Protein Family IF03395
Metagenome
Metatranscriptome
Isolate
979
Members
513
Samples
572
Scaffolds
86.75
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11418229|Ga0123353_114182292
- Length
- 102 aa
- Sequence
- MIRFDLQLFAHKKGVGSSRNGRDSAAKRLGVKRFGGQLVRAGNILVRQRGTKFHAGNNVGRGHDDTLFATTDGYVEFVTRMGGKKFVNIVPAAVASDSTDE*
Sample Types
Isolate
41.6%
Metagenome
58.3%
MAG
0.0%
Metatranscriptome
0.1%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.5%
Apidae
22.0%
Termitidae
6.9%
Drosophilidae
5.5%
Aphididae
3.8%
Kalotermitidae
3.0%
Formicidae
3.0%
Muscidae
2.8%
Curculionidae
2.0%
Calliphoridae
1.8%
Tenebrionidae
1.8%
Sarcophagidae
1.8%
Anthocoridae
1.6%
Elmidae
1.4%
Culicidae
1.2%
Tephritidae
1.0%
Ixodidae
0.8%
Pediculidae
0.8%
Termopsidae
0.8%
Pteromalidae
0.6%
Talitridae
0.6%
Rhinotermitidae
0.6%
Cerambycidae
0.4%
Passalidae
0.4%
Majidae
0.4%
Palinuridae
0.4%
Pentatomidae
0.4%
Crambidae
0.2%
Pyroglyphidae
0.2%
Aleyrodidae
0.2%
Harpacticidae
0.2%
Pseudococcidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Aphalaridae
0.2%
Aphrophoridae
0.2%
Hodotermitidae
0.2%
Delphacidae
0.2%
Gryllidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Reduviidae
0.2%
Carabidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Hippoboscidae
0.2%
Stratiomyidae
0.2%
Artemiidae
0.2%
Armadillidiidae
0.2%
Taxonomy
Archaea
1
Bacteria
875
Eukaryota
0
Viruses
0
Unclassified
103
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 2 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 3 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 4 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 5 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 6 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 7 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 8 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 9 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 10 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 11 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 12 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 13 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 14 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 15 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 16 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 17 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 18 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 19 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 20 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 21 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 22 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 23 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 24 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 27 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 28 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 29 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 30 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 31 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 32 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 33 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 34 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 35 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 36 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 37 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 38 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 39 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 40 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 41 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 42 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 43 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 44 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 45 | 2820610792 | Unclassified Firmicutes Emb289P1bin33 | Isolate | Unclassified |
| 46 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 47 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 48 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 49 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 50 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 51 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 52 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 53 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 54 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 55 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 56 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 57 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 58 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 59 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 60 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 61 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 62 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 63 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 64 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 65 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 66 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 67 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 68 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 69 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 70 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 71 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 72 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 73 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 74 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 75 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 76 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 77 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 78 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 79 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 80 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 81 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 82 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 83 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 84 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 85 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 86 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 87 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 88 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 89 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 90 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 91 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 92 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 93 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 94 | 2772190787 | Candidatus Riesia pediculicola HHAC | Isolate | Pediculidae |
| 95 | 2772190788 | Candidatus Riesia pediculischaeffi PTSK | Isolate | Pediculidae |
| 96 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 97 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 98 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 99 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 100 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 101 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 102 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 103 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 104 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 105 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 106 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 107 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 108 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 109 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 110 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 111 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 112 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 113 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 114 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 115 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 116 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 117 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 118 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 119 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 120 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 