Protein Family IF02177
Metagenome
Isolate
481
Members
333
Samples
233
Scaffolds
129.56
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10006946|Ga0123357_1000694610
- Length
- 133 aa
- Sequence
- MGDPKTKFLIVDDFSTMRRIVRNLLKELGYANADEAEDGVVALHKLETMPMEYNFVVSDWNMPNMDGLALLQKIRSSPHLKHLPVLMITAEAKKENIIAAAQAGASGYIVKPFTAATLAEKLEKVFEKMKPA*
Sample Types
Isolate
51.6%
Metagenome
48.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
25.1%
Unclassified
21.6%
Termitidae
6.3%
Formicidae
6.0%
Culicidae
5.0%
Kalotermitidae
4.4%
Anthocoridae
4.4%
Muscidae
4.1%
Curculionidae
2.8%
Calliphoridae
2.2%
Elmidae
1.3%
Drosophilidae
1.3%
Apidae
1.3%
Termopsidae
1.3%
Tenebrionidae
1.3%
Rhinotermitidae
0.9%
Talitridae
0.9%
Cerambycidae
0.9%
Passalidae
0.9%
Palinuridae
0.9%
Sarcophagidae
0.6%
Largidae
0.6%
Berytidae
0.6%
Armadillidiidae
0.6%
Alydidae
0.6%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Anthomyiidae
0.3%
Artemiidae
0.3%
Siricidae
0.3%
Pentatomidae
0.3%
Hodotermitidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Plutellidae
0.3%
Tephritidae
0.3%
Crambidae
0.3%
Majidae
0.3%
Taxonomy
Archaea
0
Bacteria
407
Eukaryota
0
Viruses
0
Unclassified
74
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 3 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 4 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 5 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 6 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 7 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 8 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 9 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 10 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 11 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 12 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 13 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 14 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 15 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 16 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 17 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 18 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 21 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 22 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 28 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 29 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 30 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 31 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 32 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 33 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 34 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 35 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 36 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 37 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 38 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 39 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 40 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 41 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 42 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 43 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 48 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 49 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 50 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 51 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 52 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 53 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 54 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 55 | 2958255616 | Serratia marcescens TM | Isolate | |
| 56 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 57 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 58 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 59 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 60 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 61 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 62 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 63 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 64 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 65 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 66 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 67 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 68 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 69 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 70 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 71 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 72 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 73 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 74 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 75 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 76 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 77 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 78 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 79 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 80 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 81 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 82 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 83 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 84 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 85 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 86 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 87 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 88 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 89 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 90 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 91 