Protein Family IF02757

Metagenome Metatranscriptome Isolate
490 Members
179 Samples
385 Scaffolds
417.16 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10048833|Ga0123356_100488333
Length
468 aa
Sequence
MPTSSRENGKSAGMRADVGIRPSEKSERGLNMDYNAIKERAEFYKADMTKFLRDMIRFPGESCGEKEKVQCAANEMRELGFDKVEIDGMGNLLGYMGSGKTLIAFDGHIDTVGIGNRDNWSFDPYEGYENDEEIGGRGVSDQEGGIVSAVYGAKIMKDLGLLNDKYTALVTATVQEEDCDGLCWQYIINESGIRPEFVVINEPTDGGIYRGQRGRMEIRVDVKGVSCHGSAPERGDNAIYKMADILQNVRDLNENGAGDDMEIKGLVKMLDEGFNPQWKEARFLGRGTITTSEIFFTSPSRCAVADSCSVSLDRRMTAGETWESCLDEIRALPAVRKYGDDVTVSMYEYDRASYTGCVYPIECYFPTWVIPEDHPVTRAMEETYRAMYGDSRIGPAETLEMRKARPLTDKWTFSTNGVSIMGRNGIPCIGFGPGAEAQAHAPDEKTWKQDLVTCAAVFAALPSVYTL*

πŸ“Š Sample Types

Isolate 21.4%
Metagenome 78.4%
MAG 0.0%
Metatranscriptome 0.2%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 31.4%
Termitidae 20.3%
Blattidae 9.3%
Kalotermitidae 8.1%
Tenebrionidae 5.8%
Rhinotermitidae 2.3%
Termopsidae 2.3%
Elmidae 2.3%
Curculionidae 2.3%
Calliphoridae 2.3%
Culicidae 1.7%
Drosophilidae 1.7%
Formicidae 1.7%
Scarabaeidae 1.2%
Cerambycidae 1.2%
Passalidae 1.2%
Daphniidae 0.6%
Hodotermitidae 0.6%
Majidae 0.6%
Gomphidae 0.6%
Libellulidae 0.6%
Rhopalidae 0.6%
Carabidae 0.6%
Crambidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 470
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
2 2590828840 Clostridium sp. 2 Isolate Termitidae
3 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
4 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
5 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
6 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
7 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
8 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
9 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 8007237282 Enterococcus sp. DIV0212c Isolate
17 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
18 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
19 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
24 2574179716 Serratia sp. DD3 Isolate Daphniidae
25 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
26 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
27 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
28 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
29 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
30 2864768727 Aeromonas veronii S00020 Isolate Elmidae
31 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
32 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
33 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
34 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
35 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
36 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
39 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
40 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
41 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
42 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
43 8100176769 Kosakonia sp. S57 Isolate Curculionidae
44 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
50 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
51 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
52 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
53 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
54 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
55 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
56 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
57 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
58 2791355473 Vibrio barjaei 3062 Isolate Unclassified
59 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
60 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
61 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
62 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
63 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
64 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
65 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
66 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
67 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
68 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
