Protein Family IF02757
Metagenome
Metatranscriptome
Isolate
490
Members
179
Samples
385
Scaffolds
417.16
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10048833|Ga0123356_100488333
- Length
- 468 aa
- Sequence
- MPTSSRENGKSAGMRADVGIRPSEKSERGLNMDYNAIKERAEFYKADMTKFLRDMIRFPGESCGEKEKVQCAANEMRELGFDKVEIDGMGNLLGYMGSGKTLIAFDGHIDTVGIGNRDNWSFDPYEGYENDEEIGGRGVSDQEGGIVSAVYGAKIMKDLGLLNDKYTALVTATVQEEDCDGLCWQYIINESGIRPEFVVINEPTDGGIYRGQRGRMEIRVDVKGVSCHGSAPERGDNAIYKMADILQNVRDLNENGAGDDMEIKGLVKMLDEGFNPQWKEARFLGRGTITTSEIFFTSPSRCAVADSCSVSLDRRMTAGETWESCLDEIRALPAVRKYGDDVTVSMYEYDRASYTGCVYPIECYFPTWVIPEDHPVTRAMEETYRAMYGDSRIGPAETLEMRKARPLTDKWTFSTNGVSIMGRNGIPCIGFGPGAEAQAHAPDEKTWKQDLVTCAAVFAALPSVYTL*
Sample Types
Isolate
21.4%
Metagenome
78.4%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.4%
Termitidae
20.3%
Blattidae
9.3%
Kalotermitidae
8.1%
Tenebrionidae
5.8%
Rhinotermitidae
2.3%
Termopsidae
2.3%
Elmidae
2.3%
Curculionidae
2.3%
Calliphoridae
2.3%
Culicidae
1.7%
Drosophilidae
1.7%
Formicidae
1.7%
Scarabaeidae
1.2%
Cerambycidae
1.2%
Passalidae
1.2%
Daphniidae
0.6%
Hodotermitidae
0.6%
Majidae
0.6%
Gomphidae
0.6%
Libellulidae
0.6%
Rhopalidae
0.6%
Carabidae
0.6%
Crambidae
0.6%
Taxonomy
Archaea
0
Bacteria
470
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 3 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 4 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 5 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 6 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 7 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 8 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 9 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 17 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 18 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 24 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 25 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 26 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 27 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 28 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 29 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 30 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 31 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 32 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 33 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 34 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 35 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 36 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 40 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 41 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 42 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 43 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 54 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 57 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 58 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 59 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 60 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 61 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 62 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 63 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 64 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 65 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 66 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 67 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 68 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 69 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 70 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 71 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 72 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 73 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 74 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 75 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 76 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 77 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 78 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 81 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 