Protein Family IF00218
Metagenome
Isolate
513
Members
447
Samples
143
Scaffolds
225.08
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0002274|IMNBL1DRAFT_000227412
- Length
- 253 aa
- Sequence
- MNYLPYTVDLKKLNQMNGLNIQENIVRDFLIAPSILSADFARLGEDTQKVLDAGADVIHFDVMDNHYVPNLTIGPMVCQALRDYGITAPIDVHLMVKPVDRIIPDFAKAGASYISFHPEASEHVDRTLQLIKSCGCKTGLVFNPATSLSHLDYVMDKVDVILLMSVNPGFGGQSFIPATLDKLRQVRQRIDQSGYDIRLEVDGGVKVDNIAEIAQAGADMFVAGSAIFGHSDYKEIIDQMRSELAKTPGLTC*
Sample Types
Isolate
72.1%
Metagenome
27.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.2%
Apidae
20.1%
Aphididae
8.1%
Drosophilidae
5.7%
Anthocoridae
5.0%
Curculionidae
4.1%
Formicidae
3.6%
Muscidae
3.1%
Termitidae
2.6%
Culicidae
2.6%
Elmidae
2.2%
Calliphoridae
2.2%
Tenebrionidae
1.9%
Tephritidae
1.2%
Ixodidae
1.0%
Cerambycidae
1.0%
Talitridae
0.7%
Armadillidiidae
0.7%
Palinuridae
0.7%
Aleyrodidae
0.7%
Pteromalidae
0.7%
Kalotermitidae
0.5%
Argasidae
0.5%
Pentatomidae
0.5%
Sarcophagidae
0.5%
Plutellidae
0.5%
Majidae
0.5%
Passalidae
0.5%
Thripidae
0.2%
Anthomyiidae
0.2%
Pediculidae
0.2%
Artemiidae
0.2%
Cixiidae
0.2%
Gryllidae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Nephropidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Aphalaridae
0.2%
Psyllidae
0.2%
Daphniidae
0.2%
Aphrophoridae
0.2%
Hodotermitidae
0.2%
Cicadellidae
0.2%
Siricidae
0.2%
Triozidae
0.2%
Crambidae
0.2%
Taxonomy
Archaea
0
Bacteria
482
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 2 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 3 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 4 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 5 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 6 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 7 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 8 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 9 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 10 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 11 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 12 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 13 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 14 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 15 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 16 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 17 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 18 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 19 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 20 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 21 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 22 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 23 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 24 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 25 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 26 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 27 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 28 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 29 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 30 | 2958255616 | Serratia marcescens TM | Isolate | |
| 31 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 32 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 33 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 34 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 35 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 40 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 41 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 42 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 43 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 44 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 45 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 46 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 47 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 48 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 49 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 50 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 51 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 52 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 53 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 54 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 55 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 56 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 57 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 58 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 59 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 60 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 61 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 62 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 63 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 64 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 65 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 66 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 67 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 68 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 69 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 70 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 71 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 72 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 73 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 74 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 75 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 76 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 77 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 78 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 79 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 80 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 81 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 82 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 83 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 84 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 85 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 86 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 87 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 88 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 89 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 90 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 91 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 92 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 93 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 94 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 95 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 96 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 97 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 98 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 99 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 100 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 101 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 102 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 103 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 104 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 105 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 106 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 107 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 108 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 109 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 110 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 111 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 112 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 113 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 114 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 115 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 116 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 117 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 118 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 119 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 120 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 121 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 122 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 123 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 124 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 125 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 126 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 127 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 128 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 129 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 130 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 131 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 132 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 133 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 134 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 135 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 136 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 