69 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
70 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
71 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
72 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
73 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
74 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
75 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
76 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
77 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
78 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
79 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
80 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
81 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
82 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
83 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
84 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
85 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
86 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
87 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
88 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
89 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
90 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
91 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
92 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
93 8071333649 Escherichia coli PN108 Isolate Calliphoridae
94 8071338694 Escherichia coli PN87 Isolate Calliphoridae
95 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
96 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
97 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
98 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
99 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
100 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
101 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
102 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
103 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
104 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
105 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
106 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
107 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
108 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
109 2864791955 Aeromonas veronii S00030 Isolate Elmidae
110 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
111 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
112 8071343737 Escherichia coli PN119 Isolate Calliphoridae
113 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
114 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
115 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
116 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
117 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
118 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
119 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
120 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
121 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
122 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
123 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
124 2820426531 Unclassified Firmicutes Lab288P3bin45 Isolate Unclassified
125 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
126 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
127 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
128 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
129 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
130 8100181737 Kosakonia sp. S58 Isolate Curculionidae
131 2978102237 Serratia fonticola AeS1 Isolate Culicidae
132 3007994558 Escherichia alba B35 Isolate Tenebrionidae
133 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
134 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
135 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
136 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
137 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
138 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
139 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
140 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
141 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
142 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
143 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
144 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
145 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
146 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
147 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
148 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
149 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
150 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
151 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
152 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
153 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
154 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
155 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
156 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
157 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
158 2593339124 Clostridium sp. 4 Isolate Termitidae
159 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
160 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
161 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
162 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
163 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
164 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
165 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
166 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
167 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
168 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
169 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
170 8071322446 Escherichia coli PN122 Isolate Calliphoridae
171 8100171289 Kosakonia sp. S42 Isolate Curculionidae
172 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
173 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
174 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
175 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
176 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
177 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
178 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
179 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_306364 3300042612 Bacteria 36565
2 Ga0466732_047624 3300042656 Bacteria 2006
3 Ga0562378_0004 3300056814 Bacteria 2423881
4 Ga0562377_0006 3300056842 Bacteria 3350072
5 Ga0562374_0001 3300057007 Bacteria 4762007
6 Ga0123357_10211723 3300009784 Bacteria 2175
7 Ga0123355_10000257 3300009826 Bacteria 68144
8 Ga0123356_10013335 3300010049 Unclassified 7938
9 Ga0123356_10014041 3300010049 Bacteria 7706
10 Ga0123356_10014688 3300010049 Unclassified 7526
11 Ga0123356_10024625 3300010049 Unclassified 5661
12 Ga0123356_10032111 3300010049 Unclassified 4914
13 Ga0123356_10487406 3300010049 Unclassified 1387
14 Ga0123353_10000993 3300010167 Bacteria 34793
15 Ga0123353_10059992 3300010167 Bacteria 6102
16 Ga0123353_10220361 3300010167 Bacteria 2967
17 Ga0123353_10291801 3300010167 Bacteria 2496
18 Ga0123353_10324989 3300010167 Bacteria 2332
19 Ga0123353_10562880 3300010167 Bacteria 1640
20 Ga0466712_243120 3300042614 Bacteria 4717
21 Ga0466711_041452 3300042615 Bacteria 22315
22 Ga0466715_321699 3300042616 Bacteria 15126
23 Ga0466715_425711 3300042616 Bacteria 13975
24 Ga0466723_098557 3300042618 Bacteria 10946
25 Ga0466723_276999 3300042618 Bacteria 14136
26 Ga0466726_009190 3300042619 Bacteria 4043
27 Ga0466728_016181 3300042620 Bacteria 3112
28 Ga0466735_101764 3300042624 Bacteria 14847
29 Ga0466727_043840 3300042655 Bacteria 2520
30 Ga0466727_328569 3300042655 Bacteria 1687
31 Ga0466700_414886 3300042600 Bacteria 2732
32 Ga0466707_181125 3300042601 Bacteria 1795
33 Ga0466707_216670 3300042601 Bacteria 16342
34 Ga0466719_071422 3300042606 Bacteria 16178
35 Ga0466720_220014 3300042607 Unclassified 4388
36 Ga0466721_182483 3300042608 Bacteria 15383
37 IMNBL1DRAFT_c0000126 3300000062 Bacteria 67951
38 Meta3P_1000074 3300002464 Bacteria 143082
39 Ga0074263_102065 3300005485 Unclassified 2553
40 Ga0415639_007307 3300038395 Bacteria 24477
41 Ga0466692_067310 3300042591 Bacteria 26519