82 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 83 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 84 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 85 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 86 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 87 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 88 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 89 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 90 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 91 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 92 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 93 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 94 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 95 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 96 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 97 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 98 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 99 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 100 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 101 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 102 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 103 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 104 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 105 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 106 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 107 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 108 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 109 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 110 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 111 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 112 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 113 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 114 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 115 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 116 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 117 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 118 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 119 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 120 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 121 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 122 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 123 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 124 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 125 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 126 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 127 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 128 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 129 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 130 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 131 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 132 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 133 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 134 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 135 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 136 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 137 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 138 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 139 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 140 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 141 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 142 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 143 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 144 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 145 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 146 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 147 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 148 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 149 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 150 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 151 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 152 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 153 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 154 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 155 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 156 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 157 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 158 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 159 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 160 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 161 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 162 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 163 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 164 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 165 | 2820127165 | Unclassified Proteobacteria Emb289P3bin90 | Isolate | Unclassified |
| 166 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 167 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 168 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 169 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 170 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 171 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 172 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 173 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 174 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 175 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 176 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 177 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 178 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 179 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_306364 | 3300042612 | Bacteria | 36565 |
| 2 | Ga0466732_047624 | 3300042656 | Bacteria | 2006 |
| 3 | Ga0562378_0004 | 3300056814 | Bacteria | 2423881 |
| 4 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 5 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 6 | Ga0123357_10211723 | 3300009784 | Bacteria | 2175 |
| 7 | Ga0123355_10000257 | 3300009826 | Bacteria | 68144 |
| 8 | Ga0123356_10013335 | 3300010049 | Unclassified | 7938 |
| 9 | Ga0123356_10014041 | 3300010049 | Bacteria | 7706 |
| 10 | Ga0123356_10014688 | 3300010049 | Unclassified | 7526 |
| 11 | Ga0123356_10024625 | 3300010049 | Unclassified | 5661 |
| 12 | Ga0123356_10032111 | 3300010049 | Unclassified | 4914 |
| 13 | Ga0123356_10487406 | 3300010049 | Unclassified | 1387 |
| 14 | Ga0123353_10000993 | 3300010167 | Bacteria | 34793 |
| 15 | Ga0123353_10059992 | 3300010167 | Bacteria | 6102 |
| 16 | Ga0123353_10220361 | 3300010167 | Bacteria | 2967 |
| 17 | Ga0123353_10291801 | 3300010167 | Bacteria | 2496 |
| 18 | Ga0123353_10324989 | 3300010167 | Bacteria | 2332 |
| 19 | Ga0123353_10562880 | 3300010167 | Bacteria | 1640 |
| 20 | Ga0466712_243120 | 3300042614 | Bacteria | 4717 |
| 21 | Ga0466711_041452 | 3300042615 | Bacteria | 22315 |
| 22 | Ga0466715_321699 | 3300042616 | Bacteria | 15126 |
| 23 | Ga0466715_425711 | 3300042616 | Bacteria | 13975 |
| 24 | Ga0466723_098557 | 3300042618 | Bacteria | 10946 |
| 25 | Ga0466723_276999 | 3300042618 | Bacteria | 14136 |
| 26 | Ga0466726_009190 | 3300042619 | Bacteria | 4043 |
| 27 | Ga0466728_016181 | 3300042620 | Bacteria | 3112 |
| 28 | Ga0466735_101764 | 3300042624 | Bacteria | 14847 |
| 29 | Ga0466727_043840 | 3300042655 | Bacteria | 2520 |
| 30 | Ga0466727_328569 | 3300042655 | Bacteria | 1687 |
| 31 | Ga0466700_414886 | 3300042600 | Bacteria | 2732 |
| 32 | Ga0466707_181125 | 3300042601 | Bacteria | 1795 |
| 33 | Ga0466707_216670 | 3300042601 | Bacteria | 16342 |
| 34 | Ga0466719_071422 | 3300042606 | Bacteria | 16178 |
| 35 | Ga0466720_220014 | 3300042607 | Unclassified | 4388 |
| 36 | Ga0466721_182483 | 3300042608 | Bacteria | 15383 |
| 37 | IMNBL1DRAFT_c0000126 | 3300000062 | Bacteria | 67951 |
| 38 | Meta3P_1000074 | 3300002464 | Bacteria | 143082 |
| 39 | Ga0074263_102065 | 3300005485 | Unclassified | 2553 |
| 40 | Ga0415639_007307 | 3300038395 | Bacteria | 24477 |
| 41 | Ga0466692_067310 | 3300042591 | Bacteria | 26519 |
| 42 | Ga0466691_084267 | 3300042593 | Bacteria | 51837 |
