Protein Family IF01089
Metagenome
Metatranscriptome
Isolate
510
Members
356
Samples
247
Scaffolds
360.38
Avg Length
Representative Sequence
- ID
- 3300003973|Ga0063521_1000077|Ga0063521_100007746
- Length
- 418 aa
- Sequence
- MYLTLFYMSIKKSALASDSIASCAIIIENKLTTYYILGYNSESLKNNPMRNREVMRVMERVYNFSAGPSILPLPVLEKVQKELLNYNGTGMSIMEMSHRSSYFQSIIEEASNLLRELMSIPDEYEVLFLQGGASLQFSMIPLNLMNTYKKAGYVLTGSWSKKALQEAEKVGEVQVIASSEQEKFTTIPKLDGLLSDEKLDYVHITTNNTIEGTKYVDIPHVEKVPLVADMSSNILSERYDVSKFGLIYAGAQKNLGPAGLTIAIIKRDLIGGADRPCPTMLNYETYSKNNSLYNTPPSFSIYVTKLVLEWLKEQGGVSAIEEQNKMKSSLLYNFLDESKLFTSPVDPTYRSLMNIPFTTPSEELNNEFLQKAKERGFVTLKGHRSVGGMRASIYNAMPVEGVKQLVDYMKEFELENR*
Sample Types
Isolate
51.6%
Metagenome
48.0%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Apidae
30.7%
Unclassified
17.5%
Termitidae
9.5%
Aphididae
4.0%
Blattidae
3.7%
Formicidae
3.7%
Kalotermitidae
3.7%
Elmidae
3.4%
Drosophilidae
3.2%
Chrysomelidae
3.2%
Muscidae
2.9%
Tenebrionidae
2.6%
Pyralidae
1.4%
Scarabaeidae
1.4%
Curculionidae
1.1%
Culicidae
0.9%
Passalidae
0.9%
Rhinotermitidae
0.9%
Armadillidiidae
0.6%
Bombycidae
0.6%
Vespidae
0.3%
Hodotermitidae
0.3%
Noctuidae
0.3%
Eresidae
0.3%
Palinuridae
0.3%
Hormaphididae
0.3%
Termopsidae
0.3%
Nephropidae
0.3%
Cerambycidae
0.3%
Calliphoridae
0.3%
Anthomyiidae
0.3%
Ocypodidae
0.3%
Glossinidae
0.3%
Pteromalidae
0.3%
Taxonomy
Archaea
0
Bacteria
490
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 2 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 3 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 4 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 5 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 6 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 7 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 8 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 9 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 10 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 11 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 12 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 13 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 14 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 15 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 16 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 17 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 18 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 19 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 20 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 21 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 22 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 23 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 24 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 25 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 26 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 27 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 28 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 29 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 30 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 31 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 32 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 33 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 34 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 37 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 38 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 40 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 41 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 42 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 43 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 44 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 45 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 48 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 51 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 52 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 53 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 54 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 62 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 65 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 66 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 67 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 68 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 69 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 70 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 71 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 72 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 73 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 74 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 75 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 76 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 77 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 78 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 79 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 80 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 81 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 82 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 83 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 