42 Ga0466691_084267 3300042593 Bacteria 51837
43 Ga0466699_100855 3300042597 Bacteria 53915
44 Ga0466705_084452 3300042612 Bacteria 9931
45 Ga0123356_10008791 3300010049 Bacteria 10005
46 Ga0123356_10016564 3300010049 Bacteria 7028
47 Ga0123356_10033989 3300010049 Bacteria 4769
48 Ga0123356_10051157 3300010049 Bacteria 3844
49 Ga0123356_10055330 3300010049 Bacteria 3695
50 Ga0123356_10398011 3300010049 Unclassified 1514
51 Ga0123353_10000060 3300010167 Bacteria 123051
52 Ga0123353_10050913 3300010167 Bacteria 6608
53 Ga0123353_10074659 3300010167 Bacteria 5450
54 Ga0123353_10106281 3300010167 Bacteria 4523
55 Ga0123353_10196345 3300010167 Bacteria 3180
56 Ga0123353_10201131 3300010167 Bacteria 3134
57 Ga0466705_511119 3300042612 Bacteria 2536
58 Ga0466712_202481 3300042614 Bacteria 11457
59 Ga0466715_015317 3300042616 Bacteria 22295
60 Ga0466718_065722 3300042617 Bacteria 7521
61 Ga0466718_104542 3300042617 Bacteria 1897
62 Ga0466723_044662 3300042618 Bacteria 11917
63 Ga0466723_046844 3300042618 Bacteria 8500
64 Ga0466723_083332 3300042618 Bacteria 36106
65 Ga0466726_192771 3300042619 Bacteria 8644
66 Ga0466730_001298 3300042625 Unclassified 2547
67 Ga0466703_107032 3300042636 Bacteria 15162
68 Ga0466703_144575 3300042636 Bacteria 13240
69 Ga0466703_256991 3300042636 Bacteria 11991
70 Ga0466703_346438 3300042636 Bacteria 4766
71 Ga0466727_086844 3300042655 Bacteria 1900
72 Ga0466706_044920 3300042599 Bacteria 3186
73 Ga0466706_073026 3300042599 Bacteria 6020
74 Ga0466707_161143 3300042601 Bacteria 9650
75 Ga0466707_211307 3300042601 Bacteria 4873
76 Ga0466707_308956 3300042601 Bacteria 3544
77 Ga0466707_394001 3300042601 Bacteria 82516
78 Ga0466713_046844 3300042602 Bacteria 16847
79 Ga0466720_237597 3300042607 Bacteria 17433
80 Ga0466721_193736 3300042608 Bacteria 14853
81 Ga0466722_085339 3300042609 Bacteria 6567
82 Ga0466722_110050 3300042609 Bacteria 4529
83 FGTW_contig19728 2065487013 Unclassified 2831
84 IMNBL1DRAFT_c0006640 3300000062 Bacteria 6273
85 JGI24695J34938_10004247 3300002450 Bacteria 9499
86 JGI24702J35022_10044144 3300002462 Bacteria 2375
87 Ga0068302_10061155 3300005071 Bacteria 11286
88 Ga0466690_001879 3300042590 Bacteria 12243
89 Ga0466692_061322 3300042591 Bacteria 7292
90 Ga0466696_220988 3300042596 Bacteria 4750
91 Ga0466696_495075 3300042596 Bacteria 10604
92 Ga0466699_351348 3300042597 Bacteria 43572
93 Ga0466705_071877 3300042612 Bacteria 11450
94 Ga0466705_319466 3300042612 Bacteria 27771
95 Ga0466733_002338 3300042659 Bacteria 3410
96 Ga0530661_000083 3300056564 Bacteria 88780
97 Ga0123355_10001087 3300009826 Bacteria 37556
98 Ga0123355_10020937 3300009826 Bacteria 10458
99 Ga0123355_10036605 3300009826 Bacteria 7980
100 Ga0123356_10024991 3300010049 Bacteria 5614
101 Ga0123356_10026003 3300010049 Bacteria 5502
102 Ga0123356_10067383 3300010049 Bacteria 3353
103 Ga0123353_10025342 3300010167 Bacteria 9036
104 Ga0123353_10074771 3300010167 Bacteria 5446
105 Ga0123353_10081218 3300010167 Bacteria 5212
106 Ga0123354_10090766 3300010882 Bacteria 4226
107 Ga0123354_10145790 3300010882 Bacteria 2898
108 Ga0123354_10240780 3300010882 Bacteria 1862
109 Ga0466705_390677 3300042612 Bacteria 17603
110 Ga0466712_133430 3300042614 Bacteria 3245
111 Ga0466711_142529 3300042615 Bacteria 13819
112 Ga0466711_292807 3300042615 Bacteria 53803
113 Ga0466715_007413 3300042616 Bacteria 11476
114 Ga0466723_076754 3300042618 Bacteria 3312
115 Ga0466728_483235 3300042620 Bacteria 1861
116 Ga0466731_219874 3300042622 Bacteria 1675
117 Ga0466734_085972 3300042623 Bacteria 2298
118 Ga0466730_012943 3300042625 Bacteria 28329
119 Ga0466703_347870 3300042636 Bacteria 29013
120 Ga0466703_378294 3300042636 Bacteria 5666
121 Ga0466709_073930 3300042648 Bacteria 28320
122 Ga0466709_176024 3300042648 Bacteria 10068
123 Ga0466709_395631 3300042648 Unclassified 2149
124 Ga0466708_030628 3300042652 Bacteria 94331
125 Ga0466708_082037 3300042652 Bacteria 2694
126 Ga0466708_286290 3300042652 Bacteria 17301
127 Ga0466708_324603 3300042652 Bacteria 3387
128 Ga0466717_153256 3300042604 Bacteria 2491
129 Ga0466716_038886 3300042605 Bacteria 11962
130 Ga0466716_047931 3300042605 Bacteria 9484