| 43 | Ga0466699_100855 | 3300042597 | Bacteria | 53915 |
| 44 | Ga0466705_084452 | 3300042612 | Bacteria | 9931 |
| 45 | Ga0123356_10008791 | 3300010049 | Bacteria | 10005 |
| 46 | Ga0123356_10016564 | 3300010049 | Bacteria | 7028 |
| 47 | Ga0123356_10033989 | 3300010049 | Bacteria | 4769 |
| 48 | Ga0123356_10051157 | 3300010049 | Bacteria | 3844 |
| 49 | Ga0123356_10055330 | 3300010049 | Bacteria | 3695 |
| 50 | Ga0123356_10398011 | 3300010049 | Unclassified | 1514 |
| 51 | Ga0123353_10000060 | 3300010167 | Bacteria | 123051 |
| 52 | Ga0123353_10050913 | 3300010167 | Bacteria | 6608 |
| 53 | Ga0123353_10074659 | 3300010167 | Bacteria | 5450 |
| 54 | Ga0123353_10106281 | 3300010167 | Bacteria | 4523 |
| 55 | Ga0123353_10196345 | 3300010167 | Bacteria | 3180 |
| 56 | Ga0123353_10201131 | 3300010167 | Bacteria | 3134 |
| 57 | Ga0466705_511119 | 3300042612 | Bacteria | 2536 |
| 58 | Ga0466712_202481 | 3300042614 | Bacteria | 11457 |
| 59 | Ga0466715_015317 | 3300042616 | Bacteria | 22295 |
| 60 | Ga0466718_065722 | 3300042617 | Bacteria | 7521 |
| 61 | Ga0466718_104542 | 3300042617 | Bacteria | 1897 |
| 62 | Ga0466723_044662 | 3300042618 | Bacteria | 11917 |
| 63 | Ga0466723_046844 | 3300042618 | Bacteria | 8500 |
| 64 | Ga0466723_083332 | 3300042618 | Bacteria | 36106 |
| 65 | Ga0466726_192771 | 3300042619 | Bacteria | 8644 |
| 66 | Ga0466730_001298 | 3300042625 | Unclassified | 2547 |
| 67 | Ga0466703_107032 | 3300042636 | Bacteria | 15162 |
| 68 | Ga0466703_144575 | 3300042636 | Bacteria | 13240 |
| 69 | Ga0466703_256991 | 3300042636 | Bacteria | 11991 |
| 70 | Ga0466703_346438 | 3300042636 | Bacteria | 4766 |
| 71 | Ga0466727_086844 | 3300042655 | Bacteria | 1900 |
| 72 | Ga0466706_044920 | 3300042599 | Bacteria | 3186 |
| 73 | Ga0466706_073026 | 3300042599 | Bacteria | 6020 |
| 74 | Ga0466707_161143 | 3300042601 | Bacteria | 9650 |
| 75 | Ga0466707_211307 | 3300042601 | Bacteria | 4873 |
| 76 | Ga0466707_308956 | 3300042601 | Bacteria | 3544 |
| 77 | Ga0466707_394001 | 3300042601 | Bacteria | 82516 |
| 78 | Ga0466713_046844 | 3300042602 | Bacteria | 16847 |
| 79 | Ga0466720_237597 | 3300042607 | Bacteria | 17433 |
| 80 | Ga0466721_193736 | 3300042608 | Bacteria | 14853 |
| 81 | Ga0466722_085339 | 3300042609 | Bacteria | 6567 |
| 82 | Ga0466722_110050 | 3300042609 | Bacteria | 4529 |
| 83 | FGTW_contig19728 | 2065487013 | Unclassified | 2831 |
| 84 | IMNBL1DRAFT_c0006640 | 3300000062 | Bacteria | 6273 |
| 85 | JGI24695J34938_10004247 | 3300002450 | Bacteria | 9499 |
| 86 | JGI24702J35022_10044144 | 3300002462 | Bacteria | 2375 |
| 87 | Ga0068302_10061155 | 3300005071 | Bacteria | 11286 |
| 88 | Ga0466690_001879 | 3300042590 | Bacteria | 12243 |
| 89 | Ga0466692_061322 | 3300042591 | Bacteria | 7292 |
| 90 | Ga0466696_220988 | 3300042596 | Bacteria | 4750 |
| 91 | Ga0466696_495075 | 3300042596 | Bacteria | 10604 |
| 92 | Ga0466699_351348 | 3300042597 | Bacteria | 43572 |
| 93 | Ga0466705_071877 | 3300042612 | Bacteria | 11450 |
| 94 | Ga0466705_319466 | 3300042612 | Bacteria | 27771 |
| 95 | Ga0466733_002338 | 3300042659 | Bacteria | 3410 |
| 96 | Ga0530661_000083 | 3300056564 | Bacteria | 88780 |
| 97 | Ga0123355_10001087 | 3300009826 | Bacteria | 37556 |
| 98 | Ga0123355_10020937 | 3300009826 | Bacteria | 10458 |
| 99 | Ga0123355_10036605 | 3300009826 | Bacteria | 7980 |
| 100 | Ga0123356_10024991 | 3300010049 | Bacteria | 5614 |
| 101 | Ga0123356_10026003 | 3300010049 | Bacteria | 5502 |
| 102 | Ga0123356_10067383 | 3300010049 | Bacteria | 3353 |
| 103 | Ga0123353_10025342 | 3300010167 | Bacteria | 9036 |
| 104 | Ga0123353_10074771 | 3300010167 | Bacteria | 5446 |
| 105 | Ga0123353_10081218 | 3300010167 | Bacteria | 5212 |
| 106 | Ga0123354_10090766 | 3300010882 | Bacteria | 4226 |
| 107 | Ga0123354_10145790 | 3300010882 | Bacteria | 2898 |
| 108 | Ga0123354_10240780 | 3300010882 | Bacteria | 1862 |
| 109 | Ga0466705_390677 | 3300042612 | Bacteria | 17603 |
| 110 | Ga0466712_133430 | 3300042614 | Bacteria | 3245 |
| 111 | Ga0466711_142529 | 3300042615 | Bacteria | 13819 |
| 112 | Ga0466711_292807 | 3300042615 | Bacteria | 53803 |
