544 | 3300042616 | Bacteria | 6014 |
| 53 | Ga0123355_10344016 | 3300009826 | Bacteria | 1984 |
| 54 | Ga0160454_100302 | 3300012798 | Bacteria | 39419 |
| 55 | Ga0160470_100736 | 3300012813 | Bacteria | 10355 |
| 56 | Ga0160472_100175 | 3300012839 | Bacteria | 85611 |
| 57 | Ga0160430_111579 | 3300012852 | Bacteria | 1464 |
| 58 | Ga0160435_1000367 | 3300012857 | Bacteria | 17138 |
| 59 | Ga0466692_075675 | 3300042591 | Bacteria | 36211 |
| 60 | Ga0466719_164881 | 3300042606 | Bacteria | 6155 |
| 61 | Ga0466730_019183 | 3300042625 | Bacteria | 2206 |
| 62 | Ga0466704_482701 | 3300042643 | Unclassified | 8898 |
| 63 | Ga0466709_233582 | 3300042648 | Bacteria | 16320 |
| 64 | DPOL_contig01647 | 2035918003 | Bacteria | 26286 |
| 65 | JGI24698J34947_10053859 | 3300002449 | Unclassified | 2012 |
| 66 | Ga0063521_1000256 | 3300003973 | Bacteria | 35335 |
| 67 | Ga0072941_1023915 | 3300005201 | Bacteria | 4652 |
| 68 | Ga0104041_1032147 | 3300007106 | Bacteria | 2522 |
| 69 | Ga0105005_1113773 | 3300007505 | Bacteria | 2364 |
| 70 | Ga0466705_197395 | 3300042612 | Bacteria | 16742 |
| 71 | Ga0160470_100195 | 3300012813 | Unclassified | 52530 |
| 72 | Ga0160456_100104 | 3300012820 | Bacteria | 96363 |
| 73 | Ga0160430_102114 | 3300012852 | Unclassified | 6553 |
| 74 | Ga0160435_1002777 | 3300012857 | Bacteria | 4228 |
| 75 | Ga0456237_0000001 | 3300041968 | Bacteria | 140796 |
| 76 | Ga0466691_033596 | 3300042593 | Bacteria | 32239 |
| 77 | Ga0466691_141485 | 3300042593 | Bacteria | 12282 |
| 78 | Ga0466706_083977 | 3300042599 | Bacteria | 1544 |
| 79 | Ga0466707_030407 | 3300042601 | Bacteria | 4251 |
| 80 | Ga0466707_083259 | 3300042601 | Bacteria | 14502 |
| 81 | Ga0466707_335898 | 3300042601 | Bacteria | 1031 |
| 82 | Ga0466713_002737 | 3300042602 | Bacteria | 71865 |
| 83 | Ga0466720_149447 | 3300042607 | Unclassified | 5208 |
| 84 | Ga0466735_124361 | 3300042624 | Bacteria | 3891 |
| 85 | Ga0466708_216785 | 3300042652 | Bacteria | 2835 |
| 86 | Ga0466708_420035 | 3300042652 | Bacteria | 1900 |
| 87 | DPOL_contig14762 | 2035918003 | Bacteria | 7715 |
| 88 | JGI24695J34938_10034308 | 3300002450 | Bacteria | 2329 |
| 89 | Ga0063521_1000272 | 3300003973 | Unclassified | 33592 |
| 90 | Ga0072940_1003004 | 3300005200 | Bacteria | 7955 |
| 91 | Ga0104147_1014047 | 3300007224 | Bacteria | 11023 |
| 92 | Ga0466715_010531 | 3300042616 | Bacteria | 9756 |
| 93 | Ga0466723_276704 | 3300042618 | Bacteria | 4261 |
| 94 | Ga0160452_100016 | 3300012834 | Bacteria | 299622 |
| 95 | Ga0160452_100672 | 3300012834 | Unclassified | 17486 |
| 96 | Ga0160443_100828 | 3300012848 | Unclassified | 15276 |
| 97 | Ga0160447_104143 | 3300012849 | Bacteria | 4381 |
| 98 | Ga0160448_101271 | 3300012854 | Unclassified | 8212 |
| 99 | Ga0247290_00046 | 3300035364 | Bacteria | 44476 |
| 100 | Ga0466690_180120 | 3300042590 | Bacteria | 47306 |
| 101 | Ga0466690_305696 | 3300042590 | Bacteria | 2388 |
| 102 | Ga0466701_013932 | 3300042598 | Bacteria | 93883 |
| 103 | Ga0466707_065039 | 3300042601 | Bacteria | 48167 |
| 104 | Ga0466707_288168 | 3300042601 | Bacteria | 17797 |
| 105 | Ga0466719_463562 | 3300042606 | Bacteria | 6594 |
| 106 | Ga0466720_009125 | 3300042607 | Bacteria | 5740 |
| 107 | Ga0466735_206628 | 3300042624 | Bacteria | 3517 |
| 108 | Ga0466730_011268 | 3300042625 | Unclassified | 4943 |