131 Ga0466716_276450 3300042605 Bacteria 14400
132 Ga0466719_328459 3300042606 Bacteria 19533
133 Ga0466720_109497 3300042607 Bacteria 28074
134 Ga0466720_238454 3300042607 Bacteria 11025
135 Ga0466722_032592 3300042609 Bacteria 1422
136 IMNBL1DRAFT_c0002223 3300000062 Bacteria 13688
137 AustNasuHG_c1021247 3300000089 Bacteria 2103
138 JGI24698J34947_10000603 3300002449 Bacteria 17214
139 JGI24695J34938_10000214 3300002450 Bacteria 55263
140 JGI24702J35022_10004031 3300002462 Bacteria 8790
141 Ga0068302_10107494 3300005071 Bacteria 13161
142 Ga0466690_210148 3300042590 Unclassified 5022
143 Ga0466691_045640 3300042593 Bacteria 12384
144 Ga0466694_300610 3300042594 Bacteria 9816
145 Ga0123357_10128931 3300009784 Bacteria 3157
146 Ga0123357_10300056 3300009784 Bacteria 1624
147 Ga0123355_10048402 3300009826 Bacteria 6912
148 Ga0123355_10066359 3300009826 Bacteria 5809
149 Ga0123356_10000315 3300010049 Bacteria 55642
150 Ga0123356_10005638 3300010049 Bacteria 12725
151 Ga0123356_10015561 3300010049 Bacteria 7286
152 Ga0123356_10027550 3300010049 Bacteria 5323
153 Ga0123353_10079507 3300010167 Bacteria 5271
154 Ga0123353_10090322 3300010167 Bacteria 4932
155 Ga0123353_10136283 3300010167 Bacteria 3937
156 Ga0466705_423163 3300042612 Bacteria 2658
157 Ga0466712_021806 3300042614 Bacteria 7507
158 Ga0466715_017605 3300042616 Bacteria 24965
159 Ga0466715_200796 3300042616 Bacteria 18864
160 Ga0466715_315068 3300042616 Bacteria 9210
161 Ga0466718_129233 3300042617 Bacteria 1577
162 Ga0466723_066018 3300042618 Bacteria 34484
163 Ga0466728_264461 3300042620 Bacteria 17134
164 Ga0466729_068727 3300042621 Bacteria 27754
165 Ga0466734_025184 3300042623 Bacteria 1504
166 Ga0466704_216772 3300042643 Bacteria 8050
167 Ga0466708_075252 3300042652 Bacteria 11056
168 Ga0466708_185355 3300042652 Bacteria 4159
169 Ga0466725_265918 3300042654 Unclassified 3867
170 Ga0466701_023727 3300042598 Bacteria 2907
171 Ga0466706_221283 3300042599 Bacteria 43471
172 Ga0466700_327085 3300042600 Bacteria 2352
173 Ga0466707_147501 3300042601 Bacteria 5506
174 Ga0466707_355068 3300042601 Bacteria 5005
175 Ga0466716_117168 3300042605 Bacteria 2880
176 Ga0466719_349713 3300042606 Bacteria 2493
177 JGI24695J34938_10020898 3300002450 Bacteria 3215
178 CVPL010L_1000347 3300002932 Unclassified 11130
179 Ga0068305_10004343 3300005083 Bacteria 60005
180 Ga0456237_0001867 3300041968 Bacteria 3389
181 Ga0466690_054725 3300042590 Bacteria 11542
182 Ga0466690_127432 3300042590 Bacteria 5605
183 Ga0466691_039301 3300042593 Bacteria 4127
184 Ga0466705_115725 3300042612 Bacteria 2913
185 Ga0466705_158657 3300042612 Bacteria 22070
186 Ga0466732_032746 3300042656 Bacteria 10831
187 Ga0466732_044947 3300042656 Bacteria 11962
188 Ga0466733_110289 3300042659 Bacteria 10822
189 Ga0562374_3173 3300057007 Bacteria 10363
190 Ga0123355_10003640 3300009826 Bacteria 22195
191 Ga0123355_10368093 3300009826 Bacteria 1886
192 Ga0123356_10000327 3300010049 Bacteria 54770
193 Ga0123356_10007487 3300010049 Bacteria 10892
194 Ga0123356_10032462 3300010049 Bacteria 4885
195 Ga0123356_10048445 3300010049 Unclassified 3955
196 Ga0123356_10048833 3300010049 Bacteria 3938
197 Ga0123353_10023455 3300010167 Bacteria 9344
198 Ga0123353_10132848 3300010167 Bacteria 3993
199 Ga0123353_10206906 3300010167 Bacteria 3081
200 Ga0123353_10232651 3300010167 Bacteria 2872
201 Ga0466712_031862 3300042614 Bacteria 21250
202 Ga0466712_121290 3300042614 Bacteria 5703
203 Ga0466712_209958 3300042614 Unclassified 1952
204 Ga0466711_227789 3300042615 Bacteria 3635
205 Ga0466715_232305 3300042616 Bacteria 41363
206 Ga0466718_010931 3300042617 Bacteria 3114
207 Ga0466723_146954 3300042618 Bacteria 7229
208 Ga0466723_217966 3300042618 Bacteria 58279
209 Ga0466726_033088 3300042619 Bacteria 9096
210 Ga0466726_206020 3300042619 Unclassified 1845
211 Ga0466735_077021 3300042624 Bacteria 16013
212 Ga0466704_412790 3300042643 Bacteria 12972
213 Ga0466724_09236 3300042649 Bacteria 58900
214 Ga0466708_429070 3300042652 Bacteria 14209
215 Ga0466725_098813 3300042654 Bacteria 13798
216 Ga0466727_142144 3300042655 Bacteria 3847
217 Ga0466707_013427 3300042601 Bacteria 33006