| 113 | Ga0466715_007413 | 3300042616 | Bacteria | 11476 |
| 114 | Ga0466723_076754 | 3300042618 | Bacteria | 3312 |
| 115 | Ga0466728_483235 | 3300042620 | Bacteria | 1861 |
| 116 | Ga0466731_219874 | 3300042622 | Bacteria | 1675 |
| 117 | Ga0466734_085972 | 3300042623 | Bacteria | 2298 |
| 118 | Ga0466730_012943 | 3300042625 | Bacteria | 28329 |
| 119 | Ga0466703_347870 | 3300042636 | Bacteria | 29013 |
| 120 | Ga0466703_378294 | 3300042636 | Bacteria | 5666 |
| 121 | Ga0466709_073930 | 3300042648 | Bacteria | 28320 |
| 122 | Ga0466709_176024 | 3300042648 | Bacteria | 10068 |
| 123 | Ga0466709_395631 | 3300042648 | Unclassified | 2149 |
| 124 | Ga0466708_030628 | 3300042652 | Bacteria | 94331 |
| 125 | Ga0466708_082037 | 3300042652 | Bacteria | 2694 |
| 126 | Ga0466708_286290 | 3300042652 | Bacteria | 17301 |
| 127 | Ga0466708_324603 | 3300042652 | Bacteria | 3387 |
| 128 | Ga0466717_153256 | 3300042604 | Bacteria | 2491 |
| 129 | Ga0466716_038886 | 3300042605 | Bacteria | 11962 |
| 130 | Ga0466716_047931 | 3300042605 | Bacteria | 9484 |
| 131 | Ga0466716_276450 | 3300042605 | Bacteria | 14400 |
| 132 | Ga0466719_328459 | 3300042606 | Bacteria | 19533 |
| 133 | Ga0466720_109497 | 3300042607 | Bacteria | 28074 |
| 134 | Ga0466720_238454 | 3300042607 | Bacteria | 11025 |
| 135 | Ga0466722_032592 | 3300042609 | Bacteria | 1422 |
| 136 | IMNBL1DRAFT_c0002223 | 3300000062 | Bacteria | 13688 |
| 137 | AustNasuHG_c1021247 | 3300000089 | Bacteria | 2103 |
| 138 | JGI24698J34947_10000603 | 3300002449 | Bacteria | 17214 |
| 139 | JGI24695J34938_10000214 | 3300002450 | Bacteria | 55263 |
| 140 | JGI24702J35022_10004031 | 3300002462 | Bacteria | 8790 |
| 141 | Ga0068302_10107494 | 3300005071 | Bacteria | 13161 |
| 142 | Ga0466690_210148 | 3300042590 | Unclassified | 5022 |
| 143 | Ga0466691_045640 | 3300042593 | Bacteria | 12384 |
| 144 | Ga0466694_300610 | 3300042594 | Bacteria | 9816 |
| 145 | Ga0123357_10128931 | 3300009784 | Bacteria | 3157 |
| 146 | Ga0123357_10300056 | 3300009784 | Bacteria | 1624 |
| 147 | Ga0123355_10048402 | 3300009826 | Bacteria | 6912 |
| 148 | Ga0123355_10066359 | 3300009826 | Bacteria | 5809 |
| 149 | Ga0123356_10000315 | 3300010049 | Bacteria | 55642 |
| 150 | Ga0123356_10005638 | 3300010049 | Bacteria | 12725 |
| 151 | Ga0123356_10015561 | 3300010049 | Bacteria | 7286 |
| 152 | Ga0123356_10027550 | 3300010049 | Bacteria | 5323 |
| 153 | Ga0123353_10079507 | 3300010167 | Bacteria | 5271 |
| 154 | Ga0123353_10090322 | 3300010167 | Bacteria | 4932 |
| 155 | Ga0123353_10136283 | 3300010167 | Bacteria | 3937 |
| 156 | Ga0466705_423163 | 3300042612 | Bacteria | 2658 |
| 157 | Ga0466712_021806 | 3300042614 | Bacteria | 7507 |
| 158 | Ga0466715_017605 | 3300042616 | Bacteria | 24965 |
| 159 | Ga0466715_200796 | 3300042616 | Bacteria | 18864 |
| 160 | Ga0466715_315068 | 3300042616 | Bacteria | 9210 |
| 161 | Ga0466718_129233 | 3300042617 | Bacteria | 1577 |
| 162 | Ga0466723_066018 | 3300042618 | Bacteria | 34484 |
| 163 | Ga0466728_264461 | 3300042620 | Bacteria | 17134 |
| 164 | Ga0466729_068727 | 3300042621 | Bacteria | 27754 |
| 165 | Ga0466734_025184 | 3300042623 | Bacteria | 1504 |
| 166 | Ga0466704_216772 | 3300042643 | Bacteria | 8050 |
| 167 | Ga0466708_075252 | 3300042652 | Bacteria | 11056 |
| 168 | Ga0466708_185355 | 3300042652 | Bacteria | 4159 |
| 169 | Ga0466725_265918 | 3300042654 | Unclassified | 3867 |
| 170 | Ga0466701_023727 | 3300042598 | Bacteria | 2907 |
| 171 | Ga0466706_221283 | 3300042599 | Bacteria | 43471 |
| 172 | Ga0466700_327085 | 3300042600 | Bacteria | 2352 |
| 173 | Ga0466707_147501 | 3300042601 | Bacteria | 5506 |
| 174 | Ga0466707_355068 | 3300042601 | Bacteria | 5005 |
| 175 | Ga0466716_117168 | 3300042605 | Bacteria | 2880 |
| 176 | Ga0466719_349713 | 3300042606 | Bacteria | 2493 |
| 177 | JGI24695J34938_10020898 | 3300002450 | Bacteria | 3215 |
| 178 | CVPL010L_1000347 | 3300002932 | Unclassified | 11130 |
| 179 | Ga0068305_10004343 | 3300005083 | Bacteria | 60005 |
| 180 | Ga0456237_0001867 | 3300041968 | Bacteria | 3389 |
| 181 | Ga0466690_054725 | 3300042590 | Bacteria | 11542 |