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 92 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 93 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 94 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 95 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 96 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 97 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 98 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 99 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 100 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 101 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 102 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 103 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 104 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 105 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 106 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 107 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 108 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 109 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 110 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 111 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 112 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 113 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 114 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 115 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 116 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 117 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 118 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 119 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 120 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 121 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 122 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 123 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 124 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 125 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 126 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 127 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 128 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 129 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 130 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 131 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 132 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 133 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 134 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 135 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 136 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 137 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 138 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 139 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 140 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 141 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 142 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 143 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 144 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 145 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 146 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 147 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 148 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 149 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 150 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 151 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 152 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 153 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 154 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 155 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 156 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 157 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 158 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 159 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 160 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 161 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 162 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 163 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 164 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 165 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 166 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 167 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 168 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 169 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 170 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 171 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 172 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 173 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 174 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 175 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 176 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 177 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 178 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 179 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 180 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 181 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 182 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 183 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 184 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 185 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 186 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 187 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 188 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 189 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 190 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 191 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 192 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 193 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 194 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 195 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 196 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 197 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 198 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 199 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 200 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 201 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 202 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 203 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 204 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 205 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 206 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 207 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 208 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 209 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 210 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 211 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 212 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 213 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 214 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 215 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 216 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 217 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 218 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 219 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 220 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 221 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 222 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 223 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 224 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 225 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 226 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 227 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 228 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 229 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 230 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 231 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 232 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 233 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 234 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 235 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 236 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 237 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 238 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 239 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 240 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 241 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 242 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 243 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 244 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 245 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 246 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 247 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 248 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 249 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 250 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 251 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 252 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 253 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 254 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 255 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 256 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 257 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 258 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 259 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 260 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 261 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 262 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 263 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 264 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 265 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 266 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 267 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 268 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 269 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 270 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 271 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 272 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 273 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 274 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 275 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 276 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 277 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 278 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 279 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 280 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 281 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 282 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 283 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 284 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 285 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 