137 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 138 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 139 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 140 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 141 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 142 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 143 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 144 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 145 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 146 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 147 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 148 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 149 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 150 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 151 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 152 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 153 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 154 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 155 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 156 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 157 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 158 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 159 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 160 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 161 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 162 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 163 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 164 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 165 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 166 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 167 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 168 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 169 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 170 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 171 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 172 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 173 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 174 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 175 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 176 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 177 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 178 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 179 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 180 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 181 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 182 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 183 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 184 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 185 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 186 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 187 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 188 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 189 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 190 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 191 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 192 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 193 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 194 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 195 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 196 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 197 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 198 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 199 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 200 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 201 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 202 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 203 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 204 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 205 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 206 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 207 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 208 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 209 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 210 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 211 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 212 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 213 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 214 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 215 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 216 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 217 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 218 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 219 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 220 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 221 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 222 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 223 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 224 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 225 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 226 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 227 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 228 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 229 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 230 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 231 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 232 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 233 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 234 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 235 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 236 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 237 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 238 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 239 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 240 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 241 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 242 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 243 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 244 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 245 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 246 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 247 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 248 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 249 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 250 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 251 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 252 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 253 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 254 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 255 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 256 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 257 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 258 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 259 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 260 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 261 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 262 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 263 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 264 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 265 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 266 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 267 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 268 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 269 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 270 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 271 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 272 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 273 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 274 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 275 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 276 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 277 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 278 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 279 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 280 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 281 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 282 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 283 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 284 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 285 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 286 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 287 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 288 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 289 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 290 