121 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 122 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 123 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 124 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 125 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 126 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 127 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 128 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 129 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 130 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 131 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 132 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 133 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 134 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 135 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 136 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 137 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 138 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 139 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 140 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 141 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 142 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 143 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 144 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 145 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 146 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 147 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 148 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 149 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 150 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 151 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 152 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 153 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 154 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 155 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 156 | 2510065001 | Arsenophonus pediculi ArP | Isolate | Pediculidae |
| 157 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 158 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 159 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 160 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 161 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 162 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 163 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 164 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 165 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 166 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 167 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 168 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 169 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 170 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 171 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 172 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 173 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 174 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 175 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 176 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 177 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 178 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 179 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 180 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 181 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 182 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 183 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 184 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 185 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 186 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 187 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 188 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 189 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 190 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 191 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 192 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 193 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 194 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 195 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 196 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 197 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 198 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 199 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 200 | 3300005311 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut | Metagenome | Drosophilidae |
| 201 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 202 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 203 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 204 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 205 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 206 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 207 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 208 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 209 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 210 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 211 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 212 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 213 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 214 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 215 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 216 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 217 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 218 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 219 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 220 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 221 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 222 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 223 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 224 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 225 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 226 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 227 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 228 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 229 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 230 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 231 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 232 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 233 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 234 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 235 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 236 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 237 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 238 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 239 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 240 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 241 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 242 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 243 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 244 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 245 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 246 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 247 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 248 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 249 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 250 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 251 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 252 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 253 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 254 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 255 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 256 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 257 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 258 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 259 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 260 