84 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 85 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 86 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 87 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 88 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 89 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 90 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 91 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 92 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 93 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 94 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 95 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 96 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 97 | 2998830186 | Enterobacteriaceae endosymbiont of Plateumaris pusilla PpusSym | Isolate | Chrysomelidae |
| 98 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 99 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 100 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 101 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 102 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 103 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 104 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 105 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 106 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 107 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 108 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 109 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 110 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 111 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 112 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 113 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 114 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 115 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 116 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 117 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 118 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 119 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 120 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 121 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 122 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 123 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 124 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 125 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 126 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 127 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 128 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 129 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 130 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 131 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 132 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 133 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 134 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 135 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 136 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 137 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 138 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 139 | 2998834370 | Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym | Isolate | Chrysomelidae |
| 140 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 141 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 142 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 143 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 144 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 145 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 146 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 147 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 148 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 149 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 150 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 151 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 152 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 153 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 154 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 155 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 156 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 157 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 158 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 159 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 160 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 161 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 162 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 163 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 164 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 165 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 166 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 167 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 168 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 169 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 170 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 171 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 172 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 173 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 174 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 175 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 176 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 177 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 178 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 179 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 180 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 181 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 182 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 183 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 184 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 185 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 186 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 187 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 188 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 189 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 190 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 191 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 192 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 193 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 194 | 2999135268 | Enterobacteriaceae endosymbiont of Plateumaris sericea PserSym | Isolate | Chrysomelidae |
| 195 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 196 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 197 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 198 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 199 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 200 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 201 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 202 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 203 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 204 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 205 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 206 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 207 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 208 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 209 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 210 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 211 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 212 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 213 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 214 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 215 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 216 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 217 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 218 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 219 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 220 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 221 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 222 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 223 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 224 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 225 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 226 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 227 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 228 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 229 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 230 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 231 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 232 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 233 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 234 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 235 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 236 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 237 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 238 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 239 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 240 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 241 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 242 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 243 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 244 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 245 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 246 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 247 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 248 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 249 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 250 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 251 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 252 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 253 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 254 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 255 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 256 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 257 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 258 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 