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 291 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 292 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 293 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 294 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 295 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 296 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 297 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 298 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 299 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 300 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 301 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 302 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 303 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 304 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 305 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 306 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 307 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 308 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 309 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 310 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 311 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 312 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 313 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 314 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 315 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 316 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 317 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 318 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 319 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 320 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 321 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 322 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 323 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 324 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 325 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 326 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 327 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 328 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 329 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 330 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 331 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 332 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 333 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 334 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 335 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 336 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 337 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 338 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 339 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 340 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 341 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 342 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 343 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 344 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 345 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 346 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 347 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 348 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 349 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 350 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 351 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 352 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 353 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 354 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 355 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 356 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 357 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 358 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 359 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 360 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 361 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 362 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 363 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 364 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 365 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 366 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 367 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 368 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 369 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 370 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 371 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 372 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 373 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 374 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 375 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 376 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 377 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 378 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 379 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 380 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 381 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 382 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 383 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 384 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 385 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 386 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 387 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 388 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 389 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 390 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 391 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 392 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 393 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 394 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 395 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 396 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 397 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 398 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 399 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 400 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 401 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 402 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 403 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 404 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 405 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 406 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 407 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 408 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 409 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 410 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 411 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 412 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 413 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 414 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 415 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 416 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 417 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 418 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 419 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 420 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 421 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 422 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 423 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 424 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 425 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 426 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 427 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 428 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 429 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 430 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 431 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 432 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 433 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 434 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 435 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 436 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 437 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 438 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 439 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 440 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 441 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 442 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 443 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 444 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 445 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 446 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 447 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_115437 | 3300042612 | Bacteria | 76604 |