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 261 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 262 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 263 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 264 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 265 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 266 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 267 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 268 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 269 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 270 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 271 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 272 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 273 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 274 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 275 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 276 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 277 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 278 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 279 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 280 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 281 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 282 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 283 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 284 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 285 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 286 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 287 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 288 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 289 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 290 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 291 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 292 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 293 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 294 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 295 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 296 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 297 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 298 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 299 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 300 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 301 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 302 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 303 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 304 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 305 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 306 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 307 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 308 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 309 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 310 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 311 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 312 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 313 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 314 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 315 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 316 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 317 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 318 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 319 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 320 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 321 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 322 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 323 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 324 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 325 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 326 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 327 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 328 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 329 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 330 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 331 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 332 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 333 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 334 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 335 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 336 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 337 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 338 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 339 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 340 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 341 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 342 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 343 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 344 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 345 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 346 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 347 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 348 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 349 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 350 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 351 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 352 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 353 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 354 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 355 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 356 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 357 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 358 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 359 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 360 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 361 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 362 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 363 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 364 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 365 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 366 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 367 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 368 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 369 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 370 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 371 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 372 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 373 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 374 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 375 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 376 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 377 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 378 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 379 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 380 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 381 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 382 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 383 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 384 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 385 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 386 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 387 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 388 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 389 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 390 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 391 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 392 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 393 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 394 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 395 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 396 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 397 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 398 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 399 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 400 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 401 