| 182 | Ga0466690_127432 | 3300042590 | Bacteria | 5605 |
| 183 | Ga0466691_039301 | 3300042593 | Bacteria | 4127 |
| 184 | Ga0466705_115725 | 3300042612 | Bacteria | 2913 |
| 185 | Ga0466705_158657 | 3300042612 | Bacteria | 22070 |
| 186 | Ga0466732_032746 | 3300042656 | Bacteria | 10831 |
| 187 | Ga0466732_044947 | 3300042656 | Bacteria | 11962 |
| 188 | Ga0466733_110289 | 3300042659 | Bacteria | 10822 |
| 189 | Ga0562374_3173 | 3300057007 | Bacteria | 10363 |
| 190 | Ga0123355_10003640 | 3300009826 | Bacteria | 22195 |
| 191 | Ga0123355_10368093 | 3300009826 | Bacteria | 1886 |
| 192 | Ga0123356_10000327 | 3300010049 | Bacteria | 54770 |
| 193 | Ga0123356_10007487 | 3300010049 | Bacteria | 10892 |
| 194 | Ga0123356_10032462 | 3300010049 | Bacteria | 4885 |
| 195 | Ga0123356_10048445 | 3300010049 | Unclassified | 3955 |
| 196 | Ga0123356_10048833 | 3300010049 | Bacteria | 3938 |
| 197 | Ga0123353_10023455 | 3300010167 | Bacteria | 9344 |
| 198 | Ga0123353_10132848 | 3300010167 | Bacteria | 3993 |
| 199 | Ga0123353_10206906 | 3300010167 | Bacteria | 3081 |
| 200 | Ga0123353_10232651 | 3300010167 | Bacteria | 2872 |
| 201 | Ga0466712_031862 | 3300042614 | Bacteria | 21250 |
| 202 | Ga0466712_121290 | 3300042614 | Bacteria | 5703 |
| 203 | Ga0466712_209958 | 3300042614 | Unclassified | 1952 |
| 204 | Ga0466711_227789 | 3300042615 | Bacteria | 3635 |
| 205 | Ga0466715_232305 | 3300042616 | Bacteria | 41363 |
| 206 | Ga0466718_010931 | 3300042617 | Bacteria | 3114 |
| 207 | Ga0466723_146954 | 3300042618 | Bacteria | 7229 |
| 208 | Ga0466723_217966 | 3300042618 | Bacteria | 58279 |
| 209 | Ga0466726_033088 | 3300042619 | Bacteria | 9096 |
| 210 | Ga0466726_206020 | 3300042619 | Unclassified | 1845 |
| 211 | Ga0466735_077021 | 3300042624 | Bacteria | 16013 |
| 212 | Ga0466704_412790 | 3300042643 | Bacteria | 12972 |
| 213 | Ga0466724_09236 | 3300042649 | Bacteria | 58900 |
| 214 | Ga0466708_429070 | 3300042652 | Bacteria | 14209 |
| 215 | Ga0466725_098813 | 3300042654 | Bacteria | 13798 |
| 216 | Ga0466727_142144 | 3300042655 | Bacteria | 3847 |
| 217 | Ga0466707_013427 | 3300042601 | Bacteria | 33006 |
| 218 | Ga0466713_117968 | 3300042602 | Bacteria | 408806 |
| 219 | Ga0466697_015447 | 3300042611 | Bacteria | 3169 |
| 220 | AustNasuHG_c1000361 | 3300000089 | Bacteria | 15790 |
| 221 | JGI24698J34947_10000833 | 3300002449 | Bacteria | 15450 |
| 222 | Ga0063521_1000037 | 3300003973 | Bacteria | 114288 |
| 223 | Ga0222431_1003140 | 3300021190 | Bacteria | 3666 |
| 224 | Ga0466690_267711 | 3300042590 | Bacteria | 22966 |
| 225 | Ga0466692_082134 | 3300042591 | Bacteria | 50975 |
| 226 | Ga0466692_083742 | 3300042591 | Bacteria | 3618 |
| 227 | Ga0466691_078361 | 3300042593 | Bacteria | 10352 |
| 228 | Ga0466694_305180 | 3300042594 | Bacteria | 2508 |
| 229 | Ga0466695_006492 | 3300042595 | Bacteria | 22629 |
| 230 | Ga0466696_063751 | 3300042596 | Bacteria | 4102 |
| 231 | Ga0466696_392907 | 3300042596 | Bacteria | 5190 |
| 232 | Ga0466699_035399 | 3300042597 | Bacteria | 4709 |
| 233 | Ga0466705_199486 | 3300042612 | Bacteria | 19717 |
| 234 | Ga0562379_1200 | 3300056790 | Unclassified | 32272 |
| 235 | Ga0123357_10081259 | 3300009784 | Bacteria | 4260 |
| 236 | Ga0123355_10115496 | 3300009826 | Bacteria | 4180 |
| 237 | Ga0123355_10125805 | 3300009826 | Bacteria | 3961 |
| 238 | Ga0123356_10001540 | 3300010049 | Bacteria | 25396 |
| 239 | Ga0123356_10048796 | 3300010049 | Unclassified | 3940 |
| 240 | Ga0123356_10051175 | 3300010049 | Bacteria | 3843 |
| 241 | Ga0123356_10140916 | 3300010049 | Bacteria | 2378 |
| 242 | Ga0123353_10042654 | 3300010167 | Bacteria | 7178 |
| 243 | Ga0123353_10056145 | 3300010167 | Bacteria | 6302 |
| 244 | Ga0123353_10110691 | 3300010167 | Bacteria | 4425 |
| 245 | Ga0123353_10238226 | 3300010167 | Bacteria | 2830 |
| 246 | Ga0123353_10271763 | 3300010167 | Bacteria | 2611 |
| 247 | Ga0123353_10462953 | 3300010167 | Bacteria | 1862 |
| 248 | Ga0466712_284256 | 3300042614 | Bacteria | 29285 |
| 249 | Ga0466711_065549 | 3300042615 | Bacteria | 11726 |