| 2 | Ga0160456_101641 | 3300012820 | Bacteria | 5055 |
| 3 | Ga0316159_10982 | 3300030930 | Bacteria | 3908 |
| 4 | Ga0247289_0723 | 3300035363 | Bacteria | 4202 |
| 5 | Ga0136159_1000107 | 3300010217 | Bacteria | 71535 |
| 6 | SWWA_contig31768__length_7989___numreads_448 | 2100351016 | Bacteria | 7989 |
| 7 | HBC_ctgsDRAFT_1001166 | 3300000333 | Bacteria | 5748 |
| 8 | SCG598B02_12384 | 3300000472 | Unclassified | 25188 |
| 9 | Ga0063521_1000131 | 3300003973 | Bacteria | 56876 |
| 10 | Ga0074278_149020 | 3300005721 | Unclassified | 6297 |
| 11 | Ga0103265_1015498 | 3300007068 | Unclassified | 998 |
| 12 | Ga0102739_1002277 | 3300007095 | Bacteria | 2994 |
| 13 | Ga0104041_1112656 | 3300007106 | Bacteria | 1683 |
| 14 | Ga0127530_106766 | 3300009468 | Bacteria | 4147 |
| 15 | Ga0127653_100120 | 3300009471 | Bacteria | 188812 |
| 16 | Ga0466730_097102 | 3300042625 | Unclassified | 13760 |
| 17 | Ga0466725_142731 | 3300042654 | Bacteria | 5354 |
| 18 | Ga0160436_1010966 | 3300012861 | Bacteria | 1954 |
| 19 | Ga0247290_00771 | 3300035364 | Unclassified | 4826 |
| 20 | Ga0415639_036352 | 3300038395 | Bacteria | 8936 |
| 21 | Ga0466707_070416 | 3300042601 | Bacteria | 77540 |
| 22 | Ga0466713_143957 | 3300042602 | Bacteria | 200019 |
| 23 | IMNBL1DRAFT_c0002274 | 3300000062 | Bacteria | 13522 |
| 24 | HBC_ctgsDRAFT_1057894 | 3300000333 | Bacteria | 935 |
| 25 | SCG598L16_122406 | 3300000490 | Bacteria | 16104 |
| 26 | WW0001_100140 | 3300002732 | Bacteria | 110492 |
| 27 | Ga0074278_146523 | 3300005721 | Bacteria | 43570 |
| 28 | Ga0103266_1002230 | 3300007067 | Bacteria | 4879 |
| 29 | Ga0104019_1000176 | 3300007150 | Bacteria | 3952 |
| 30 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 31 | Ga0127657_102179 | 3300009457 | Bacteria | 33619 |
| 32 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 33 | Ga0466730_002608 | 3300042625 | Unclassified | 12140 |
| 34 | Ga0466730_015494 | 3300042625 | Unclassified | 1421 |
| 35 | Ga0466725_297168 | 3300042654 | Bacteria | 2457 |
| 36 | Ga0160472_100039 | 3300012839 | Bacteria | 240625 |
| 37 | Ga0160433_106575 | 3300012846 | Bacteria | 1644 |
| 38 | Ga0466707_186123 | 3300042601 | Unclassified | 1562 |
| 39 | Ga0466707_316956 | 3300042601 | Bacteria | 6988 |
| 40 | FGTW_contig00261 | 2065487013 | Unclassified | 4798 |
| 41 | HBC_ctgsDRAFT_1022518 | 3300000333 | Unclassified | 1541 |
| 42 | Ga0103260_1006367 | 3300007139 | Bacteria | 1704 |
| 43 | Ga0104147_1101489 | 3300007224 | Bacteria | 9142 |
| 44 | Ga0127655_1002103 | 3300009459 | Bacteria | 66905 |
| 45 | Ga0466730_001031 | 3300042625 | Unclassified | 1020 |
| 46 | Ga0466724_01460 | 3300042649 | Unclassified | 16857 |
| 47 | Ga0466724_15499 | 3300042649 | Bacteria | 16617 |
| 48 | Ga0466724_20054 | 3300042649 | Bacteria | 88002 |
| 49 | Ga0466724_22862 | 3300042649 | Bacteria | 6381 |
| 50 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 51 | Ga0562377_0485 | 3300056842 | Bacteria | 64072 |
| 52 | Ga0160433_100072 | 3300012846 | Bacteria | 108277 |
| 53 | Ga0160445_112118 | 3300012847 | Unclassified | 1240 |
| 54 | Ga0160434_102130 | 3300012850 | Unclassified | 3478 |
| 55 | Ga0265387_1000041 | 3300024582 | Bacteria | 42338 |
| 56 | Ga0316159_12026 | 3300030930 | Bacteria | 3480 |
| 57 | Ga0247289_0113 | 3300035363 | Unclassified | 21398 |
| 58 | Ga0247290_00210 | 3300035364 | Unclassified | 17205 |
| 59 | Ga0466694_372162 | 3300042594 | Bacteria | 2308 |
| 60 | Ga0160454_100333 | 3300012798 | Bacteria | 33468 |
| 61 | gam1t_NODE_683793_length=6267_GC=36_1_Contigs=4 | 2189573031 | Bacteria | 6297 |
| 62 | Ga0063521_1000435 | 3300003973 | Bacteria | 21691 |
| 63 | Ga0074188_1000287 | 3300005318 | Bacteria | 18151 |
| 64 | Ga0103264_1003093 | 3300007188 | Bacteria | 7993 |
| 65 | Ga0103267_1066363 | 3300007190 | Bacteria | 1133 |
| 66 | Ga0105553_1033961 | 3300007767 | Bacteria | 34168 |
| 67 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 68 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 69 | Ga0466730_003903 | 3300042625 | Bacteria | 30154 |
| 70 | Ga0466730_022258 | 3300042625 | Bacteria | 4109 |
| 71 | Ga0466724_24456 | 3300042649 | Bacteria | 16838 |
| 72 | Ga0466725_281656 | 3300042654 | Bacteria | 1051 |
| 73 | Ga0562375_0011 | 3300056856 | Bacteria | 1302371 |
| 74 | Ga0160433_102782 | 3300012846 | Unclassified | 3509 |
| 75 | Ga0466701_038078 | 3300042598 | Bacteria | 27476 |
| 76 | Ga0466701_048042 | 3300042598 | Bacteria | 56656 |
| 77 | DPOL_contig02592 | 2035918003 | Unclassified | 17819 |
| 78 | Meta3P_1000089 | 3300002464 | Bacteria | 81100 |
| 79 | Meta3P_1002440 | 3300002464 | Bacteria | 6305 |
| 80 | CVPL010L_1001363 | 3300002932 | Unclassified | 5854 |
| 81 | Ga0063521_1000133 | 3300003973 | Bacteria | 55555 |
| 82 | Ga0074278_109205 | 3300005721 | Unclassified | 20571 |
| 83 | Ga0127645_101855 | 3300009461 | Bacteria | 7648 |
| 84 | Ga0466724_04675 | 3300042649 | Bacteria | 51593 |
| 85 | Ga0466724_21855 | 3300042649 | Bacteria | 50243 |
| 86 | Ga0160431_102744 | 3300012828 | Unclassified | 3945 |
| 87 | Ga0160447_101730 | 3300012849 | Unclassified | 8239 |
| 88 | Ga0415639_074506 | 3300038395 | Bacteria | 2013 |
| 89 | Ga0123356_10650165 | 3300010049 | Bacteria | 1221 |
| 90 | Ga0466707_340550 | 3300042601 | Bacteria | 35760 |
| 91 | FGTW_contig02810 | 2065487013 | Unclassified | 2083 |
| 92 | SWWA_contig07006__length_6725___numreads_124 | 2100351016 | Bacteria | 6725 |
| 93 | CVPL005L_10007262 | 3300002938 | Bacteria | 10530 |
| 94 | Ga0063521_1000314 | 3300003973 | Bacteria | 29286 |
| 95 | Ga0103261_1002557 | 3300007083 | Bacteria | 4845 |
| 96 | Ga0104049_1131189 | 3300007103 | Bacteria | 3357 |
| 97 | Ga0104041_1001653 | 3300007106 | Bacteria | 8065 |
| 98 | Ga0102737_1000868 | 3300007142 | Bacteria | 9246 |
| 99 | Ga0105008_1000113 | 3300007507 | Unclassified | 3077 |
| 100 | Ga0127656_100969 | 3300009453 | Bacteria | 16558 |
| 101 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 102 | Ga0466730_071553 | 3300042625 | Bacteria | 12978 |
| 103 | Ga0466725_287474 | 3300042654 | Bacteria | 1098 |
| 104 | Ga0160441_102331 | 3300012825 | Unclassified | 3945 |
| 105 | Ga0160441_102416 | 3300012825 | Unclassified | 3815 |
| 106 | Ga0160460_101139 | 3300012845 | Unclassified | 10350 |
| 107 | Ga0123353_11259603 | 3300010167 | Bacteria | 964 |
| 108 | Ga0466713_085273 | 3300042602 | Bacteria | 11846 |
| 109 | DPOL_contig15172 | 2035918003 | Bacteria | 24635 |
| 110 | FGTW_contig30417 | 2065487013 | Bacteria | 71135 |
| 111 | FGTW_contig30709 | 2065487013 | Unclassified | 7510 |
| 112 | gam1t_NODE_593770_length=43570_GC=36_1_Contigs=1 | 2189573031 | Bacteria | 43570 |
| 113 | SCG598P17_12930 | 3300000461 | Unclassified | 63011 |
| 114 | SCG598I20_12713 | 3300000473 | Bacteria | 30771 |
| 115 | CVPL010L_1000084 | 3300002932 | Bacteria | 42976 |
| 116 | Ga0063521_1000193 | 3300003973 | Bacteria | 44530 |
| 117 | Ga0074311_1004456 | 3300005317 | Bacteria | 1550 |
| 118 | Ga0102738_1001227 | 3300007141 | Bacteria | 4013 |
| 119 | Ga0105005_1032317 | 3300007505 | Bacteria | 12596 |
| 120 | Ga0127530_100162 | 3300009468 | Bacteria | 26462 |
| 121 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 122 | Ga0466711_150400 | 3300042615 | Bacteria | 11258 |
| 123 | Ga0466730_086262 | 3300042625 | Bacteria | 4647 |
| 124 | Ga0466730_092827 | 3300042625 | Unclassified | 1377 |
| 125 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 126 | Ga0562375_0278 | 3300056856 | Bacteria | 131571 |
| 127 | Ga0562375_1094 | 3300056856 | Bacteria | 41491 |
| 128 | Ga0265387_1001207 | 3300024582 | Bacteria | 3817 |
| 129 | Ga0466657_124147 | 3300042582 | Bacteria | 6029 |
| 130 | Ga0466706_134655 | 3300042599 | Bacteria | 2593 |
| 131 | Ga0466713_152817 | 3300042602 | Bacteria | 97256 |
| 132 | FGTW_contig19326 | 2065487013 | Unclassified | 3354 |
| 133 | 2227080782 | 2225789004 | Bacteria | 166845 |
| 134 | CVPL010W_10008903 | 3300002931 | Bacteria | 9304 |
| 135 | Ga0063521_1000068 | 3300003973 | Bacteria | 87932 |
| 136 | Ga0102734_1000619 | 3300007129 | Bacteria | 20649 |
| 137 | Ga0103264_1018615 | 3300007188 | Bacteria | 3389 |
| 138 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 139 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 140 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 141 | Ga0466734_161237 | 3300042623 | Bacteria | 16094 |
| 142 | Ga0466724_16785 | 3300042649 | Bacteria | 209654 |
| 143 | Ga0466724_53957 | 3300042649 | Bacteria | 25987 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00834 | Ribul_P_3_epim | Ribulose-phosphate 3 epimerase family | 31 | 228 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.