218 Ga0466713_117968 3300042602 Bacteria 408806
219 Ga0466697_015447 3300042611 Bacteria 3169
220 AustNasuHG_c1000361 3300000089 Bacteria 15790
221 JGI24698J34947_10000833 3300002449 Bacteria 15450
222 Ga0063521_1000037 3300003973 Bacteria 114288
223 Ga0222431_1003140 3300021190 Bacteria 3666
224 Ga0466690_267711 3300042590 Bacteria 22966
225 Ga0466692_082134 3300042591 Bacteria 50975
226 Ga0466692_083742 3300042591 Bacteria 3618
227 Ga0466691_078361 3300042593 Bacteria 10352
228 Ga0466694_305180 3300042594 Bacteria 2508
229 Ga0466695_006492 3300042595 Bacteria 22629
230 Ga0466696_063751 3300042596 Bacteria 4102
231 Ga0466696_392907 3300042596 Bacteria 5190
232 Ga0466699_035399 3300042597 Bacteria 4709
233 Ga0466705_199486 3300042612 Bacteria 19717
234 Ga0562379_1200 3300056790 Unclassified 32272
235 Ga0123357_10081259 3300009784 Bacteria 4260
236 Ga0123355_10115496 3300009826 Bacteria 4180
237 Ga0123355_10125805 3300009826 Bacteria 3961
238 Ga0123356_10001540 3300010049 Bacteria 25396
239 Ga0123356_10048796 3300010049 Unclassified 3940
240 Ga0123356_10051175 3300010049 Bacteria 3843
241 Ga0123356_10140916 3300010049 Bacteria 2378
242 Ga0123353_10042654 3300010167 Bacteria 7178
243 Ga0123353_10056145 3300010167 Bacteria 6302
244 Ga0123353_10110691 3300010167 Bacteria 4425
245 Ga0123353_10238226 3300010167 Bacteria 2830
246 Ga0123353_10271763 3300010167 Bacteria 2611
247 Ga0123353_10462953 3300010167 Bacteria 1862
248 Ga0466712_284256 3300042614 Bacteria 29285
249 Ga0466711_065549 3300042615 Bacteria 11726
250 Ga0466715_006741 3300042616 Bacteria 1920
251 Ga0466715_295318 3300042616 Bacteria 45887
252 Ga0466726_239069 3300042619 Bacteria 26158
253 Ga0466728_437758 3300042620 Bacteria 2249
254 Ga0466731_217085 3300042622 Bacteria 2777
255 Ga0466730_026878 3300042625 Bacteria 5362
256 Ga0466703_318616 3300042636 Bacteria 7273
257 Ga0466704_191460 3300042643 Bacteria 34072
258 Ga0466704_260979 3300042643 Unclassified 1576
259 Ga0466709_417087 3300042648 Bacteria 251481
260 Ga0466708_239524 3300042652 Bacteria 10962
261 Ga0466727_144457 3300042655 Bacteria 22290
262 Ga0466727_294921 3300042655 Bacteria 3915
263 Ga0466706_155809 3300042599 Bacteria 1659
264 Ga0466713_026715 3300042602 Bacteria 43279
265 Ga0466721_071324 3300042608 Bacteria 2778
266 Ga0466722_165737 3300042609 Bacteria 3060
267 FGTW_contig30941 2065487013 Bacteria 7564
268 JGI24698J34947_10000076 3300002449 Bacteria 31759
269 JGI24698J34947_10002790 3300002449 Bacteria 9460
270 JGI24705J35276_12233693 3300002504 Bacteria 4998
271 Ga0068305_10137218 3300005083 Bacteria 11443
272 Ga0072941_1384366 3300005201 Bacteria 2324
273 Ga0105005_1032146 3300007505 Bacteria 11340
274 Ga0456237_0001736 3300041968 Bacteria 3500
275 Ga0466691_005104 3300042593 Bacteria 30173
276 Ga0466694_055152 3300042594 Bacteria 6714
277 Ga0466695_290439 3300042595 Bacteria 2502
278 Ga0466705_318699 3300042612 Bacteria 2290
279 Ga0562378_0015 3300056814 Bacteria 945537
280 Ga0562375_0599 3300056856 Bacteria 69479
281 Ga0123356_10000009 3300010049 Bacteria 226788
282 Ga0123356_10000795 3300010049 Bacteria 35033
283 Ga0123356_10013734 3300010049 Bacteria 7801
284 Ga0123356_10034225 3300010049 Bacteria 4749
285 Ga0123356_10098007 3300010049 Bacteria 2806
286 Ga0123356_10152895 3300010049 Bacteria 2294
287 Ga0123356_10173212 3300010049 Bacteria 2171
288 Ga0123353_10000333 3300010167 Bacteria 58025
289 Ga0123353_10024230 3300010167 Bacteria 9208
290 Ga0123353_10121260 3300010167 Bacteria 4205
291 Ga0123353_10169621 3300010167 Bacteria 3465
292 Ga0123354_10292888 3300010882 Bacteria 1556
293 Ga0466711_278247 3300042615 Bacteria 26787
294 Ga0466715_336717 3300042616 Bacteria 38913
295 Ga0466723_143810 3300042618 Bacteria 5358
296 Ga0466726_064629 3300042619 Bacteria 6230
297 Ga0466726_081058 3300042619 Bacteria 1912
298 Ga0466728_175048 3300042620 Bacteria 2346
299 Ga0466728_295349 3300042620 Bacteria 10583
300 Ga0466729_241071 3300042621 Bacteria 2722
301 Ga0466729_285981 3300042621 Bacteria 6923
302 Ga0466735_081068 3300042624 Bacteria 11120
303 Ga0466703_202346 3300042636 Bacteria 12582
304 Ga0466704_041700 3300042643 Bacteria 7822