| 109 | Ga0466724_02227 | 3300042649 | Unclassified | 2152 |
| 110 | Ga0466724_43634 | 3300042649 | Bacteria | 373148 |
| 111 | JGI24698J34947_10048634 | 3300002449 | Unclassified | 2146 |
| 112 | CVPL010L_1000007 | 3300002932 | Bacteria | 119115 |
| 113 | Ga0105524_100869 | 3300007733 | Bacteria | 15525 |
| 114 | Ga0466712_107757 | 3300042614 | Bacteria | 6151 |
| 115 | Ga0466711_021123 | 3300042615 | Bacteria | 2689 |
| 116 | Ga0466711_077458 | 3300042615 | Bacteria | 15761 |
| 117 | Ga0466711_515715 | 3300042615 | Bacteria | 4280 |
| 118 | Ga0466715_087706 | 3300042616 | Bacteria | 19707 |
| 119 | Ga0466715_155485 | 3300042616 | Bacteria | 10735 |
| 120 | Ga0466715_341934 | 3300042616 | Bacteria | 5568 |
| 121 | Ga0466723_040982 | 3300042618 | Bacteria | 17061 |
| 122 | Ga0466705_078749 | 3300042612 | Bacteria | 8881 |
| 123 | Ga0160442_100006 | 3300012806 | Bacteria | 536179 |
| 124 | Ga0160466_100230 | 3300012809 | Bacteria | 39423 |
| 125 | Ga0160433_119605 | 3300012846 | Unclassified | 804 |
| 126 | Ga0160447_101744 | 3300012849 | Unclassified | 8181 |
| 127 | Ga0160447_103400 | 3300012849 | Unclassified | 5113 |
| 128 | Ga0247290_01381 | 3300035364 | Bacteria | 2804 |
| 129 | Ga0466701_057980 | 3300042598 | Bacteria | 195772 |
| 130 | Ga0466701_099512 | 3300042598 | Bacteria | 1711 |
| 131 | Ga0466707_241224 | 3300042601 | Bacteria | 2971 |
| 132 | Ga0466707_347502 | 3300042601 | Unclassified | 1994 |
| 133 | Ga0466713_059920 | 3300042602 | Bacteria | 35835 |
| 134 | Ga0466722_183265 | 3300042609 | Bacteria | 8625 |
| 135 | Ga0466730_077466 | 3300042625 | Bacteria | 17145 |
| 136 | Ga0466702_124517 | 3300042635 | Bacteria | 1464 |
| 137 | Ga0466704_457337 | 3300042643 | Bacteria | 2539 |
| 138 | Ga0466724_18281 | 3300042649 | Bacteria | 30529 |
| 139 | Ga0466724_24104 | 3300042649 | Bacteria | 1818 |
| 140 | Ga0466708_166514 | 3300042652 | Bacteria | 80304 |
| 141 | Ga0466708_455020 | 3300042652 | Bacteria | 3914 |
| 142 | FGTW_contig27241 | 2065487013 | Unclassified | 2121 |
| 143 | SWWA_contig17086__length_64668___numreads_3845 | 2100351016 | Bacteria | 64668 |
| 144 | AustNasuHG_c1015196 | 3300000089 | Bacteria | 2602 |
| 145 | JGI24698J34947_10001579 | 3300002449 | Bacteria | 12072 |
| 146 | Ga0104041_1002036 | 3300007106 | Bacteria | 2502 |
| 147 | Ga0104042_1120160 | 3300007130 | Bacteria | 2301 |
| 148 | Ga0466712_193648 | 3300042614 | Bacteria | 6066 |
| 149 | Ga0466712_259166 | 3300042614 | Unclassified | 4790 |
| 150 | Ga0466718_015827 | 3300042617 | Bacteria | 1605 |
| 151 | Ga0466728_055190 | 3300042620 | Bacteria | 9140 |
| 152 | Ga0466728_056335 | 3300042620 | Bacteria | 48636 |
| 153 | Ga0160469_100264 | 3300012824 | Unclassified | 38384 |
| 154 | Ga0160431_100240 | 3300012828 | Bacteria | 36566 |
| 155 | Ga0160467_101478 | 3300012829 | Unclassified | 8876 |
| 156 | Ga0160458_100196 | 3300012832 | Unclassified | 45014 |
| 157 | Ga0160472_104704 | 3300012839 | Bacteria | 2340 |
| 158 | Ga0160433_100156 | 3300012846 | Bacteria | 58077 |
| 159 | Ga0160435_1013709 | 3300012857 | Bacteria | 1595 |
| 160 | Ga0264413_106740 | 3300024493 | Unclassified | 7375 |
| 161 | Ga0264413_113467 | 3300024493 | Unclassified | 2354 |
| 162 | Ga0247290_00002 | 3300035364 | Unclassified | 116086 |
| 163 | Ga0466692_103295 | 3300042591 | Bacteria | 27430 |