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 402 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 403 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 404 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 405 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 406 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 407 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 408 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 409 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 410 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 411 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 412 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 413 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 414 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 415 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 416 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 417 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 418 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 419 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 420 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 421 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 422 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 423 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 424 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 425 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 426 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 427 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 428 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 429 | 2773858019 | Candidatus Riesia pediculicola HHBH | Isolate | Pediculidae |
| 430 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 431 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 432 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 433 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 434 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 435 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 436 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 437 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 438 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 439 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 440 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 441 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 442 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 443 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 444 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 445 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 446 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 447 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 448 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 449 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 450 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 451 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 452 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 453 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 454 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 455 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 456 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 457 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 458 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 459 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 460 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 461 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 462 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 463 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 464 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 465 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 466 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 467 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 468 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 469 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 470 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 471 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 472 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 473 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 474 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 475 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 476 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 477 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 478 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 479 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 480 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 481 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 482 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 483 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 484 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 485 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 486 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 487 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 488 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 489 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 490 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 491 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 492 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 493 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 494 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 495 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 496 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 497 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 498 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 499 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 500 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 501 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 502 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 503 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 504 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 505 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 506 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 507 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 508 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 509 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 510 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 511 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 512 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 513 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_129282 | 3300042611 | Bacteria | 1380 |
| 2 | Ga0466733_099636 | 3300042659 | Bacteria | 9472 |
| 3 | Ga0466733_135335 | 3300042659 | Bacteria | 1258 |
| 4 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 5 | Ga0466707_054785 | 3300042601 | Bacteria | 39086 |
| 6 | Ga0466707_103701 | 3300042601 | Bacteria | 3024 |
| 7 | Ga0466707_115189 | 3300042601 | Unclassified | 2370 |
| 8 | Ga0466707_211958 | 3300042601 | Bacteria | 3985 |
| 9 | Ga0466714_019475 | 3300042603 | Unclassified | 1369 |
| 10 | Ga0466719_323537 | 3300042606 | Bacteria | 3700 |
| 11 | Ga0123355_10001537 | 3300009826 | Bacteria | 32201 |
| 12 | Ga0123355_10131603 | 3300009826 | Bacteria | 3854 |
| 13 | Ga0123355_10194705 | 3300009826 | Bacteria | 2976 |
| 14 | Ga0123356_10130051 | 3300010049 | Bacteria | 2465 |
| 15 | Ga0123356_10584771 | 3300010049 | Bacteria | 1280 |
| 16 | Ga0123356_10725833 | 3300010049 | Unclassified | 1163 |
| 17 | Ga0123356_11337705 | 3300010049 | Unclassified | 879 |
| 18 | Ga0123356_11860351 | 3300010049 | Bacteria | 749 |
| 19 | Ga0123356_12286985 | 3300010049 | Bacteria | 676 |
| 20 | Ga0123356_12655580 | 3300010049 | Bacteria | 627 |
| 21 | Ga0123353_10016602 | 3300010167 | Bacteria | 10769 |
| 22 | Ga0123353_10126545 | 3300010167 | Bacteria | 4106 |
| 23 | Ga0123353_10271523 | 3300010167 | Bacteria | 2612 |
| 24 | Ga0123353_10698841 | 3300010167 | Bacteria | 1424 |
| 25 | Ga0123353_10837096 | 3300010167 | Unclassified | 1264 |
| 26 | Ga0123353_11070274 | 3300010167 | Bacteria | 1075 |
| 27 | Ga0123353_12347848 | 3300010167 | Bacteria | 640 |
| 28 | Ga0160433_121991 | 3300012846 | Unclassified | 749 |