286 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 287 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 288 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 289 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 290 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 291 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 292 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 293 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 294 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 295 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 296 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 297 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 298 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 299 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 300 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 301 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 302 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 303 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 304 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 305 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 306 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 307 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 308 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 309 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 310 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 311 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 312 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 313 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 314 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 315 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 316 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 317 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 318 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 319 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 320 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 321 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 322 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 323 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 324 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 325 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 326 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 327 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 328 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 329 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 330 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 331 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 332 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 333 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_181424 | 3300042659 | Bacteria | 38986 |
| 2 | Ga0160447_103433 | 3300012849 | Bacteria | 5078 |
| 3 | Ga0247289_0003 | 3300035363 | Unclassified | 94432 |
| 4 | Ga0415639_283370 | 3300038395 | Bacteria | 1481 |
| 5 | Ga0466690_384892 | 3300042590 | Bacteria | 29462 |
| 6 | Ga0466715_227042 | 3300042616 | Unclassified | 7153 |
| 7 | Ga0466701_078183 | 3300042598 | Bacteria | 2164 |
| 8 | Ga0466706_033760 | 3300042599 | Bacteria | 3958 |
| 9 | Ga0466707_129641 | 3300042601 | Bacteria | 97865 |
| 10 | Ga0466713_025090 | 3300042602 | Bacteria | 10019 |
| 11 | Ga0466716_262892 | 3300042605 | Bacteria | 1272 |
| 12 | Ga0466722_052411 | 3300042609 | Bacteria | 10638 |
| 13 | Ga0123354_10133778 | 3300010882 | Unclassified | 3114 |
| 14 | HBC_ctgsDRAFT_1001689 | 3300000333 | Bacteria | 4853 |
| 15 | JGI24702J35022_10003055 | 3300002462 | Unclassified | 10117 |
| 16 | CVPL010L_1000458 | 3300002932 | Unclassified | 32012 |
| 17 | Ga0103266_1001245 | 3300007067 | Bacteria | 4466 |
| 18 | Ga0103261_1011243 | 3300007083 | Unclassified | 1247 |
| 19 | Ga0102734_1006996 | 3300007129 | Bacteria | 2542 |
| 20 | Ga0103264_1001502 | 3300007188 | Bacteria | 10256 |
| 21 | Ga0466704_021877 | 3300042643 | Bacteria | 6412 |
| 22 | Ga0466705_146937 | 3300042612 | Bacteria | 13917 |
| 23 | Ga0160432_101248 | 3300012818 | Unclassified | 8871 |
| 24 | Ga0160472_101079 | 3300012839 | Unclassified | 9387 |
| 25 | Ga0160434_103204 | 3300012850 | Unclassified | 2780 |
| 26 | Ga0466657_396738 | 3300042582 | Unclassified | 3792 |
| 27 | Ga0466696_166874 | 3300042596 | Bacteria | 2405 |
| 28 | Ga0466711_157729 | 3300042615 | Bacteria | 10287 |
| 29 | Ga0466715_529001 | 3300042616 | Unclassified | 2114 |
| 30 | Ga0466715_595376 | 3300042616 | Unclassified | 3773 |
| 31 | Ga0466723_059212 | 3300042618 | Unclassified | 10769 |
| 32 | Ga0466726_270053 | 3300042619 | Unclassified | 3177 |
| 33 | Ga0466716_504396 | 3300042605 | Unclassified | 2180 |
| 34 | Ga0123356_10630187 | 3300010049 | Bacteria | 1238 |
| 35 | Ga0123353_10084538 | 3300010167 | Unclassified | 5108 |
| 36 | Ga0160442_100142 | 3300012806 | Bacteria | 69485 |
| 37 | FGTW_contig21080 | 2065487013 | Unclassified | 2199 |
| 38 | IMNBGM34_c000418 | 3300000036 | Bacteria | 11771 |
| 39 | CVPL010W_10003415 | 3300002931 | Bacteria | 18213 |
| 40 | CVPL010L_1000366 | 3300002932 | Bacteria | 10841 |
| 41 | CVPL010L_1020842 | 3300002932 | Bacteria | 631 |
| 42 | Ga0063521_1000250 | 3300003973 | Bacteria | 36019 |
| 43 | Ga0072941_1384725 | 3300005201 | Unclassified | 1095 |
| 44 | Ga0103261_1000648 | 3300007083 | Bacteria | 5286 |
| 45 | Ga0103261_1015218 | 3300007083 | Bacteria | 1071 |
| 46 | Ga0103260_1089118 | 3300007139 | Bacteria | 509 |
| 47 | Ga0102737_1000231 | 3300007142 | Unclassified | 18912 |
| 48 | Ga0103264_1000059 | 3300007188 | Bacteria | 64034 |