| 164 | Ga0466691_018700 | 3300042593 | Bacteria | 9585 |
| 165 | Ga0466706_043870 | 3300042599 | Bacteria | 2482 |
| 166 | Ga0466707_402313 | 3300042601 | Bacteria | 1426 |
| 167 | Ga0466713_029436 | 3300042602 | Bacteria | 16661 |
| 168 | Ga0466713_096430 | 3300042602 | Bacteria | 298472 |
| 169 | Ga0466716_095323 | 3300042605 | Bacteria | 13082 |
| 170 | Ga0466729_206798 | 3300042621 | Bacteria | 5249 |
| 171 | Ga0466729_310482 | 3300042621 | Bacteria | 2154 |
| 172 | Ga0466730_025915 | 3300042625 | Bacteria | 79236 |
| 173 | Ga0466730_091386 | 3300042625 | Bacteria | 123631 |
| 174 | Ga0466703_342080 | 3300042636 | Bacteria | 20988 |
| 175 | Ga0466724_13761 | 3300042649 | Bacteria | 395579 |
| 176 | Ga0466724_31651 | 3300042649 | Unclassified | 32519 |
| 177 | DPO_contig00145 | 2032320009 | Bacteria | 115311 |
| 178 | DPOL_contig01145 | 2035918003 | Unclassified | 2507 |
| 179 | SPBB_contig11509 | 2044078006 | Bacteria | 172655 |
| 180 | FGTW_contig24641 | 2065487013 | Unclassified | 4791 |
| 181 | JGI24698J34947_10006685 | 3300002449 | Bacteria | 6333 |
| 182 | CVPL010L_1000080 | 3300002932 | Bacteria | 30099 |
| 183 | CVPL010L_1003977 | 3300002932 | Bacteria | 1630 |
| 184 | Ga0072941_1257890 | 3300005201 | Bacteria | 2878 |
| 185 | Ga0072941_1522697 | 3300005201 | Bacteria | 1609 |
| 186 | Ga0074188_1000757 | 3300005318 | Bacteria | 14370 |
| 187 | Ga0466712_109181 | 3300042614 | Unclassified | 8855 |
| 188 | Ga0466712_240605 | 3300042614 | Unclassified | 2309 |
| 189 | Ga0123355_10194072 | 3300009826 | Bacteria | 2982 |
| 190 | Ga0160442_102700 | 3300012806 | Bacteria | 1919 |
| 191 | Ga0160446_100186 | 3300012835 | Bacteria | 45067 |
| 192 | Ga0160460_100384 | 3300012845 | Unclassified | 29121 |
| 193 | Ga0160433_100630 | 3300012846 | Bacteria | 14305 |
| 194 | Ga0160430_104175 | 3300012852 | Bacteria | 3688 |
| 195 | Ga0160435_1002903 | 3300012857 | Bacteria | 4119 |
| 196 | Ga0160457_1000086 | 3300012858 | Bacteria | 122920 |
| 197 | Ga0160457_1023011 | 3300012858 | Bacteria | 870 |
| 198 | Ga0264413_106741 | 3300024493 | Bacteria | 5101 |
| 199 | Ga0466691_195596 | 3300042593 | Bacteria | 68522 |
| 200 | Ga0466701_040148 | 3300042598 | Bacteria | 33738 |
| 201 | Ga0466707_018711 | 3300042601 | Bacteria | 29522 |
| 202 | Ga0466719_368632 | 3300042606 | Bacteria | 15784 |
| 203 | Ga0466722_246667 | 3300042609 | Bacteria | 23447 |
| 204 | Ga0466729_199519 | 3300042621 | Bacteria | 45461 |
| 205 | Ga0466703_049130 | 3300042636 | Bacteria | 1438 |
| 206 | Ga0466704_495280 | 3300042643 | Bacteria | 3607 |
| 207 | Ga0466709_077811 | 3300042648 | Bacteria | 5480 |
| 208 | Ga0466709_220869 | 3300042648 | Bacteria | 21588 |
| 209 | Ga0466724_22921 | 3300042649 | Unclassified | 8873 |
| 210 | Ga0466708_052368 | 3300042652 | Bacteria | 7951 |
| 211 | SPBB_contig11548 | 2044078006 | Unclassified | 47795 |
| 212 | Meta3P_1000995 | 3300002464 | Unclassified | 7834 |
| 213 | Ga0104051_1102788 | 3300007078 | Unclassified | 1779 |
| 214 | Ga0466715_084752 | 3300042616 | Bacteria | 9171 |
| 215 | Ga0466715_626313 | 3300042616 | Bacteria | 31027 |
| 216 | Ga0466723_033253 | 3300042618 | Bacteria | 4181 |
| 217 | Ga0466728_180368 | 3300042620 | Bacteria | 2526 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 73 | 215 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.