| 29 | Ga0466691_121723 | 3300042593 | Bacteria | 16502 |
| 30 | Ga0466696_254567 | 3300042596 | Bacteria | 2842 |
| 31 | Ga0466696_345067 | 3300042596 | Bacteria | 1964 |
| 32 | Ga0466696_441884 | 3300042596 | Bacteria | 8263 |
| 33 | Ga0466701_003768 | 3300042598 | Bacteria | 56043 |
| 34 | Ga0466710_056955 | 3300042613 | Bacteria | 1690 |
| 35 | Ga0466710_171687 | 3300042613 | Bacteria | 15463 |
| 36 | Ga0466711_162161 | 3300042615 | Bacteria | 5891 |
| 37 | Ga0466715_468561 | 3300042616 | Bacteria | 1128 |
| 38 | Ga0466728_235205 | 3300042620 | Bacteria | 130104 |
| 39 | Ga0466728_241397 | 3300042620 | Bacteria | 50193 |
| 40 | Ga0466729_156802 | 3300042621 | Bacteria | 1297 |
| 41 | Ga0466734_048664 | 3300042623 | Bacteria | 17117 |
| 42 | Ga0466735_049884 | 3300042624 | Bacteria | 4135 |
| 43 | Ga0466702_126028 | 3300042635 | Bacteria | 2094 |
| 44 | Ga0466702_166020 | 3300042635 | Bacteria | 6687 |
| 45 | Ga0466703_209317 | 3300042636 | Bacteria | 1090 |
| 46 | Ga0466704_236306 | 3300042643 | Unclassified | 6529 |
| 47 | Ga0466704_406390 | 3300042643 | Unclassified | 1872 |
| 48 | Ga0466708_016944 | 3300042652 | Unclassified | 2440 |
| 49 | Ga0466708_272023 | 3300042652 | Bacteria | 9562 |
| 50 | Ga0466708_423598 | 3300042652 | Bacteria | 3014 |
| 51 | DPOL_contig04235 | 2035918003 | Unclassified | 775 |
| 52 | IMNBL1DRAFT_c0002030 | 3300000062 | Bacteria | 14504 |
| 53 | IMNBL1DRAFT_c0002397 | 3300000062 | Bacteria | 13048 |
| 54 | JGI24695J34938_10031234 | 3300002450 | Bacteria | 2473 |
| 55 | JGI24696J40584_12812404 | 3300002834 | Bacteria | 891 |
| 56 | JGI24696J40584_12875354 | 3300002834 | Bacteria | 1062 |
| 57 | CVPL005L_10000266 | 3300002938 | Bacteria | 84267 |
| 58 | CVPL005L_10012458 | 3300002938 | Bacteria | 6437 |
| 59 | Ga0063521_1058367 | 3300003973 | Bacteria | 794 |
| 60 | Ga0068305_10159350 | 3300005083 | Bacteria | 7516 |
| 61 | Ga0074309_1038775 | 3300005314 | Unclassified | 1382 |
| 62 | Ga0074278_127382 | 3300005721 | Bacteria | 79131 |
| 63 | Ga0104041_1034705 | 3300007106 | Unclassified | 631 |
| 64 | Ga0103260_1005541 | 3300007139 | Bacteria | 1853 |
| 65 | Ga0104147_1146831 | 3300007224 | Unclassified | 998 |
| 66 | Ga0105524_103605 | 3300007733 | Bacteria | 2423 |
| 67 | Ga0123357_10000008 | 3300009784 | Bacteria | 232327 |
| 68 | Ga0466706_146768 | 3300042599 | Bacteria | 4072 |
| 69 | Ga0466700_176784 | 3300042600 | Bacteria | 34366 |
| 70 | Ga0466700_272986 | 3300042600 | Bacteria | 1553 |
| 71 | Ga0466713_100996 | 3300042602 | Bacteria | 7175 |
| 72 | Ga0466714_050161 | 3300042603 | Bacteria | 26685 |
| 73 | Ga0466714_086463 | 3300042603 | Bacteria | 13339 |
| 74 | Ga0466716_005539 | 3300042605 | Bacteria | 1139 |
| 75 | Ga0466697_044547 | 3300042611 | Bacteria | 1000 |
| 76 | Ga0123355_10000722 | 3300009826 | Bacteria | 44823 |
| 77 | Ga0123355_10190379 | 3300009826 | Bacteria | 3023 |
| 78 | Ga0123355_11289687 | 3300009826 | Bacteria | 734 |
| 79 | Ga0123356_10007523 | 3300010049 | Bacteria | 10862 |
| 80 | Ga0123356_10089406 | 3300010049 | Bacteria | 2930 |
| 81 | Ga0123356_10234069 | 3300010049 | Unclassified | 1903 |
| 82 | Ga0123356_10444685 | 3300010049 | Unclassified | 1443 |
| 83 | Ga0123356_10566993 | 3300010049 | Unclassified | 1298 |
| 84 | Ga0123356_12285020 | 3300010049 | Bacteria | 676 |
| 85 | Ga0123356_13177132 | 3300010049 | Bacteria | 572 |
| 86 | Ga0123356_13258056 | 3300010049 | Unclassified | 565 |
| 87 | Ga0123356_13767648 | 3300010049 | Bacteria | 524 |
| 88 | Ga0123353_10054605 | 3300010167 | Bacteria | 6388 |
| 89 | Ga0123353_10070110 | 3300010167 | Bacteria | 5631 |
| 90 | Ga0123353_10159889 | 3300010167 | Unclassified | 3587 |
| 91 | Ga0123353_10384793 | 3300010167 | Unclassified | 2096 |
| 92 | Ga0123353_10505718 | 3300010167 | Bacteria | 1759 |
| 93 | Ga0123353_10817412 | 3300010167 | Unclassified | 1284 |
| 94 | Ga0123353_11565353 | 3300010167 | Unclassified | 835 |
| 95 | Ga0123354_10285883 | 3300010882 | Bacteria | 1591 |
| 96 | Ga0123354_10654073 | 3300010882 | Unclassified | 750 |
| 97 | Ga0123354_11009978 | 3300010882 | Bacteria | 534 |
| 98 | Ga0466657_199187 | 3300042582 | Bacteria | 18046 |
| 99 | Ga0466657_240449 | 3300042582 | Bacteria | 1206 |
| 100 | Ga0466657_270394 | 3300042582 | Bacteria | 24563 |
| 101 | Ga0466690_079047 | 3300042590 | Bacteria | 4392 |
| 102 | Ga0466691_045661 | 3300042593 | Bacteria | 4834 |
| 103 | Ga0466691_077108 | 3300042593 | Bacteria | 65914 |
| 104 | Ga0466694_048720 | 3300042594 | Bacteria | 10236 |
| 105 | Ga0466694_112474 | 3300042594 | Bacteria | 1008 |
| 106 | Ga0466696_209804 | 3300042596 | Bacteria | 2100 |
| 107 | Ga0466696_210788 | 3300042596 | Bacteria | 12826 |
| 108 | Ga0466696_330515 | 3300042596 | Bacteria | 7749 |
| 109 | Ga0466696_481186 | 3300042596 | Bacteria | 1277 |
| 110 | Ga0466711_516667 | 3300042615 | Bacteria | 1280 |
| 111 | Ga0466715_216537 | 3300042616 | Bacteria | 23332 |
| 112 | Ga0466723_191980 | 3300042618 | Bacteria | 13919 |
| 113 | Ga0466723_372186 | 3300042618 | Bacteria | 3691 |
| 114 | Ga0466726_024913 | 3300042619 | Bacteria | 11138 |
| 115 | Ga0466728_087307 | 3300042620 | Bacteria | 1706 |
| 116 | Ga0466728_382473 | 3300042620 | Bacteria | 1375 |
| 117 | Ga0466729_009946 | 3300042621 | Bacteria | 39791 |
| 118 | Ga0466729_301439 | 3300042621 | Unclassified | 2981 |
| 119 | Ga0466731_149726 | 3300042622 | Bacteria | 1503 |
| 120 | Ga0466703_304484 | 3300042636 | Bacteria | 31736 |
| 121 | Ga0466708_089535 | 3300042652 | Bacteria | 39014 |
| 122 | Ga0466708_263611 | 3300042652 | Bacteria | 34129 |
| 123 | Ga0466725_438566 | 3300042654 | Unclassified | 2126 |
| 124 | FGTW_contig33071 | 2065487013 | Unclassified | 1782 |
| 125 | 2227467119 | 2225789004 | Unclassified | 958 |
| 126 | IMNBL1DRAFT_c0076395 | 3300000062 | Bacteria | 950 |
| 127 | JGI24702J35022_10201657 | 3300002462 | Bacteria | 1139 |
| 128 | CVPL005L_10000277 | 3300002938 | Unclassified | 47761 |
| 129 | Ga0068302_10238856 | 3300005071 | Bacteria | 728 |
| 130 | Ga0068305_10209661 | 3300005083 | Unclassified | 810 |
| 131 | Ga0074188_1176778 | 3300005318 | Bacteria | 729 |
| 132 | Ga0074278_139382 | 3300005721 | Bacteria | 116875 |
| 133 | Ga0102736_1005874 | 3300007052 | Unclassified | 1543 |
| 134 | Ga0103266_1009435 | 3300007067 | Unclassified | 1169 |
| 135 | Ga0103261_1004403 | 3300007083 | Unclassified | 2122 |
| 136 | Ga0104049_1131298 | 3300007103 | Unclassified | 2832 |
| 137 | Ga0102738_1050014 | 3300007141 | Bacteria | 658 |
| 138 | Ga0103264_1000012 | 3300007188 | Bacteria | 124297 |
| 139 | Ga0103264_1000347 | 3300007188 | Bacteria | 24731 |
| 140 | Ga0105005_1032809 | 3300007505 | Unclassified | 9839 |
| 141 | Ga0466697_279687 | 3300042611 | Bacteria | 1138 |
| 142 | Ga0466733_109761 | 3300042659 | Bacteria | 9791 |
| 143 | Ga0466733_212413 | 3300042659 | Bacteria | 15415 |
| 144 | Ga0466701_039674 | 3300042598 | Bacteria | 3543 |
| 145 | Ga0466701_049737 | 3300042598 | Unclassified | 1652 |
| 146 | Ga0466706_137570 | 3300042599 | Bacteria | 1321 |
| 147 | Ga0466707_001275 | 3300042601 | Bacteria | 25717 |
| 148 | Ga0466707_092455 | 3300042601 | Bacteria | 1188 |
| 149 | Ga0466713_098236 | 3300042602 | Bacteria | 111747 |
| 150 | Ga0466714_044355 | 3300042603 | Bacteria | 1525 |
| 151 | Ga0466714_053716 | 3300042603 | Unclassified | 1363 |
| 152 | Ga0466719_062547 | 3300042606 | Bacteria | 5586 |
| 153 | Ga0466719_228001 | 3300042606 | Bacteria | 2102 |
| 154 | Ga0466721_169530 | 3300042608 | Bacteria | 1349 |
| 155 | Ga0466722_017406 | 3300042609 | Bacteria | 1070 |
| 156 | Ga0123357_10175947 | 3300009784 | Bacteria | 2516 |
| 157 | Ga0123357_10222047 | 3300009784 | Bacteria | 2094 |
| 158 | Ga0123355_12111466 | 3300009826 | Bacteria | 518 |
| 159 | Ga0123356_10001139 | 3300010049 | Bacteria | 29462 |
| 160 | Ga0123356_10158005 | 3300010049 | Bacteria | 2260 |
| 161 | Ga0123356_10944058 | 3300010049 | Bacteria | 1034 |
| 162 | Ga0123356_11211307 | 3300010049 | Bacteria | 921 |
| 163 | Ga0123356_12014537 | 3300010049 | Bacteria | 720 |
| 164 | Ga0123353_10025552 | 3300010167 | Bacteria | 9000 |
| 165 | Ga0123353_10210196 | 3300010167 | Bacteria | 3053 |
| 166 | Ga0123353_10278497 | 3300010167 | Bacteria | 2571 |