| 49 | Ga0466734_002207 | 3300042623 | Bacteria | 2619 |
| 50 | Ga0466730_084905 | 3300042625 | Bacteria | 5128 |
| 51 | Ga0466725_227917 | 3300042654 | Bacteria | 34011 |
| 52 | Ga0415639_269541 | 3300038395 | Bacteria | 2222 |
| 53 | Ga0466657_170331 | 3300042582 | Bacteria | 33398 |
| 54 | Ga0466692_177022 | 3300042591 | Bacteria | 46972 |
| 55 | Ga0466715_163485 | 3300042616 | Bacteria | 29116 |
| 56 | Ga0466715_525476 | 3300042616 | Unclassified | 3752 |
| 57 | Ga0466726_489169 | 3300042619 | Bacteria | 25990 |
| 58 | Ga0466717_108147 | 3300042604 | Bacteria | 8868 |
| 59 | Ga0466719_132785 | 3300042606 | Bacteria | 6799 |
| 60 | Ga0466722_215896 | 3300042609 | Bacteria | 6150 |
| 61 | Ga0123356_10500295 | 3300010049 | Unclassified | 1371 |
| 62 | DPOL_contig16480 | 2035918003 | Bacteria | 14163 |
| 63 | DPOL_contig20247 | 2035918003 | Bacteria | 27216 |
| 64 | SPBB_contig09688 | 2044078006 | Bacteria | 61876 |
| 65 | SWWA_contig31680__length_19616___numreads_1040 | 2100351016 | Bacteria | 19616 |
| 66 | CVPL005W_1000127 | 3300002934 | Bacteria | 32241 |
| 67 | CVPL005W_1000707 | 3300002934 | Bacteria | 11826 |
| 68 | Ga0072941_1161383 | 3300005201 | Bacteria | 8276 |
| 69 | Ga0102736_1002823 | 3300007052 | Bacteria | 2652 |
| 70 | Ga0103260_1000671 | 3300007139 | Bacteria | 6499 |
| 71 | Ga0102737_1000972 | 3300007142 | Bacteria | 8556 |
| 72 | Ga0103268_1002780 | 3300007192 | Unclassified | 3797 |
| 73 | Ga0104147_1022405 | 3300007224 | Bacteria | 10536 |
| 74 | Ga0466734_109211 | 3300042623 | Unclassified | 1256 |
| 75 | Ga0466703_217430 | 3300042636 | Unclassified | 3136 |
| 76 | Ga0466708_183550 | 3300042652 | Bacteria | 19378 |
| 77 | Ga0466708_192071 | 3300042652 | Bacteria | 25132 |
| 78 | Ga0160447_103314 | 3300012849 | Bacteria | 5202 |
| 79 | Ga0316159_15564 | 3300030930 | Unclassified | 879 |
| 80 | Ga0466656_162192 | 3300042550 | Bacteria | 1504 |
| 81 | Ga0466657_304091 | 3300042582 | Unclassified | 10325 |
| 82 | Ga0466691_098332 | 3300042593 | Unclassified | 7573 |
| 83 | Ga0466691_131656 | 3300042593 | Unclassified | 1768 |
| 84 | Ga0466711_085549 | 3300042615 | Unclassified | 1342 |
| 85 | Ga0466711_330281 | 3300042615 | Bacteria | 4684 |
| 86 | Ga0466723_243831 | 3300042618 | Bacteria | 13642 |
| 87 | Ga0466726_042892 | 3300042619 | Bacteria | 13896 |
| 88 | Ga0466726_446036 | 3300042619 | Unclassified | 1687 |
| 89 | Ga0466728_190681 | 3300042620 | Bacteria | 53550 |
| 90 | Ga0466729_154284 | 3300042621 | Bacteria | 21435 |
| 91 | Ga0466719_180869 | 3300042606 | Bacteria | 6899 |
| 92 | Ga0466719_467583 | 3300042606 | Unclassified | 11954 |
| 93 | Ga0123357_10006946 | 3300009784 | Bacteria | 13912 |
| 94 | Ga0160464_100061 | 3300012805 | Unclassified | 130455 |
| 95 | JGI24702J35022_10038189 | 3300002462 | Unclassified | 2564 |
| 96 | Meta3P_1000325 | 3300002464 | Bacteria | 53316 |
| 97 | CVPL010W_10014199 | 3300002931 | Bacteria | 5885 |
| 98 | Ga0072941_1034257 | 3300005201 | Bacteria | 18483 |
| 99 | Ga0103261_1021565 | 3300007083 | Bacteria | 909 |
| 100 | Ga0104049_1135493 | 3300007103 | Bacteria | 1177 |
| 101 | Ga0102740_1028945 | 3300007140 | Unclassified | 857 |
| 102 | Ga0102737_1000523 | 3300007142 | Bacteria | 12527 |
| 103 | Ga0102737_1014900 | 3300007142 | Bacteria | 1243 |
| 104 | Ga0103264_1000176 | 3300007188 | Bacteria | 37727 |
| 105 | Ga0103264_1000644 | 3300007188 | Bacteria | 16602 |
| 106 | Ga0103268_1000892 | 3300007192 | Bacteria | 8219 |
| 107 | Ga0466735_079839 | 3300042624 | Bacteria | 2909 |
| 108 | Ga0466730_003559 | 3300042625 | Bacteria | 70522 |
| 109 | Ga0466730_031520 | 3300042625 | Unclassified | 36110 |
| 110 | Ga0466703_392936 | 3300042636 | Unclassified | 7233 |
| 111 | Ga0466704_275414 | 3300042643 | Unclassified | 1583 |
| 112 | Ga0466709_064564 | 3300042648 | Unclassified | 17161 |
| 113 | Ga0466708_098635 | 3300042652 | Bacteria | 8981 |
| 114 | Ga0466708_348150 | 3300042652 | Bacteria | 6359 |
| 115 | Ga0466725_268072 | 3300042654 | Bacteria | 37519 |
| 116 | Ga0466725_461466 | 3300042654 | Bacteria | 1396 |
| 117 | Ga0466727_242004 | 3300042655 | Bacteria | 18174 |
| 118 | Ga0466697_122951 | 3300042611 | Bacteria | 4788 |
| 119 | Ga0466705_197212 | 3300042612 | Unclassified | 1320 |
| 120 | Ga0160460_101777 | 3300012845 | Unclassified | 6206 |
| 121 | Ga0466657_080609 | 3300042582 | Unclassified | 5444 |
| 122 | Ga0466691_084816 | 3300042593 | Bacteria | 12931 |
| 123 | Ga0466696_004993 | 3300042596 | Bacteria | 1110 |
| 124 | Ga0466701_000766 | 3300042598 | Bacteria | 80268 |
| 125 | Ga0466706_111986 | 3300042599 | Bacteria | 7127 |
| 126 | Ga0466707_034764 | 3300042601 | Unclassified | 22464 |
| 127 | Ga0466707_129562 | 3300042601 | Bacteria | 78697 |
| 128 | Ga0466719_328206 | 3300042606 | Unclassified | 2581 |
| 129 | Ga0466719_473868 | 3300042606 | Bacteria | 6200 |
| 130 | Ga0466722_099236 | 3300042609 | Unclassified | 2159 |
| 131 | Ga0123356_10710080 | 3300010049 | Bacteria | 1175 |
| 132 | 2227525165 | 2225789004 | Bacteria | 650 |
| 133 | CVPL010W_10004150 | 3300002931 | Bacteria | 26009 |
| 134 | Ga0103263_113901 | 3300007042 | Bacteria | 795 |
| 135 | Ga0103264_1000342 | 3300007188 | Bacteria | 34615 |
| 136 | Ga0103264_1003805 | 3300007188 | Bacteria | 8460 |
| 137 | Ga0466730_039481 | 3300042625 | Bacteria | 9555 |
| 138 | Ga0466704_132041 | 3300042643 | Unclassified | 6471 |
| 139 | Ga0466724_66622 | 3300042649 | Bacteria | 2134 |
| 140 | Ga0466708_012581 | 3300042652 | Unclassified | 4652 |
| 141 | Ga0160446_127655 | 3300012835 | Unclassified | 608 |
| 142 | Ga0160445_108851 | 3300012847 | Unclassified | 1536 |