| 250 | Ga0466715_006741 | 3300042616 | Bacteria | 1920 |
| 251 | Ga0466715_295318 | 3300042616 | Bacteria | 45887 |
| 252 | Ga0466726_239069 | 3300042619 | Bacteria | 26158 |
| 253 | Ga0466728_437758 | 3300042620 | Bacteria | 2249 |
| 254 | Ga0466731_217085 | 3300042622 | Bacteria | 2777 |
| 255 | Ga0466730_026878 | 3300042625 | Bacteria | 5362 |
| 256 | Ga0466703_318616 | 3300042636 | Bacteria | 7273 |
| 257 | Ga0466704_191460 | 3300042643 | Bacteria | 34072 |
| 258 | Ga0466704_260979 | 3300042643 | Unclassified | 1576 |
| 259 | Ga0466709_417087 | 3300042648 | Bacteria | 251481 |
| 260 | Ga0466708_239524 | 3300042652 | Bacteria | 10962 |
| 261 | Ga0466727_144457 | 3300042655 | Bacteria | 22290 |
| 262 | Ga0466727_294921 | 3300042655 | Bacteria | 3915 |
| 263 | Ga0466706_155809 | 3300042599 | Bacteria | 1659 |
| 264 | Ga0466713_026715 | 3300042602 | Bacteria | 43279 |
| 265 | Ga0466721_071324 | 3300042608 | Bacteria | 2778 |
| 266 | Ga0466722_165737 | 3300042609 | Bacteria | 3060 |
| 267 | FGTW_contig30941 | 2065487013 | Bacteria | 7564 |
| 268 | JGI24698J34947_10000076 | 3300002449 | Bacteria | 31759 |
| 269 | JGI24698J34947_10002790 | 3300002449 | Bacteria | 9460 |
| 270 | JGI24705J35276_12233693 | 3300002504 | Bacteria | 4998 |
| 271 | Ga0068305_10137218 | 3300005083 | Bacteria | 11443 |
| 272 | Ga0072941_1384366 | 3300005201 | Bacteria | 2324 |
| 273 | Ga0105005_1032146 | 3300007505 | Bacteria | 11340 |
| 274 | Ga0456237_0001736 | 3300041968 | Bacteria | 3500 |
| 275 | Ga0466691_005104 | 3300042593 | Bacteria | 30173 |
| 276 | Ga0466694_055152 | 3300042594 | Bacteria | 6714 |
| 277 | Ga0466695_290439 | 3300042595 | Bacteria | 2502 |
| 278 | Ga0466705_318699 | 3300042612 | Bacteria | 2290 |
| 279 | Ga0562378_0015 | 3300056814 | Bacteria | 945537 |
| 280 | Ga0562375_0599 | 3300056856 | Bacteria | 69479 |
| 281 | Ga0123356_10000009 | 3300010049 | Bacteria | 226788 |
| 282 | Ga0123356_10000795 | 3300010049 | Bacteria | 35033 |
| 283 | Ga0123356_10013734 | 3300010049 | Bacteria | 7801 |
| 284 | Ga0123356_10034225 | 3300010049 | Bacteria | 4749 |
| 285 | Ga0123356_10098007 | 3300010049 | Bacteria | 2806 |
| 286 | Ga0123356_10152895 | 3300010049 | Bacteria | 2294 |
| 287 | Ga0123356_10173212 | 3300010049 | Bacteria | 2171 |
| 288 | Ga0123353_10000333 | 3300010167 | Bacteria | 58025 |
| 289 | Ga0123353_10024230 | 3300010167 | Bacteria | 9208 |
| 290 | Ga0123353_10121260 | 3300010167 | Bacteria | 4205 |
| 291 | Ga0123353_10169621 | 3300010167 | Bacteria | 3465 |
| 292 | Ga0123354_10292888 | 3300010882 | Bacteria | 1556 |
| 293 | Ga0466711_278247 | 3300042615 | Bacteria | 26787 |
| 294 | Ga0466715_336717 | 3300042616 | Bacteria | 38913 |
| 295 | Ga0466723_143810 | 3300042618 | Bacteria | 5358 |
| 296 | Ga0466726_064629 | 3300042619 | Bacteria | 6230 |
| 297 | Ga0466726_081058 | 3300042619 | Bacteria | 1912 |
| 298 | Ga0466728_175048 | 3300042620 | Bacteria | 2346 |
| 299 | Ga0466728_295349 | 3300042620 | Bacteria | 10583 |
| 300 | Ga0466729_241071 | 3300042621 | Bacteria | 2722 |
| 301 | Ga0466729_285981 | 3300042621 | Bacteria | 6923 |
| 302 | Ga0466735_081068 | 3300042624 | Bacteria | 11120 |
| 303 | Ga0466703_202346 | 3300042636 | Bacteria | 12582 |
| 304 | Ga0466704_041700 | 3300042643 | Bacteria | 7822 |
| 305 | Ga0466709_121014 | 3300042648 | Bacteria | 15642 |
| 306 | Ga0466727_037338 | 3300042655 | Bacteria | 3864 |
| 307 | Ga0466727_205589 | 3300042655 | Bacteria | 2708 |
| 308 | Ga0466706_056044 | 3300042599 | Bacteria | 4624 |
| 309 | Ga0466706_195522 | 3300042599 | Bacteria | 3067 |
| 310 | Ga0466700_191190 | 3300042600 | Bacteria | 2605 |
| 311 | Ga0466716_453866 | 3300042605 | Bacteria | 3751 |
| 312 | Ga0466720_018543 | 3300042607 | Bacteria | 131979 |
| 313 | Ga0466720_048851 | 3300042607 | Bacteria | 10538 |
| 314 | Ga0466722_252221 | 3300042609 | Bacteria | 10821 |
| 315 | JGI24698J34947_10010880 | 3300002449 | Bacteria | 4992 |
| 316 | JGI24702J35022_10003211 | 3300002462 | Bacteria | 9885 |
| 317 | JGI24702J35022_10010578 | 3300002462 | Bacteria | 5153 |
| 318 | Ga0316159_10013 | 3300030930 | Bacteria | 70725 |