| 167 | Ga0123353_10462549 | 3300010167 | Bacteria | 1863 |
| 168 | Ga0123353_10604834 | 3300010167 | Bacteria | 1566 |
| 169 | Ga0123353_10652269 | 3300010167 | Unclassified | 1490 |
| 170 | Ga0123353_10734150 | 3300010167 | Bacteria | 1378 |
| 171 | Ga0123353_10738040 | 3300010167 | Bacteria | 1373 |
| 172 | Ga0123353_10985174 | 3300010167 | Bacteria | 1135 |
| 173 | Ga0123353_11728672 | 3300010167 | Bacteria | 782 |
| 174 | Ga0123353_12248855 | 3300010167 | Bacteria | 658 |
| 175 | Ga0123353_12456742 | 3300010167 | Unclassified | 621 |
| 176 | Ga0123353_13004673 | 3300010167 | Bacteria | 546 |
| 177 | Ga0123353_13218564 | 3300010167 | Bacteria | 523 |
| 178 | Ga0123354_10090227 | 3300010882 | Bacteria | 4245 |
| 179 | Ga0123354_10133498 | 3300010882 | Bacteria | 3119 |
| 180 | Ga0123354_10393521 | 3300010882 | Unclassified | 1181 |
| 181 | Ga0316159_12497 | 3300030930 | Bacteria | 1939 |
| 182 | Ga0415639_000626 | 3300038395 | Unclassified | 5713 |
| 183 | Ga0466693_058909 | 3300042592 | Unclassified | 2095 |
| 184 | Ga0466691_068049 | 3300042593 | Bacteria | 10988 |
| 185 | Ga0466691_073728 | 3300042593 | Bacteria | 4319 |
| 186 | Ga0466694_055338 | 3300042594 | Bacteria | 3537 |
| 187 | Ga0466710_212577 | 3300042613 | Bacteria | 1055 |
| 188 | Ga0466715_080333 | 3300042616 | Bacteria | 1260 |
| 189 | Ga0466726_152389 | 3300042619 | Bacteria | 44347 |
| 190 | Ga0466726_303270 | 3300042619 | Bacteria | 1038 |
| 191 | Ga0466734_051565 | 3300042623 | Bacteria | 1650 |
| 192 | Ga0466734_079638 | 3300042623 | Bacteria | 1062 |
| 193 | Ga0466703_354313 | 3300042636 | Bacteria | 2056 |
| 194 | Ga0466704_048231 | 3300042643 | Bacteria | 5700 |
| 195 | Ga0466704_282831 | 3300042643 | Unclassified | 10248 |
| 196 | Ga0466724_22329 | 3300042649 | Bacteria | 153198 |
| 197 | Ga0466727_313271 | 3300042655 | Bacteria | 2290 |
| 198 | TM1208_contig81397 | 2021593000 | Bacteria | 531 |
| 199 | 2227358540 | 2225789004 | Bacteria | 138171 |
| 200 | 2227527841 | 2225789004 | Bacteria | 642 |
| 201 | 2227555182 | 2225789004 | Bacteria | 14806 |
| 202 | JGI24702J35022_10001333 | 3300002462 | Bacteria | 15340 |
| 203 | CVPL010L_1000092 | 3300002932 | Bacteria | 28025 |
| 204 | CVPL005W_1001055 | 3300002934 | Bacteria | 8314 |
| 205 | CVPL005W_1001476 | 3300002934 | Unclassified | 6155 |
| 206 | Ga0063521_1000030 | 3300003973 | Bacteria | 121116 |
| 207 | Ga0104051_1108432 | 3300007078 | Unclassified | 909 |
| 208 | Ga0102739_1008208 | 3300007095 | Unclassified | 1376 |
| 209 | Ga0102734_1004779 | 3300007129 | Unclassified | 5682 |
| 210 | Ga0103264_1000097 | 3300007188 | Bacteria | 50420 |
| 211 | Ga0466733_109474 | 3300042659 | Bacteria | 12479 |
| 212 | Ga0562378_0278 | 3300056814 | Bacteria | 112045 |
| 213 | Ga0562377_0094 | 3300056842 | Bacteria | 324522 |
| 214 | Ga0466701_099693 | 3300042598 | Bacteria | 3005 |
| 215 | Ga0466706_039567 | 3300042599 | Unclassified | 1187 |
| 216 | Ga0466706_085280 | 3300042599 | Bacteria | 1682 |
| 217 | Ga0466706_203427 | 3300042599 | Bacteria | 1418 |
| 218 | Ga0466707_211090 | 3300042601 | Bacteria | 5448 |
| 219 | Ga0466714_100292 | 3300042603 | Bacteria | 3174 |
| 220 | Ga0466716_149104 | 3300042605 | Bacteria | 26848 |
| 221 | Ga0466716_460297 | 3300042605 | Bacteria | 1189 |
| 222 | Ga0466719_083308 | 3300042606 | Bacteria | 41647 |
| 223 | Ga0466719_235357 | 3300042606 | Unclassified | 1155 |
| 224 | Ga0466719_289155 | 3300042606 | Bacteria | 13435 |
| 225 | Ga0466719_368940 | 3300042606 | Unclassified | 1176 |
| 226 | Ga0466721_336580 | 3300042608 | Bacteria | 1244 |
| 227 | Ga0466722_084229 | 3300042609 | Bacteria | 96990 |
| 228 | Ga0123355_10003164 | 3300009826 | Bacteria | 23495 |
| 229 | Ga0123355_10003620 | 3300009826 | Bacteria | 22255 |
| 230 | Ga0123355_10010884 | 3300009826 | Bacteria | 13992 |
| 231 | Ga0123355_10013596 | 3300009826 | Bacteria | 12677 |
| 232 | Ga0123355_10129743 | 3300009826 | Bacteria | 3886 |
| 233 | Ga0123355_10140173 | 3300009826 | Bacteria | 3701 |
| 234 | Ga0123355_10478511 | 3300009826 | Unclassified | 1551 |
| 235 | Ga0123355_11757566 | 3300009826 | Unclassified | 587 |
| 236 | Ga0123356_10000097 | 3300010049 | Bacteria | 92344 |
| 237 | Ga0123356_10000459 | 3300010049 | Bacteria | 45589 |
| 238 | Ga0123356_10012429 | 3300010049 | Bacteria | 8262 |
| 239 | Ga0123356_10323992 | 3300010049 | Bacteria | 1655 |
| 240 | Ga0123356_11230702 | 3300010049 | Bacteria | 914 |
| 241 | Ga0123356_11477660 | 3300010049 | Bacteria | 838 |
| 242 | Ga0123353_10027509 | 3300010167 | Bacteria | 8717 |
| 243 | Ga0123353_10053657 | 3300010167 | Bacteria | 6443 |
| 244 | Ga0123353_10208685 | 3300010167 | Bacteria | 3065 |
| 245 | Ga0123353_10357789 | 3300010167 | Bacteria | 2195 |
| 246 | Ga0123353_10472332 | 3300010167 | Bacteria | 1838 |
| 247 | Ga0123353_10709338 | 3300010167 | Bacteria | 1410 |
| 248 | Ga0123353_10901213 | 3300010167 | Unclassified | 1204 |
| 249 | Ga0123353_11133590 | 3300010167 | Bacteria | 1034 |
| 250 | Ga0123353_11418229 | 3300010167 | Bacteria | 891 |
| 251 | Ga0123353_11481271 | 3300010167 | Bacteria | 866 |
| 252 | Ga0123353_11568925 | 3300010167 | Bacteria | 834 |
| 253 | Ga0123354_10000203 | 3300010882 | Bacteria | 51448 |
| 254 | Ga0123354_10004655 | 3300010882 | Bacteria | 19539 |
| 255 | Ga0123354_10688264 | 3300010882 | Unclassified | 718 |
| 256 | Ga0123354_10916628 | 3300010882 | Bacteria | 573 |
| 257 | Ga0415639_011041 | 3300038395 | Unclassified | 1087 |
| 258 | Ga0466690_047622 | 3300042590 | Bacteria | 6014 |
| 259 | Ga0466691_009721 | 3300042593 | Bacteria | 4848 |
| 260 | Ga0466691_053238 | 3300042593 | Bacteria | 1082 |
| 261 | Ga0466691_120840 | 3300042593 | Bacteria | 49335 |
| 262 | Ga0466696_078676 | 3300042596 | Unclassified | 13280 |
| 263 | Ga0466696_319708 | 3300042596 | Bacteria | 6414 |
| 264 | Ga0466711_495151 | 3300042615 | Bacteria | 3064 |
| 265 | Ga0466723_290727 | 3300042618 | Bacteria | 4045 |
| 266 | Ga0466723_291299 | 3300042618 | Bacteria | 1028 |
| 267 | Ga0466723_310391 | 3300042618 | Bacteria | 5585 |
| 268 | Ga0466726_306522 | 3300042619 | Bacteria | 20854 |
| 269 | Ga0466726_447504 | 3300042619 | Bacteria | 2926 |
| 270 | Ga0466703_136593 | 3300042636 | Bacteria | 3418 |
| 271 | Ga0466704_434343 | 3300042643 | Unclassified | 1266 |
| 272 | Ga0466709_103619 | 3300042648 | Bacteria | 9262 |
| 273 | Ga0466709_175061 | 3300042648 | Bacteria | 1808 |
| 274 | Ga0466724_59624 | 3300042649 | Unclassified | 3765 |
| 275 | Ga0466724_67589 | 3300042649 | Unclassified | 1591 |
| 276 | Ga0466725_107518 | 3300042654 | Bacteria | 74412 |
| 277 | Ga0466725_134759 | 3300042654 | Bacteria | 1374 |
| 278 | Ga0466725_226342 | 3300042654 | Unclassified | 1585 |
| 279 | Ga0466727_057024 | 3300042655 | Bacteria | 3748 |
| 280 | Ga0466727_153004 | 3300042655 | Bacteria | 5448 |
| 281 | Ga0466727_245681 | 3300042655 | Bacteria | 65513 |
| 282 | FGTW_contig12359 | 2065487013 | Unclassified | 2840 |
| 283 | 2227109453 | 2225789004 | Bacteria | 1752 |
| 284 | IMNBL1DRAFT_c0122491 | 3300000062 | Bacteria | 682 |
| 285 | IMNBL1DRAFT_c0172526 | 3300000062 | Unclassified | 548 |
| 286 | HBC_ctgsDRAFT_1014609 | 3300000333 | Bacteria | 1898 |
| 287 | SCG598I20_12792 | 3300000473 | Unclassified | 32817 |
| 288 | CVPL010W_10008429 | 3300002931 | Bacteria | 9750 |
| 289 | CVPL010L_1001852 | 3300002932 | Bacteria | 4968 |
| 290 | CVPL005W_1000212 | 3300002934 | Bacteria | 28542 |
| 291 | Ga0068302_10323140 | 3300005071 | Bacteria | 1933 |
| 292 | Ga0072941_1085417 | 3300005201 | Bacteria | 8180 |
| 293 | Ga0074300_1138770 | 3300005311 | Unclassified | 883 |
| 294 | Ga0074278_130411 | 3300005721 | Unclassified | 2728 |
| 295 | Ga0102736_1002784 | 3300007052 | Unclassified | 2680 |
| 296 | Ga0104040_1142595 | 3300007149 | Unclassified | 2580 |
| 297 | Ga0105005_1021963 | 3300007505 | Unclassified | 2990 |
| 298 | Ga0466705_042712 | 3300042612 | Unclassified | 1111 |
| 299 | Ga0466705_085512 | 3300042612 | Bacteria | 2014 |
| 300 | Ga0466705_130689 | 3300042612 | Bacteria | 2621 |
| 301 | Ga0466701_066461 | 3300042598 | Bacteria | 8537 |
| 302 | Ga0466706_063873 | 3300042599 | Bacteria | 4504 |