259 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 260 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 261 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 262 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 263 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 264 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 265 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 266 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 267 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 268 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 269 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 270 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 271 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 272 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 273 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 274 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 275 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 276 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 277 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 278 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 279 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 280 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 281 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 282 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 283 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 284 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 285 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 286 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 287 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 288 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 289 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 290 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 291 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 292 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 293 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 294 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 295 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 296 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 297 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 298 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 299 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 300 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 301 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 302 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 303 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 304 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 305 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 306 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 307 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 308 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 309 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 310 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 311 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 312 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 313 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 314 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 315 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 316 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 317 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 318 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 319 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 320 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 321 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 322 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 323 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 324 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 325 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 326 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 327 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 328 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 329 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 330 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 331 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 332 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 333 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 334 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 335 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 336 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 337 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 338 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 339 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 340 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 341 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 342 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 343 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 344 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 345 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 346 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 347 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 348 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 349 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 350 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 351 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 352 | 2998827396 | Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym | Isolate | Chrysomelidae |
| 353 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 354 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 355 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 356 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_288630 | 3300042612 | Bacteria | 1888 |
| 2 | Ga0530661_001225 | 3300056564 | Bacteria | 13915 |
| 3 | Ga0562377_0082 | 3300056842 | Bacteria | 346138 |
| 4 | Ga0562374_0944 | 3300057007 | Bacteria | 39647 |
| 5 | Ga0415639_003760 | 3300038395 | Bacteria | 12574 |
| 6 | Ga0466729_272174 | 3300042621 | Bacteria | 94053 |
| 7 | Ga0466729_278937 | 3300042621 | Bacteria | 5184 |
| 8 | Ga0466703_227149 | 3300042636 | Bacteria | 5273 |
| 9 | Ga0466704_333686 | 3300042643 | Bacteria | 14846 |
| 10 | Ga0466724_09622 | 3300042649 | Bacteria | 60623 |
| 11 | Ga0466712_030071 | 3300042614 | Bacteria | 8563 |
| 12 | Ga0466712_213845 | 3300042614 | Unclassified | 2644 |
| 13 | Ga0466715_220464 | 3300042616 | Bacteria | 3624 |
| 14 | Ga0466715_523065 | 3300042616 | Bacteria | 5223 |
| 15 | Ga0466718_000166 | 3300042617 | Bacteria | 3911 |
| 16 | Ga0466726_091132 | 3300042619 | Bacteria | 11907 |
| 17 | Ga0123357_10082619 | 3300009784 | Bacteria | 4218 |
| 18 | Ga0123355_10019095 | 3300009826 | Bacteria | 10904 |
| 19 | Ga0123355_10048108 | 3300009826 | Bacteria | 6932 |
| 20 | Ga0123355_10252152 | 3300009826 | Bacteria | 2482 |
| 21 | Ga0123353_10002901 | 3300010167 | Bacteria | 21475 |
| 22 | Ga0123353_10234861 | 3300010167 | Bacteria | 2855 |
| 23 | Ga0466706_242195 | 3300042599 | Bacteria | 7422 |
| 24 | Ga0466714_051220 | 3300042603 | Bacteria | 1986 |
| 25 | Ga0466698_385954 | 3300042610 | Bacteria | 2722 |
| 26 | IMNBL1DRAFT_c0003556 | 3300000062 | Bacteria | 9914 |
| 27 | IMNBL1DRAFT_c0005985 | 3300000062 | Bacteria | 6789 |
| 28 | SCG598L16_135175 | 3300000490 | Bacteria | 17379 |
| 29 | JGI24695J34938_10000910 | 3300002450 | Bacteria | 27242 |
| 30 | JGI24703J35330_11748872 | 3300002501 | Bacteria | 111701 |
| 31 | CVPL010W_10019795 | 3300002931 | Bacteria | 3979 |
| 32 | CVPL010L_1000532 | 3300002932 | Unclassified | 11047 |
| 33 | CVPL005W_1000262 | 3300002934 | Bacteria | 23707 |
| 34 | Ga0104045_1004646 | 3300007085 | Unclassified | 13875 |
| 35 | Ga0103268_1000103 | 3300007192 | Unclassified | 26831 |
| 36 | Ga0105005_1102770 | 3300007505 | Bacteria | 3026 |
| 37 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 38 | Ga0530661_000028 | 3300056564 | Bacteria | 173409 |
| 39 | Ga0562375_0012 | 3300056856 | Bacteria | 1240899 |
| 40 | Ga0160445_101267 | 3300012847 | Bacteria | 7540 |
| 41 | Ga0466693_193019 | 3300042592 | Bacteria | 5150 |
| 42 | Ga0466691_160701 | 3300042593 | Bacteria | 7013 |
| 43 | Ga0466704_343338 | 3300042643 | Bacteria | 2511 |
| 44 | Ga0466725_314643 | 3300042654 | Bacteria | 3455 |
| 45 | Ga0466705_487246 | 3300042612 | Bacteria | 59518 |
| 46 | Ga0466715_209599 | 3300042616 | Bacteria | 9017 |
| 47 | Ga0466715_272326 | 3300042616 | Bacteria | 7507 |
| 48 | Ga0466723_141075 | 3300042618 | Bacteria | 12722 |
| 49 | Ga0466723_321949 | 3300042618 | Bacteria | 8365 |
| 50 | Ga0123357_10166721 | 3300009784 | Bacteria | 2620 |
| 51 | Ga0123357_10200380 | 3300009784 | Bacteria | 2273 |
| 52 | Ga0123355_10000293 | 3300009826 | Bacteria | 64130 |
| 53 | Ga0123355_10000656 | 3300009826 | Bacteria | 46915 |
| 54 | Ga0466706_033904 | 3300042599 | Bacteria | 3450 |
| 55 | Ga0466714_029564 | 3300042603 | Bacteria | 43960 |
| 56 | Ga0466716_302438 | 3300042605 | Bacteria | 1661 |
| 57 | Ga0466719_173527 | 3300042606 | Bacteria | 2023 |
| 58 | gam1t_NODE_134930_length=9614_GC=34_4_Contigs=9 | 2189573031 | Bacteria | 9694 |
| 59 | IMNBL1DRAFT_c0002484 | 3300000062 | Bacteria | 12800 |
| 60 | HBC_ctgsDRAFT_1000305 | 3300000333 | Bacteria | 11186 |
| 61 | JGI24705J35276_12230527 | 3300002504 | Bacteria | 3653 |
| 62 | CVPL005W_1000049 | 3300002934 | Bacteria | 77363 |
| 63 | Ga0072941_1144886 | 3300005201 | Bacteria | 11982 |
| 64 | Ga0074278_152215 | 3300005721 | Bacteria | 18557 |
| 65 | Ga0127530_100507 | 3300009468 | Bacteria | 23482 |
| 66 | Ga0466705_124899 | 3300042612 | Bacteria | 2532 |
| 67 | Ga0466733_073609 | 3300042659 | Bacteria | 2058 |
| 68 | Ga0562379_0088 | 3300056790 | Bacteria | 331945 |
| 69 | Ga0562377_1815 | 3300056842 | Bacteria | 19380 |
| 70 | Ga0562376_1184 | 3300056857 | Bacteria | 38269 |
| 71 | Ga0160441_100110 | 3300012825 | Bacteria | 96916 |
| 72 | Ga0255809_1006150 | 3300022820 | Bacteria | 1255 |
| 73 | Ga0415639_066625 | 3300038395 | Bacteria | 3021 |
| 74 | Ga0466703_067905 | 3300042636 | Bacteria | 3478 |
| 75 | Ga0466703_358525 | 3300042636 | Bacteria | 3523 |
| 76 | Ga0466724_32047 | 3300042649 | Bacteria | 4436 |
| 77 | Ga0466715_240988 | 3300042616 | Bacteria | 2702 |
| 78 | Ga0466718_017153 | 3300042617 | Unclassified | 8853 |