| 319 | Ga0466690_432229 | 3300042590 | Bacteria | 2871 |
| 320 | Ga0466692_106684 | 3300042591 | Bacteria | 24510 |
| 321 | Ga0466693_093613 | 3300042592 | Bacteria | 2202 |
| 322 | Ga0466691_166400 | 3300042593 | Bacteria | 8278 |
| 323 | Ga0466699_049399 | 3300042597 | Bacteria | 8607 |
| 324 | Ga0466705_012448 | 3300042612 | Bacteria | 8538 |
| 325 | Ga0466705_024381 | 3300042612 | Bacteria | 2174 |
| 326 | Ga0466705_038371 | 3300042612 | Bacteria | 11510 |
| 327 | Ga0466705_240460 | 3300042612 | Bacteria | 4982 |
| 328 | Ga0466732_451241 | 3300042656 | Bacteria | 10070 |
| 329 | Ga0466733_211629 | 3300042659 | Bacteria | 17312 |
| 330 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 331 | Ga0562377_0538 | 3300056842 | Bacteria | 59511 |
| 332 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 333 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 334 | Ga0123355_10000067 | 3300009826 | Bacteria | 112202 |
| 335 | Ga0123355_10040624 | 3300009826 | Bacteria | 7573 |
| 336 | Ga0123355_10304493 | 3300009826 | Bacteria | 2168 |
| 337 | Ga0123356_10014318 | 3300010049 | Bacteria | 7631 |
| 338 | Ga0123356_10019518 | 3300010049 | Bacteria | 6425 |
| 339 | Ga0123356_10023361 | 3300010049 | Bacteria | 5820 |
| 340 | Ga0123356_10031458 | 3300010049 | Bacteria | 4966 |
| 341 | Ga0123356_10061951 | 3300010049 | Bacteria | 3494 |
| 342 | Ga0123356_10252722 | 3300010049 | Bacteria | 1841 |
| 343 | Ga0123353_10019366 | 3300010167 | Bacteria | 10108 |
| 344 | Ga0123353_10110030 | 3300010167 | Bacteria | 4439 |
| 345 | Ga0123353_10130027 | 3300010167 | Bacteria | 4042 |
| 346 | Ga0123353_10172513 | 3300010167 | Bacteria | 3432 |
| 347 | Ga0123353_10190817 | 3300010167 | Bacteria | 3234 |
| 348 | Ga0123354_10236570 | 3300010882 | Bacteria | 1892 |
| 349 | Ga0466712_075804 | 3300042614 | Bacteria | 38150 |
| 350 | Ga0466711_263012 | 3300042615 | Bacteria | 32756 |
| 351 | Ga0466711_286731 | 3300042615 | Bacteria | 3914 |
| 352 | Ga0466723_161126 | 3300042618 | Bacteria | 21003 |
| 353 | Ga0466728_024058 | 3300042620 | Bacteria | 8474 |
| 354 | Ga0466728_053105 | 3300042620 | Bacteria | 22958 |
| 355 | Ga0466730_035900 | 3300042625 | Bacteria | 55377 |
| 356 | Ga0466709_418230 | 3300042648 | Bacteria | 8336 |
| 357 | Ga0466708_083359 | 3300042652 | Bacteria | 8550 |
| 358 | Ga0466706_149107 | 3300042599 | Bacteria | 2447 |
| 359 | Ga0466706_245126 | 3300042599 | Bacteria | 1411 |
| 360 | Ga0466707_076357 | 3300042601 | Bacteria | 224161 |
| 361 | Ga0466717_158360 | 3300042604 | Bacteria | 1658 |
| 362 | Ga0466716_112270 | 3300042605 | Bacteria | 2428 |
| 363 | Ga0466719_212359 | 3300042606 | Bacteria | 15889 |
| 364 | Ga0466720_033684 | 3300042607 | Bacteria | 17925 |
| 365 | Ga0466722_179461 | 3300042609 | Bacteria | 6943 |
| 366 | 2227535732 | 2225789004 | Bacteria | 57093 |
| 367 | IMNBL1DRAFT_c0013504 | 3300000062 | Bacteria | 3657 |
| 368 | AustNasuHG_c1007387 | 3300000089 | Bacteria | 3912 |
| 369 | JGI24698J34947_10000106 | 3300002449 | Bacteria | 28864 |
| 370 | JGI24698J34947_10005000 | 3300002449 | Bacteria | 7266 |
| 371 | JGI24695J34938_10000106 | 3300002450 | Bacteria | 73679 |
| 372 | JGI24695J34938_10021509 | 3300002450 | Bacteria | 3153 |
| 373 | JGI24705J35276_12230487 | 3300002504 | Bacteria | 3642 |
| 374 | JGI24700J35501_10930847 | 3300002508 | Bacteria | 27907 |
| 375 | Ga0063521_1000048 | 3300003973 | Bacteria | 106555 |
| 376 | Ga0104049_1131118 | 3300007103 | Bacteria | 4605 |
| 377 | Ga0466690_029738 | 3300042590 | Bacteria | 11880 |
| 378 | Ga0466690_044243 | 3300042590 | Bacteria | 5291 |
| 379 | Ga0466690_069614 | 3300042590 | Bacteria | 3788 |
| 380 | Ga0466692_105323 | 3300042591 | Bacteria | 2271 |
| 381 | Ga0466691_209904 | 3300042593 | Bacteria | 5979 |
| 382 | Ga0466696_103856 | 3300042596 | Bacteria | 1564 |
| 383 | Ga0466696_198725 | 3300042596 | Bacteria | 16131 |
| 384 | Ga0466699_113295 | 3300042597 | Bacteria | 2645 |
| 385 | Ga0466699_217232 | 3300042597 | Bacteria | 6637 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01546 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.