| 303 | Ga0466700_060882 | 3300042600 | Bacteria | 2363 |
| 304 | Ga0466717_216942 | 3300042604 | Bacteria | 3242 |
| 305 | Ga0466716_379093 | 3300042605 | Bacteria | 1917 |
| 306 | Ga0466719_486037 | 3300042606 | Unclassified | 1104 |
| 307 | Ga0466721_029376 | 3300042608 | Unclassified | 1307 |
| 308 | Ga0466721_169463 | 3300042608 | Unclassified | 1164 |
| 309 | Ga0466697_030985 | 3300042611 | Bacteria | 3299 |
| 310 | Ga0123355_10000151 | 3300009826 | Bacteria | 83578 |
| 311 | Ga0123355_10328812 | 3300009826 | Bacteria | 2051 |
| 312 | Ga0123355_10526690 | 3300009826 | Bacteria | 1443 |
| 313 | Ga0123355_10792385 | 3300009826 | Unclassified | 1059 |
| 314 | Ga0123356_10000196 | 3300010049 | Bacteria | 69725 |
| 315 | Ga0123356_10014533 | 3300010049 | Bacteria | 7566 |
| 316 | Ga0123356_10015249 | 3300010049 | Bacteria | 7369 |
| 317 | Ga0123356_10040149 | 3300010049 | Bacteria | 4360 |
| 318 | Ga0123356_10092051 | 3300010049 | Bacteria | 2891 |
| 319 | Ga0123356_11115572 | 3300010049 | Bacteria | 957 |
| 320 | Ga0123356_11429226 | 3300010049 | Bacteria | 851 |
| 321 | Ga0123356_11435481 | 3300010049 | Bacteria | 850 |
| 322 | Ga0123356_12150999 | 3300010049 | Bacteria | 697 |
| 323 | Ga0123356_12790230 | 3300010049 | Bacteria | 611 |
| 324 | Ga0123356_13152518 | 3300010049 | Bacteria | 574 |
| 325 | Ga0123356_13657622 | 3300010049 | Bacteria | 532 |
| 326 | Ga0123353_10009556 | 3300010167 | Bacteria | 13407 |
| 327 | Ga0123353_10037800 | 3300010167 | Bacteria | 7577 |
| 328 | Ga0123353_10077765 | 3300010167 | Bacteria | 5332 |
| 329 | Ga0123353_10159079 | 3300010167 | Bacteria | 3598 |
| 330 | Ga0123353_10227275 | 3300010167 | Unclassified | 2913 |
| 331 | Ga0123353_10400140 | 3300010167 | Bacteria | 2044 |
| 332 | Ga0123353_11007891 | 3300010167 | Bacteria | 1118 |
| 333 | Ga0123353_11293156 | 3300010167 | Bacteria | 948 |
| 334 | Ga0123353_11504102 | 3300010167 | Unclassified | 857 |
| 335 | Ga0123353_11806527 | 3300010167 | Unclassified | 759 |
| 336 | Ga0123353_12173726 | 3300010167 | Bacteria | 672 |
| 337 | Ga0123354_10119197 | 3300010882 | Bacteria | 3420 |
| 338 | Ga0160472_100117 | 3300012839 | Bacteria | 125418 |
| 339 | Ga0415639_106696 | 3300038395 | Bacteria | 3724 |
| 340 | Ga0466690_099990 | 3300042590 | Bacteria | 35118 |
| 341 | Ga0466705_457598 | 3300042612 | Bacteria | 1474 |
| 342 | Ga0466711_273872 | 3300042615 | Bacteria | 28686 |
| 343 | Ga0466711_407845 | 3300042615 | Bacteria | 2995 |
| 344 | Ga0466715_197550 | 3300042616 | Bacteria | 1459 |
| 345 | Ga0466715_499368 | 3300042616 | Bacteria | 3988 |
| 346 | Ga0466723_176625 | 3300042618 | Bacteria | 7740 |
| 347 | Ga0466726_068228 | 3300042619 | Bacteria | 3107 |
| 348 | Ga0466728_261143 | 3300042620 | Bacteria | 1734 |
| 349 | Ga0466729_175750 | 3300042621 | Bacteria | 3155 |
| 350 | Ga0466734_087603 | 3300042623 | Bacteria | 2571 |
| 351 | Ga0466735_173446 | 3300042624 | Bacteria | 4564 |
| 352 | Ga0466704_024288 | 3300042643 | Bacteria | 1169 |
| 353 | Ga0466704_385448 | 3300042643 | Bacteria | 3078 |
| 354 | Ga0466709_368443 | 3300042648 | Archaea | 18332 |
| 355 | Ga0466724_33212 | 3300042649 | Bacteria | 11170 |
| 356 | Ga0466725_343458 | 3300042654 | Bacteria | 20718 |
| 357 | DPOL_contig07949 | 2035918003 | Unclassified | 15145 |
| 358 | gam1t_NODE_665810_length=2728_GC=35_9_Contigs=1 | 2189573031 | Unclassified | 2728 |
| 359 | 2227533591 | 2225789004 | Bacteria | 625 |
| 360 | IMNBL1DRAFT_c0000886 | 3300000062 | Bacteria | 23284 |
| 361 | IMNBL1DRAFT_c0133756 | 3300000062 | Bacteria | 644 |
| 362 | JGI24698J34947_10003153 | 3300002449 | Unclassified | 8920 |
| 363 | JGI24695J34938_10473010 | 3300002450 | Bacteria | 569 |
| 364 | JGI24702J35022_10024381 | 3300002462 | Bacteria | 3269 |
| 365 | JGI24705J35276_12202055 | 3300002504 | Bacteria | 1630 |
| 366 | JGI24705J35276_12227622 | 3300002504 | Unclassified | 3034 |
| 367 | Ga0063521_1095360 | 3300003973 | Unclassified | 539 |
| 368 | Ga0072940_1423253 | 3300005200 | Bacteria | 1180 |
| 369 | Ga0103266_1007649 | 3300007067 | Bacteria | 1323 |
| 370 | Ga0104045_1008587 | 3300007085 | Unclassified | 761 |
| 371 | Ga0104049_1024947 | 3300007103 | Unclassified | 1624 |
| 372 | Ga0102734_1001623 | 3300007129 | Bacteria | 8142 |
| 373 | Ga0104048_1170113 | 3300007143 | Bacteria | 1763 |
| 374 | Ga0103264_1001271 | 3300007188 | Bacteria | 17688 |
| 375 | Ga0103264_1005657 | 3300007188 | Bacteria | 5941 |
| 376 | Ga0466705_219904 | 3300042612 | Bacteria | 2424 |
| 377 | Ga0466732_072148 | 3300042656 | Bacteria | 1985 |
| 378 | Ga0466732_147610 | 3300042656 | Bacteria | 6241 |
| 379 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 380 | Ga0466706_249272 | 3300042599 | Bacteria | 21997 |
| 381 | Ga0466707_229507 | 3300042601 | Bacteria | 1110 |
| 382 | Ga0466714_123543 | 3300042603 | Bacteria | 10492 |
| 383 | Ga0466717_102506 | 3300042604 | Bacteria | 1355 |
| 384 | Ga0466716_109782 | 3300042605 | Bacteria | 6390 |
| 385 | Ga0466721_154073 | 3300042608 | Bacteria | 6906 |
| 386 | Ga0466722_020305 | 3300042609 | Unclassified | 5722 |
| 387 | Ga0123357_10107129 | 3300009784 | Bacteria | 3580 |
| 388 | Ga0123357_10797603 | 3300009784 | Unclassified | 640 |
| 389 | Ga0123355_10025006 | 3300009826 | Bacteria | 9610 |
| 390 | Ga0123355_10521539 | 3300009826 | Bacteria | 1453 |
| 391 | Ga0123356_10020729 | 3300010049 | Bacteria | 6216 |
| 392 | Ga0123356_10082886 | 3300010049 | Bacteria | 3037 |
| 393 | Ga0123356_10394639 | 3300010049 | Bacteria | 1520 |
| 394 | Ga0123356_10479257 | 3300010049 | Unclassified | 1397 |
| 395 | Ga0123356_10623270 | 3300010049 | Bacteria | 1245 |
| 396 | Ga0123356_11126117 | 3300010049 | Bacteria | 953 |
| 397 | Ga0123356_11167389 | 3300010049 | Bacteria | 937 |
| 398 | Ga0123356_11253193 | 3300010049 | Bacteria | 906 |
| 399 | Ga0123356_11538092 | 3300010049 | Bacteria | 822 |
| 400 | Ga0123356_13065198 | 3300010049 | Bacteria | 583 |
| 401 | Ga0123356_13163881 | 3300010049 | Bacteria | 573 |
| 402 | Ga0123353_10000220 | 3300010167 | Bacteria | 72262 |
| 403 | Ga0123353_10030953 | 3300010167 | Bacteria | 8279 |
| 404 | Ga0123353_10064658 | 3300010167 | Bacteria | 5871 |
| 405 | Ga0123353_10155056 | 3300010167 | Bacteria | 3653 |
| 406 | Ga0123353_10280791 | 3300010167 | Bacteria | 2558 |
| 407 | Ga0123353_10409391 | 3300010167 | Bacteria | 2014 |
| 408 | Ga0123353_10641163 | 3300010167 | Unclassified | 1506 |
| 409 | Ga0123353_12067578 | 3300010167 | Bacteria | 695 |
| 410 | Ga0123353_12090269 | 3300010167 | Bacteria | 690 |
| 411 | Ga0123353_12102760 | 3300010167 | Bacteria | 687 |
| 412 | Ga0123353_13388107 | 3300010167 | Bacteria | 506 |
| 413 | Ga0222431_1024045 | 3300021190 | Bacteria | 501 |
| 414 | Ga0466693_013271 | 3300042592 | Bacteria | 2697 |
| 415 | Ga0466711_308987 | 3300042615 | Bacteria | 1767 |
| 416 | Ga0466711_387001 | 3300042615 | Bacteria | 1689 |
| 417 | Ga0466726_182324 | 3300042619 | Unclassified | 2056 |
| 418 | Ga0466729_135173 | 3300042621 | Bacteria | 102359 |
| 419 | Ga0466704_259288 | 3300042643 | Bacteria | 18562 |
| 420 | Ga0466709_222441 | 3300042648 | Bacteria | 7249 |
| 421 | Ga0466708_283620 | 3300042652 | Bacteria | 13773 |
| 422 | Ga0466708_322735 | 3300042652 | Bacteria | 3548 |
| 423 | Ga0466725_097685 | 3300042654 | Bacteria | 42888 |
| 424 | Ga0466725_210379 | 3300042654 | Bacteria | 3858 |
| 425 | Ga0466727_133220 | 3300042655 | Unclassified | 6465 |
| 426 | gam1t_NODE_592656_length=116795_GC=34_8_Contigs=9 | 2189573031 | Bacteria | 116875 |
| 427 | gam1t_NODE_620935_length=79101_GC=34_1_Contigs=4 | 2189573031 | Bacteria | 79131 |
| 428 | JGI24702J35022_10000910 | 3300002462 | Bacteria | 18423 |
| 429 | Ga0063521_1000014 | 3300003973 | Bacteria | 163473 |
| 430 | Ga0103266_1000087 | 3300007067 | Bacteria | 63864 |
| 431 | Ga0103260_1010584 | 3300007139 | Unclassified | 1280 |
| 432 | Ga0103268_1000962 | 3300007192 | Bacteria | 8200 |
| 433 | Ga0127656_100083 | 3300009453 | Bacteria | 72717 |
| 434 | Ga0127655_1006029 | 3300009459 | Bacteria | 40196 |
| 435 | Ga0466705_182584 | 3300042612 | Bacteria | 7071 |
| 436 | Ga0466706_102355 | 3300042599 | Bacteria | 28097 |
| 437 | Ga0466707_267402 | 3300042601 | Bacteria | 6063 |