| 79 | Ga0466726_082666 | 3300042619 | Bacteria | 4080 |
| 80 | Ga0123355_10003585 | 3300009826 | Bacteria | 22336 |
| 81 | Ga0123355_10083869 | 3300009826 | Bacteria | 5078 |
| 82 | Ga0123356_10010579 | 3300010049 | Bacteria | 9044 |
| 83 | Ga0123354_10115846 | 3300010882 | Unclassified | 3500 |
| 84 | Ga0466701_064830 | 3300042598 | Bacteria | 186218 |
| 85 | Ga0466706_272633 | 3300042599 | Bacteria | 22826 |
| 86 | Ga0466713_031828 | 3300042602 | Bacteria | 1768 |
| 87 | Ga0466716_220570 | 3300042605 | Bacteria | 4858 |
| 88 | Ga0466719_380735 | 3300042606 | Bacteria | 1446 |
| 89 | gam1t_NODE_55222_length=18497_GC=35_5_Contigs=7 | 2189573031 | Bacteria | 18557 |
| 90 | gam1t_NODE_571512_length=6119_GC=33_5_Contigs=5 | 2189573031 | Bacteria | 6159 |
| 91 | gam1t_NODE_613397_length=82390_GC=33_2_Contigs=4 | 2189573031 | Bacteria | 82420 |
| 92 | JGI24702J35022_10009546 | 3300002462 | Bacteria | 5439 |
| 93 | CVPL005L_10001055 | 3300002938 | Bacteria | 30997 |
| 94 | Ga0072941_1436110 | 3300005201 | Bacteria | 2151 |
| 95 | Ga0074278_101327 | 3300005721 | Unclassified | 9694 |
| 96 | Ga0103264_1003922 | 3300007188 | Bacteria | 6933 |
| 97 | Ga0105005_1004567 | 3300007505 | Unclassified | 3069 |
| 98 | Ga0127656_100083 | 3300009453 | Bacteria | 72717 |
| 99 | Ga0466733_063298 | 3300042659 | Bacteria | 1745 |
| 100 | Ga0466733_118579 | 3300042659 | Bacteria | 3555 |
| 101 | Ga0415639_003672 | 3300038395 | Bacteria | 6198 |
| 102 | Ga0415639_005997 | 3300038395 | Bacteria | 24747 |
| 103 | Ga0415639_011721 | 3300038395 | Bacteria | 14540 |
| 104 | Ga0466690_090724 | 3300042590 | Bacteria | 4899 |
| 105 | Ga0466691_078506 | 3300042593 | Bacteria | 7175 |
| 106 | Ga0466694_154070 | 3300042594 | Bacteria | 6809 |
| 107 | Ga0466694_407510 | 3300042594 | Bacteria | 2038 |
| 108 | Ga0466696_006082 | 3300042596 | Bacteria | 5176 |
| 109 | Ga0466696_374751 | 3300042596 | Bacteria | 11496 |
| 110 | Ga0466699_133233 | 3300042597 | Bacteria | 4607 |
| 111 | Ga0466730_016012 | 3300042625 | Bacteria | 4702 |
| 112 | Ga0466725_445432 | 3300042654 | Bacteria | 5416 |
| 113 | Ga0466710_410014 | 3300042613 | Bacteria | 6149 |
| 114 | Ga0466715_618524 | 3300042616 | Bacteria | 2685 |
| 115 | Ga0466723_020354 | 3300042618 | Bacteria | 7324 |
| 116 | Ga0466728_376399 | 3300042620 | Bacteria | 7285 |
| 117 | Ga0123355_10008818 | 3300009826 | Bacteria | 15257 |
| 118 | Ga0123353_10427459 | 3300010167 | Bacteria | 1960 |
| 119 | Ga0466719_106851 | 3300042606 | Bacteria | 6102 |
| 120 | Ga0466722_125702 | 3300042609 | Bacteria | 4817 |
| 121 | Ga0466722_248824 | 3300042609 | Bacteria | 19685 |
| 122 | CVPL010W_10009081 | 3300002931 | Bacteria | 9154 |
| 123 | Ga0074278_130897 | 3300005721 | Unclassified | 6159 |
| 124 | Ga0103264_1000044 | 3300007188 | Bacteria | 70873 |
| 125 | Ga0103264_1000072 | 3300007188 | Bacteria | 61230 |
| 126 | Ga0103267_1000153 | 3300007190 | Bacteria | 27119 |
| 127 | Ga0466705_194045 | 3300042612 | Bacteria | 39862 |
| 128 | Ga0466733_133480 | 3300042659 | Bacteria | 3217 |
| 129 | Ga0562377_0036 | 3300056842 | Bacteria | 678424 |
| 130 | Ga0160452_100889 | 3300012834 | Bacteria | 11972 |
| 131 | Ga0223683_1113386 | 3300021245 | Bacteria | 1258 |
| 132 | Ga0415639_016124 | 3300038395 | Bacteria | 4270 |
| 133 | Ga0415639_127066 | 3300038395 | Bacteria | 8711 |
| 134 | Ga0466695_174990 | 3300042595 | Bacteria | 1947 |
| 135 | Ga0466696_437991 | 3300042596 | Bacteria | 7481 |
| 136 | Ga0466699_351595 | 3300042597 | Unclassified | 3608 |
| 137 | Ga0466730_029491 | 3300042625 | Bacteria | 3583 |
| 138 | Ga0466703_251854 | 3300042636 | Bacteria | 17454 |
| 139 | Ga0466704_145132 | 3300042643 | Bacteria | 19435 |
| 140 | Ga0466704_541617 | 3300042643 | Bacteria | 2406 |
| 141 | Ga0466705_498057 | 3300042612 | Unclassified | 1168 |
| 142 | Ga0466711_441466 | 3300042615 | Bacteria | 8419 |
| 143 | Ga0466726_115855 | 3300042619 | Bacteria | 4341 |
| 144 | Ga0123355_10001164 | 3300009826 | Bacteria | 36435 |
| 145 | Ga0123355_10001521 | 3300009826 | Bacteria | 32339 |
| 146 | Ga0123356_10150406 | 3300010049 | Bacteria | 2310 |
| 147 | Ga0466706_203459 | 3300042599 | Bacteria | 4268 |
| 148 | Ga0466707_255706 | 3300042601 | Bacteria | 12287 |
| 149 | Ga0466713_080293 | 3300042602 | Bacteria | 1485 |
| 150 | Ga0466714_055757 | 3300042603 | Unclassified | 3000 |
| 151 | Ga0466714_072048 | 3300042603 | Bacteria | 15374 |
| 152 | Ga0466720_081044 | 3300042607 | Bacteria | 1616 |
| 153 | Ga0466722_123747 | 3300042609 | Bacteria | 4485 |
| 154 | Ga0466722_230158 | 3300042609 | Bacteria | 1336 |
| 155 | Ga0466698_433681 | 3300042610 | Bacteria | 1797 |
| 156 | gam1t_NODE_712889_length=11153_GC=34_2_Contigs=5 | 2189573031 | Bacteria | 11193 |
| 157 | 2227483822 | 2225789004 | Bacteria | 4332 |
| 158 | JGI24698J34947_10003888 | 3300002449 | Bacteria | 8124 |
| 159 | JGI24703J35330_11543856 | 3300002501 | Bacteria | 1209 |
| 160 | JGI24703J35330_11748403 | 3300002501 | Bacteria | 15446 |
| 161 | Ga0074278_121064 | 3300005721 | Unclassified | 11193 |
| 162 | Ga0102734_1000201 | 3300007129 | Bacteria | 19206 |
| 163 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 164 | Ga0562379_0058 | 3300056790 | Bacteria | 476404 |