| 143 | Ga0160443_115987 | 3300012848 | Bacteria | 811 |
| 144 | Ga0160435_1043261 | 3300012857 | Bacteria | 630 |
| 145 | Ga0466692_101940 | 3300042591 | Bacteria | 50488 |
| 146 | Ga0466712_036679 | 3300042614 | Bacteria | 4321 |
| 147 | Ga0466728_138439 | 3300042620 | Unclassified | 3602 |
| 148 | Ga0466713_037605 | 3300042602 | Unclassified | 15055 |
| 149 | Ga0123353_10031020 | 3300010167 | Unclassified | 8271 |
| 150 | Ga0123353_10070960 | 3300010167 | Bacteria | 5597 |
| 151 | Ga0123353_10370649 | 3300010167 | Bacteria | 2147 |
| 152 | IMNBL1DRAFT_c0017078 | 3300000062 | Bacteria | 3075 |
| 153 | CVPL010W_10009129 | 3300002931 | Bacteria | 9117 |
| 154 | Ga0063521_1000103 | 3300003973 | Unclassified | 66974 |
| 155 | Ga0068305_10086801 | 3300005083 | Bacteria | 4940 |
| 156 | Ga0102736_1044291 | 3300007052 | Bacteria | 980 |
| 157 | Ga0103265_1009484 | 3300007068 | Bacteria | 1276 |
| 158 | Ga0102735_1000286 | 3300007080 | Bacteria | 11991 |
| 159 | Ga0102734_1006233 | 3300007129 | Bacteria | 2667 |
| 160 | Ga0103260_1000548 | 3300007139 | Bacteria | 7185 |
| 161 | Ga0102737_1003819 | 3300007142 | Bacteria | 3348 |
| 162 | Ga0103264_1017274 | 3300007188 | Bacteria | 4567 |
| 163 | Ga0466730_045914 | 3300042625 | Bacteria | 132698 |
| 164 | Ga0466708_044430 | 3300042652 | Bacteria | 30037 |
| 165 | Ga0466708_152494 | 3300042652 | Bacteria | 37948 |
| 166 | Ga0466725_191539 | 3300042654 | Bacteria | 3580 |
| 167 | Ga0160443_109527 | 3300012848 | Bacteria | 1140 |
| 168 | Ga0160447_100139 | 3300012849 | Bacteria | 49926 |
| 169 | Ga0160434_111535 | 3300012850 | Unclassified | 1427 |
| 170 | Ga0160436_1050818 | 3300012861 | Bacteria | 621 |
| 171 | Ga0265387_1000491 | 3300024582 | Bacteria | 6274 |
| 172 | Ga0466656_069387 | 3300042550 | Unclassified | 4798 |
| 173 | Ga0466690_374945 | 3300042590 | Bacteria | 57693 |
| 174 | Ga0466691_000797 | 3300042593 | Bacteria | 14713 |
| 175 | Ga0466696_196462 | 3300042596 | Unclassified | 1662 |
| 176 | Ga0466705_529566 | 3300042612 | Unclassified | 1546 |
| 177 | Ga0466715_528123 | 3300042616 | Bacteria | 1620 |
| 178 | Ga0466718_161013 | 3300042617 | Unclassified | 1160 |
| 179 | Ga0466716_377037 | 3300042605 | Bacteria | 1751 |
| 180 | Ga0123356_10484581 | 3300010049 | Bacteria | 1390 |
| 181 | Ga0123353_11661495 | 3300010167 | Bacteria | 802 |
| 182 | Ga0123354_10019311 | 3300010882 | Unclassified | 10702 |
| 183 | Ga0160454_100015 | 3300012798 | Bacteria | 351622 |
| 184 | SPBB_contig10319 | 2044078006 | Unclassified | 13343 |
| 185 | FGTW_contig16883 | 2065487013 | Unclassified | 5646 |
| 186 | FGTW_contig21745 | 2065487013 | Unclassified | 7833 |
| 187 | FGTW_contig23871 | 2065487013 | Bacteria | 10666 |
| 188 | 2227535720 | 2225789004 | Bacteria | 58750 |
| 189 | JGI24702J35022_10025123 | 3300002462 | Unclassified | 3216 |
| 190 | CVPL010W_10000096 | 3300002931 | Bacteria | 62459 |
| 191 | Ga0102736_1001101 | 3300007052 | Bacteria | 4873 |
| 192 | Ga0102736_1002607 | 3300007052 | Unclassified | 2804 |
| 193 | Ga0103266_1000117 | 3300007067 | Bacteria | 27729 |
| 194 | Ga0103265_1005884 | 3300007068 | Bacteria | 1670 |
| 195 | Ga0102739_1000544 | 3300007095 | Bacteria | 7455 |
| 196 | Ga0102734_1001501 | 3300007129 | Bacteria | 8261 |
| 197 | Ga0103260_1008505 | 3300007139 | Unclassified | 1434 |
| 198 | Ga0102740_1000015 | 3300007140 | Bacteria | 46459 |
| 199 | Ga0102737_1023526 | 3300007142 | Bacteria | 963 |
| 200 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 201 | Ga0103264_1000264 | 3300007188 | Bacteria | 29007 |
| 202 | Ga0105005_1090680 | 3300007505 | Bacteria | 9988 |
| 203 | Ga0466724_33561 | 3300042649 | Bacteria | 205596 |
| 204 | Ga0466705_352386 | 3300042612 | Bacteria | 63158 |
| 205 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 206 | Ga0160459_105931 | 3300012831 | Unclassified | 1575 |
| 207 | Ga0160458_108292 | 3300012832 | Bacteria | 1188 |
| 208 | Ga0160446_100084 | 3300012835 | Bacteria | 90262 |
| 209 | Ga0160472_100059 | 3300012839 | Bacteria | 181621 |
| 210 | Ga0466656_264340 | 3300042550 | Unclassified | 1085 |
| 211 | Ga0466692_041678 | 3300042591 | Bacteria | 43810 |
| 212 | Ga0466705_449443 | 3300042612 | Bacteria | 1410 |
| 213 | Ga0466710_446051 | 3300042613 | Bacteria | 45509 |
| 214 | Ga0466711_412154 | 3300042615 | Bacteria | 79545 |
| 215 | Ga0466715_135611 | 3300042616 | Unclassified | 6801 |
| 216 | Ga0466715_460619 | 3300042616 | Bacteria | 8093 |
| 217 | Ga0466700_290096 | 3300042600 | Unclassified | 2623 |
| 218 | Ga0466707_385863 | 3300042601 | Bacteria | 14258 |
| 219 | Ga0466716_166808 | 3300042605 | Bacteria | 20955 |
| 220 | Ga0466716_422303 | 3300042605 | Bacteria | 1705 |
| 221 | Ga0123356_11237109 | 3300010049 | Bacteria | 912 |
| 222 | Ga0160464_100027 | 3300012805 | Unclassified | 200617 |
| 223 | FGTW_contig29261 | 2065487013 | Unclassified | 1597 |
| 224 | Ga0068302_10066171 | 3300005071 | Unclassified | 8968 |
| 225 | Ga0103266_1001199 | 3300007067 | Bacteria | 4579 |
| 226 | Ga0103261_1017644 | 3300007083 | Bacteria | 999 |
| 227 | Ga0102740_1002295 | 3300007140 | Bacteria | 4442 |
| 228 | Ga0102738_1000206 | 3300007141 | Bacteria | 12609 |
| 229 | Ga0103264_1000819 | 3300007188 | Bacteria | 15544 |
| 230 | Ga0466703_110628 | 3300042636 | Unclassified | 19885 |
| 231 | Ga0466704_147712 | 3300042643 | Unclassified | 1521 |
| 232 | Ga0466725_123472 | 3300042654 | Unclassified | 7171 |
| 233 | Ga0466727_000362 | 3300042655 | Bacteria | 30327 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00072 | Response_reg | Response regulator receiver domain | 9 | 122 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.