| 438 | Ga0466707_313151 | 3300042601 | Bacteria | 1562 |
| 439 | Ga0466716_119412 | 3300042605 | Bacteria | 6115 |
| 440 | Ga0466719_141118 | 3300042606 | Bacteria | 2497 |
| 441 | Ga0466719_190511 | 3300042606 | Bacteria | 2433 |
| 442 | Ga0466719_192446 | 3300042606 | Bacteria | 6623 |
| 443 | Ga0123357_10210817 | 3300009784 | Bacteria | 2183 |
| 444 | Ga0123357_10281144 | 3300009784 | Bacteria | 1719 |
| 445 | Ga0123357_10311508 | 3300009784 | Bacteria | 1571 |
| 446 | Ga0123355_10007312 | 3300009826 | Bacteria | 16529 |
| 447 | Ga0123356_10214835 | 3300010049 | Bacteria | 1975 |
| 448 | Ga0123356_10781813 | 3300010049 | Bacteria | 1125 |
| 449 | Ga0123356_10871372 | 3300010049 | Unclassified | 1072 |
| 450 | Ga0123356_11115787 | 3300010049 | Bacteria | 957 |
| 451 | Ga0123356_11219163 | 3300010049 | Bacteria | 918 |
| 452 | Ga0123356_12310338 | 3300010049 | Unclassified | 673 |
| 453 | Ga0123356_12497891 | 3300010049 | Bacteria | 647 |
| 454 | Ga0123356_13799529 | 3300010049 | Bacteria | 521 |
| 455 | Ga0123356_14067970 | 3300010049 | Bacteria | 503 |
| 456 | Ga0123353_10001331 | 3300010167 | Bacteria | 30253 |
| 457 | Ga0123353_10117552 | 3300010167 | Bacteria | 4277 |
| 458 | Ga0123353_10217112 | 3300010167 | Bacteria | 2994 |
| 459 | Ga0123353_10264988 | 3300010167 | Bacteria | 2651 |
| 460 | Ga0123353_10368189 | 3300010167 | Bacteria | 2156 |
| 461 | Ga0123353_10408517 | 3300010167 | Bacteria | 2017 |
| 462 | Ga0123353_11081771 | 3300010167 | Bacteria | 1067 |
| 463 | Ga0123353_11576974 | 3300010167 | Bacteria | 831 |
| 464 | Ga0123354_10497440 | 3300010882 | Bacteria | 953 |
| 465 | Ga0160432_107894 | 3300012818 | Bacteria | 884 |
| 466 | Ga0415639_113884 | 3300038395 | Bacteria | 9978 |
| 467 | Ga0466657_098387 | 3300042582 | Bacteria | 38819 |
| 468 | Ga0466690_004830 | 3300042590 | Unclassified | 3592 |
| 469 | Ga0466691_004010 | 3300042593 | Bacteria | 1679 |
| 470 | Ga0466691_085838 | 3300042593 | Bacteria | 37198 |
| 471 | Ga0466691_092288 | 3300042593 | Bacteria | 1423 |
| 472 | Ga0466695_033608 | 3300042595 | Bacteria | 3609 |
| 473 | Ga0466696_477510 | 3300042596 | Bacteria | 2323 |
| 474 | Ga0466712_078954 | 3300042614 | Bacteria | 40645 |
| 475 | Ga0466715_408147 | 3300042616 | Bacteria | 7593 |
| 476 | Ga0466715_568454 | 3300042616 | Bacteria | 2265 |
| 477 | Ga0466723_098905 | 3300042618 | Bacteria | 1710 |
| 478 | Ga0466723_117898 | 3300042618 | Bacteria | 6368 |
| 479 | Ga0466726_326192 | 3300042619 | Bacteria | 3892 |
| 480 | Ga0466726_439254 | 3300042619 | Bacteria | 3063 |
| 481 | Ga0466728_029704 | 3300042620 | Bacteria | 32782 |
| 482 | Ga0466729_243715 | 3300042621 | Bacteria | 6629 |
| 483 | Ga0466731_218346 | 3300042622 | Bacteria | 1307 |
| 484 | Ga0466702_105324 | 3300042635 | Bacteria | 1450 |
| 485 | Ga0466703_061584 | 3300042636 | Bacteria | 16796 |
| 486 | Ga0466703_105301 | 3300042636 | Unclassified | 1090 |
| 487 | Ga0466703_244569 | 3300042636 | Unclassified | 9643 |
| 488 | Ga0466703_256207 | 3300042636 | Bacteria | 4923 |
| 489 | Ga0466704_187468 | 3300042643 | Bacteria | 3309 |
| 490 | Ga0466704_244451 | 3300042643 | Bacteria | 33541 |
| 491 | Ga0466708_046495 | 3300042652 | Bacteria | 3249 |
| 492 | Ga0466725_002560 | 3300042654 | Bacteria | 2541 |
| 493 | JGI24695J34938_10051899 | 3300002450 | Bacteria | 1791 |
| 494 | CVPL010L_1000259 | 3300002932 | Bacteria | 21876 |
| 495 | Ga0074311_1181044 | 3300005317 | Unclassified | 593 |
| 496 | Ga0102736_1021270 | 3300007052 | Bacteria | 750 |
| 497 | Ga0104041_1139829 | 3300007106 | Unclassified | 570 |
| 498 | Ga0103264_1000147 | 3300007188 | Bacteria | 40931 |
| 499 | Ga0127651_100078 | 3300009483 | Bacteria | 210306 |
| 500 | Ga0123357_10002027 | 3300009784 | Bacteria | 22203 |
| 501 | Ga0466705_019811 | 3300042612 | Bacteria | 1272 |
| 502 | Ga0466705_048055 | 3300042612 | Bacteria | 23845 |
| 503 | Ga0466705_079416 | 3300042612 | Bacteria | 1162 |
| 504 | Ga0466707_230067 | 3300042601 | Bacteria | 1315 |
| 505 | Ga0466707_297146 | 3300042601 | Bacteria | 1079 |
| 506 | Ga0466707_370931 | 3300042601 | Bacteria | 3969 |
| 507 | Ga0466714_117443 | 3300042603 | Bacteria | 1028 |
| 508 | Ga0466717_205653 | 3300042604 | Bacteria | 1546 |
| 509 | Ga0466719_302075 | 3300042606 | Bacteria | 69558 |
| 510 | Ga0466721_050037 | 3300042608 | Bacteria | 25875 |
| 511 | Ga0466721_393620 | 3300042608 | Bacteria | 48776 |
| 512 | Ga0123357_10005576 | 3300009784 | Bacteria | 15115 |
| 513 | Ga0123357_10359340 | 3300009784 | Bacteria | 1381 |
| 514 | Ga0123357_10911863 | 3300009784 | Bacteria | 565 |
| 515 | Ga0123355_10905449 | 3300009826 | Bacteria | 957 |
| 516 | Ga0123356_10064945 | 3300010049 | Unclassified | 3414 |
| 517 | Ga0123356_10123665 | 3300010049 | Unclassified | 2522 |
| 518 | Ga0123356_12320957 | 3300010049 | Unclassified | 671 |
| 519 | Ga0123356_13069990 | 3300010049 | Bacteria | 582 |
| 520 | Ga0123353_10140005 | 3300010167 | Unclassified | 3876 |
| 521 | Ga0123353_10188343 | 3300010167 | Bacteria | 3260 |
| 522 | Ga0123353_10242104 | 3300010167 | Bacteria | 2802 |
| 523 | Ga0123353_10373304 | 3300010167 | Bacteria | 2137 |
| 524 | Ga0123353_10986324 | 3300010167 | Bacteria | 1134 |
| 525 | Ga0123353_11052634 | 3300010167 | Bacteria | 1087 |
| 526 | Ga0123353_11077726 | 3300010167 | Bacteria | 1070 |
| 527 | Ga0123353_11086553 | 3300010167 | Bacteria | 1064 |
| 528 | Ga0123353_11574157 | 3300010167 | Bacteria | 832 |
| 529 | Ga0123353_11648147 | 3300010167 | Bacteria | 807 |
| 530 | Ga0123353_11952600 | 3300010167 | Bacteria | 721 |
| 531 | Ga0123353_12119565 | 3300010167 | Bacteria | 684 |
| 532 | Ga0123353_12375472 | 3300010167 | Bacteria | 635 |
| 533 | Ga0123353_12414856 | 3300010167 | Bacteria | 628 |
| 534 | Ga0316159_10003 | 3300030930 | Bacteria | 422460 |
| 535 | Ga0316159_11780 | 3300030930 | Bacteria | 2574 |
| 536 | Ga0415639_026547 | 3300038395 | Bacteria | 29287 |
| 537 | Ga0466657_327901 | 3300042582 | Unclassified | 1670 |
| 538 | Ga0466690_260624 | 3300042590 | Bacteria | 14197 |
| 539 | Ga0466692_049838 | 3300042591 | Bacteria | 185020 |
| 540 | Ga0466692_114115 | 3300042591 | Bacteria | 7697 |
| 541 | Ga0466693_069630 | 3300042592 | Bacteria | 1113 |
| 542 | Ga0466693_199106 | 3300042592 | Bacteria | 1116 |
| 543 | Ga0466693_275556 | 3300042592 | Bacteria | 1884 |
| 544 | Ga0466705_445977 | 3300042612 | Bacteria | 1392 |
| 545 | Ga0466710_234973 | 3300042613 | Bacteria | 10476 |
| 546 | Ga0466711_505782 | 3300042615 | Bacteria | 1806 |
| 547 | Ga0466726_495217 | 3300042619 | Bacteria | 1423 |
| 548 | Ga0466728_317736 | 3300042620 | Unclassified | 2147 |
| 549 | Ga0466734_101095 | 3300042623 | Bacteria | 8823 |
| 550 | Ga0466735_058222 | 3300042624 | Bacteria | 3279 |
| 551 | Ga0466730_101634 | 3300042625 | Bacteria | 33409 |
| 552 | Ga0466703_219338 | 3300042636 | Bacteria | 3640 |
| 553 | Ga0466703_417924 | 3300042636 | Bacteria | 8247 |
| 554 | Ga0466704_033641 | 3300042643 | Bacteria | 15411 |
| 555 | Ga0466704_080523 | 3300042643 | Bacteria | 1461 |
| 556 | Ga0466704_180724 | 3300042643 | Bacteria | 6212 |
| 557 | Ga0466725_044638 | 3300042654 | Bacteria | 5430 |
| 558 | Ga0466727_346721 | 3300042655 | Bacteria | 2176 |
| 559 | 2227495155 | 2225789004 | Unclassified | 769 |
| 560 | IMNBL1DRAFT_c0012451 | 3300000062 | Bacteria | 3886 |
| 561 | IMNBL1DRAFT_c0036251 | 3300000062 | Bacteria | 1725 |
| 562 | JGI24702J35022_10020461 | 3300002462 | Bacteria | 3592 |
| 563 | JGI24702J35022_10045968 | 3300002462 | Bacteria | 2326 |
| 564 | JGI24702J35022_10057853 | 3300002462 | Bacteria | 2070 |
| 565 | CVPL010W_10001413 | 3300002931 | Bacteria | 28130 |
| 566 | Ga0063521_1000018 | 3300003973 | Bacteria | 141059 |
| 567 | Ga0068302_10087959 | 3300005071 | Bacteria | 1682 |
| 568 | Ga0102734_1001978 | 3300007129 | Unclassified | 23481 |
| 569 | Ga0103264_1000432 | 3300007188 | Bacteria | 21676 |
| 570 | Ga0103264_1001573 | 3300007188 | Bacteria | 10086 |
| 571 | Ga0103264_1002048 | 3300007188 | Bacteria | 9001 |
| 572 | Ga0127645_120171 | 3300009461 | Bacteria | 4403 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01016 | Ribosomal_L27 | Ribosomal L27 protein | 10 | 89 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.