| 165 | Ga0562378_0110 | 3300056814 | Bacteria | 213613 |
| 166 | Ga0562375_0014 | 3300056856 | Bacteria | 1185783 |
| 167 | Ga0160455_102622 | 3300012837 | Bacteria | 3530 |
| 168 | Ga0466704_180359 | 3300042643 | Bacteria | 3742 |
| 169 | Ga0466704_372723 | 3300042643 | Bacteria | 8925 |
| 170 | Ga0466710_174988 | 3300042613 | Bacteria | 3855 |
| 171 | Ga0466728_055868 | 3300042620 | Bacteria | 6126 |
| 172 | Ga0466728_179607 | 3300042620 | Bacteria | 19336 |
| 173 | Ga0466728_365450 | 3300042620 | Bacteria | 3407 |
| 174 | Ga0123355_10074004 | 3300009826 | Bacteria | 5457 |
| 175 | Ga0123355_10432716 | 3300009826 | Bacteria | 1672 |
| 176 | Ga0123356_10078806 | 3300010049 | Bacteria | 3111 |
| 177 | Ga0123356_10104293 | 3300010049 | Bacteria | 2725 |
| 178 | Ga0123353_10003782 | 3300010167 | Bacteria | 19288 |
| 179 | Ga0123353_10530508 | 3300010167 | Bacteria | 1705 |
| 180 | Ga0466706_153196 | 3300042599 | Unclassified | 3806 |
| 181 | Ga0466714_154815 | 3300042603 | Bacteria | 2740 |
| 182 | Ga0466721_353757 | 3300042608 | Bacteria | 2877 |
| 183 | IMNBGM34_c000395 | 3300000036 | Bacteria | 12299 |
| 184 | SCG598L16_135905 | 3300000490 | Bacteria | 30184 |
| 185 | JGI24698J34947_10000376 | 3300002449 | Unclassified | 20033 |
| 186 | JGI24702J35022_10000896 | 3300002462 | Bacteria | 18523 |
| 187 | JGI24703J35330_11748823 | 3300002501 | Bacteria | 41152 |
| 188 | Ga0074278_109517 | 3300005721 | Bacteria | 2538 |
| 189 | Ga0102738_1000316 | 3300007141 | Unclassified | 8735 |
| 190 | Ga0102737_1002898 | 3300007142 | Bacteria | 4092 |
| 191 | Ga0466705_307221 | 3300042612 | Bacteria | 11387 |
| 192 | Ga0160452_100351 | 3300012834 | Bacteria | 38802 |
| 193 | Ga0160448_109197 | 3300012854 | Bacteria | 2191 |
| 194 | Ga0415639_024157 | 3300038395 | Bacteria | 8346 |
| 195 | Ga0415639_088771 | 3300038395 | Bacteria | 10824 |
| 196 | Ga0120204_000106 | 3300038942 | Bacteria | 3999 |
| 197 | Ga0466657_022505 | 3300042582 | Bacteria | 3326 |
| 198 | Ga0466694_401453 | 3300042594 | Bacteria | 2143 |
| 199 | Ga0466696_228175 | 3300042596 | Bacteria | 1905 |
| 200 | Ga0466699_273142 | 3300042597 | Bacteria | 4115 |
| 201 | Ga0466699_311570 | 3300042597 | Bacteria | 1407 |
| 202 | Ga0466731_090668 | 3300042622 | Bacteria | 2809 |
| 203 | Ga0466704_168985 | 3300042643 | Bacteria | 3708 |
| 204 | Ga0466710_393164 | 3300042613 | Bacteria | 2081 |
| 205 | Ga0466726_400944 | 3300042619 | Bacteria | 4556 |
| 206 | Ga0466728_181308 | 3300042620 | Bacteria | 9833 |
| 207 | Ga0123355_10147531 | 3300009826 | Bacteria | 3582 |
| 208 | Ga0123353_10279070 | 3300010167 | Bacteria | 2567 |
| 209 | Ga0466701_065937 | 3300042598 | Bacteria | 1585 |
| 210 | Ga0466706_070713 | 3300042599 | Bacteria | 26399 |
| 211 | SCG598B02_13270 | 3300000472 | Bacteria | 26366 |
| 212 | JGI24703J35330_11747909 | 3300002501 | Bacteria | 9002 |
| 213 | Ga0063521_1002019 | 3300003973 | Bacteria | 5119 |
| 214 | Ga0466733_100030 | 3300042659 | Bacteria | 1956 |
| 215 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 216 | Ga0466693_152123 | 3300042592 | Bacteria | 7367 |
| 217 | Ga0466693_300811 | 3300042592 | Unclassified | 1072 |
| 218 | Ga0466694_158310 | 3300042594 | Bacteria | 2964 |
| 219 | Ga0466709_233970 | 3300042648 | Bacteria | 334556 |
| 220 | Ga0466724_27818 | 3300042649 | Bacteria | 2718 |
| 221 | Ga0466725_056150 | 3300042654 | Bacteria | 2590 |
| 222 | Ga0466711_098312 | 3300042615 | Bacteria | 11347 |
| 223 | Ga0466715_319453 | 3300042616 | Bacteria | 71623 |
| 224 | Ga0466715_328510 | 3300042616 | Bacteria | 8966 |
| 225 | Ga0466718_042899 | 3300042617 | Bacteria | 2681 |
| 226 | Ga0466718_162106 | 3300042617 | Bacteria | 6058 |
| 227 | Ga0466723_148676 | 3300042618 | Bacteria | 5556 |
| 228 | Ga0123353_10002284 | 3300010167 | Bacteria | 23790 |
| 229 | Ga0123353_10121885 | 3300010167 | Bacteria | 4192 |
| 230 | Ga0466706_180593 | 3300042599 | Bacteria | 4714 |
| 231 | Ga0466700_133291 | 3300042600 | Bacteria | 1400 |
| 232 | Ga0466713_100538 | 3300042602 | Bacteria | 188125 |
| 233 | Ga0466720_208084 | 3300042607 | Unclassified | 2354 |
| 234 | Ga0466698_372718 | 3300042610 | Unclassified | 1178 |
| 235 | 2212578784 | 2209111004 | Bacteria | 7010 |
| 236 | 2227080784 | 2225789004 | Bacteria | 153522 |
| 237 | IMNBL1DRAFT_c0001158 | 3300000062 | Bacteria | 20076 |
| 238 | HBC_ctgsDRAFT_1003716 | 3300000333 | Bacteria | 3507 |
| 239 | JGI24698J34947_10074019 | 3300002449 | Unclassified | 1623 |
| 240 | CVPL010W_10006723 | 3300002931 | Bacteria | 11646 |
| 241 | CVPL005W_1000236 | 3300002934 | Bacteria | 24542 |
| 242 | Ga0063521_1000077 | 3300003973 | Bacteria | 80247 |
| 243 | Ga0063521_1000573 | 3300003973 | Bacteria | 15726 |
| 244 | Ga0074278_144632 | 3300005721 | Bacteria | 82420 |
| 245 | Ga0102735_1000163 | 3300007080 | Bacteria | 19075 |
| 246 | Ga0102737_1007226 | 3300007142 | Bacteria | 2041 |
| 247 | Ga0103264_1000030 | 3300007188 | Bacteria | 85624 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00266 | Aminotran_5 | Aminotransferase class-V | 61 | 405 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.