305 Ga0466709_121014 3300042648 Bacteria 15642
306 Ga0466727_037338 3300042655 Bacteria 3864
307 Ga0466727_205589 3300042655 Bacteria 2708
308 Ga0466706_056044 3300042599 Bacteria 4624
309 Ga0466706_195522 3300042599 Bacteria 3067
310 Ga0466700_191190 3300042600 Bacteria 2605
311 Ga0466716_453866 3300042605 Bacteria 3751
312 Ga0466720_018543 3300042607 Bacteria 131979
313 Ga0466720_048851 3300042607 Bacteria 10538
314 Ga0466722_252221 3300042609 Bacteria 10821
315 JGI24698J34947_10010880 3300002449 Bacteria 4992
316 JGI24702J35022_10003211 3300002462 Bacteria 9885
317 JGI24702J35022_10010578 3300002462 Bacteria 5153
318 Ga0316159_10013 3300030930 Bacteria 70725
319 Ga0466690_432229 3300042590 Bacteria 2871
320 Ga0466692_106684 3300042591 Bacteria 24510
321 Ga0466693_093613 3300042592 Bacteria 2202
322 Ga0466691_166400 3300042593 Bacteria 8278
323 Ga0466699_049399 3300042597 Bacteria 8607
324 Ga0466705_012448 3300042612 Bacteria 8538
325 Ga0466705_024381 3300042612 Bacteria 2174
326 Ga0466705_038371 3300042612 Bacteria 11510
327 Ga0466705_240460 3300042612 Bacteria 4982
328 Ga0466732_451241 3300042656 Bacteria 10070
329 Ga0466733_211629 3300042659 Bacteria 17312
330 Ga0562377_0016 3300056842 Bacteria 1202354
331 Ga0562377_0538 3300056842 Bacteria 59511
332 Ga0562375_0013 3300056856 Bacteria 1229523
333 Ga0562375_0025 3300056856 Bacteria 749171
334 Ga0123355_10000067 3300009826 Bacteria 112202
335 Ga0123355_10040624 3300009826 Bacteria 7573
336 Ga0123355_10304493 3300009826 Bacteria 2168
337 Ga0123356_10014318 3300010049 Bacteria 7631
338 Ga0123356_10019518 3300010049 Bacteria 6425
339 Ga0123356_10023361 3300010049 Bacteria 5820
340 Ga0123356_10031458 3300010049 Bacteria 4966
341 Ga0123356_10061951 3300010049 Bacteria 3494
342 Ga0123356_10252722 3300010049 Bacteria 1841
343 Ga0123353_10019366 3300010167 Bacteria 10108
344 Ga0123353_10110030 3300010167 Bacteria 4439
345 Ga0123353_10130027 3300010167 Bacteria 4042
346 Ga0123353_10172513 3300010167 Bacteria 3432
347 Ga0123353_10190817 3300010167 Bacteria 3234
348 Ga0123354_10236570 3300010882 Bacteria 1892
349 Ga0466712_075804 3300042614 Bacteria 38150
350 Ga0466711_263012 3300042615 Bacteria 32756
351 Ga0466711_286731 3300042615 Bacteria 3914
352 Ga0466723_161126 3300042618 Bacteria 21003
353 Ga0466728_024058 3300042620 Bacteria 8474
354 Ga0466728_053105 3300042620 Bacteria 22958
355 Ga0466730_035900 3300042625 Bacteria 55377
356 Ga0466709_418230 3300042648 Bacteria 8336
357 Ga0466708_083359 3300042652 Bacteria 8550
358 Ga0466706_149107 3300042599 Bacteria 2447
359 Ga0466706_245126 3300042599 Bacteria 1411
360 Ga0466707_076357 3300042601 Bacteria 224161
361 Ga0466717_158360 3300042604 Bacteria 1658
362 Ga0466716_112270 3300042605 Bacteria 2428
363 Ga0466719_212359 3300042606 Bacteria 15889
364 Ga0466720_033684 3300042607 Bacteria 17925
365 Ga0466722_179461 3300042609 Bacteria 6943
366 2227535732 2225789004 Bacteria 57093
367 IMNBL1DRAFT_c0013504 3300000062 Bacteria 3657
368 AustNasuHG_c1007387 3300000089 Bacteria 3912
369 JGI24698J34947_10000106 3300002449 Bacteria 28864
370 JGI24698J34947_10005000 3300002449 Bacteria 7266
371 JGI24695J34938_10000106 3300002450 Bacteria 73679
372 JGI24695J34938_10021509 3300002450 Bacteria 3153
373 JGI24705J35276_12230487 3300002504 Bacteria 3642
374 JGI24700J35501_10930847 3300002508 Bacteria 27907
375 Ga0063521_1000048 3300003973 Bacteria 106555
376 Ga0104049_1131118 3300007103 Bacteria 4605
377 Ga0466690_029738 3300042590 Bacteria 11880
378 Ga0466690_044243 3300042590 Bacteria 5291
379 Ga0466690_069614 3300042590 Bacteria 3788
380 Ga0466692_105323 3300042591 Bacteria 2271
381 Ga0466691_209904 3300042593 Bacteria 5979
382 Ga0466696_103856 3300042596 Bacteria 1564
383 Ga0466696_198725 3300042596 Bacteria 16131
384 Ga0466699_113295 3300042597 Bacteria 2645
385 Ga0466699_217232 3300042597 Bacteria 6637

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07687 M20_dimer Peptidase dimerisation domain 211 332 0.96
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 104 461 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01546 GO:0016787 hydrolase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.