Protein Family IF14155
Metagenome
Isolate
664
Members
343
Samples
229
Scaffolds
400.1
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8102109360|8102116758|
- Length
- 453 aa
- Sequence
- LHRTVDYDGCFDPRLPCHIHPSGWASNQRSIRNQRNAAASPRRGYGRAITGDFMRDAFICDAIRTPIGRYAGALSTVRADDLGAVPLRALMERNKDVDWNAIEEVIYGCANQAGEDNRNVARMSTLLAGLPQGVPGTTVNRLCGSGMDAIGVAARAIKAGEAGFLIAGGVESMSRAPFVLGKASSAFSRQADIYDTTIGWRFVNPLMRNQYGVDSMPETAENVADDFKVSRADQDAFALRSQQKASRAQKDGTLAQEIVPVTITQKKGDPLVVMQDEHPRDTSLEALAKLKGVVRPDGSVTAGNASGVNDGAAALILADEASAKRFGLVPRARILGLATAGVAPRVMGIGPAPATEKLLARLNMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGMSGARLVTTASYQLLRTQGRYALCTMCTGVGQGIAIAIERV
Sample Types
Isolate
65.5%
Metagenome
34.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
24.6%
Unclassified
18.8%
Elmidae
7.7%
Termitidae
5.2%
Culicidae
4.9%
Drosophilidae
4.9%
Apidae
4.3%
Anthocoridae
4.3%
Curculionidae
4.0%
Formicidae
2.8%
Tenebrionidae
2.2%
Armadillidiidae
2.2%
Kalotermitidae
1.5%
Cerambycidae
1.2%
Sarcophagidae
0.9%
Tephritidae
0.9%
Largidae
0.6%
Nephropidae
0.6%
Plutellidae
0.6%
Berytidae
0.6%
Pentatomidae
0.6%
Daphniidae
0.6%
Hydrophilidae
0.6%
Alydidae
0.6%
Trigoniulidae
0.3%
Pteromalidae
0.3%
Rhopalidae
0.3%
Rhinotermitidae
0.3%
Carabidae
0.3%
Siricidae
0.3%
Passalidae
0.3%
Calliphoridae
0.3%
Crambidae
0.3%
Thripidae
0.3%
Pediculidae
0.3%
Hodotermitidae
0.3%
Noctuidae
0.3%
Cambaridae
0.3%
Muscidae
0.3%
Taxonomy
Archaea
0
Bacteria
621
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 3 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 4 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 5 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 6 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 7 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 8 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 9 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 10 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 11 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 12 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 13 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 14 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 15 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 21 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 22 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 23 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 24 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 25 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 26 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 27 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 28 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 29 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 30 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 31 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 32 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 33 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 34 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 35 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 36 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 37 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 38 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 39 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 40 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 41 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 42 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 43 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 44 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 45 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 46 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 47 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 48 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 49 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 50 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 51 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 52 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 53 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 54 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 58 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 59 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 60 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 61 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 62 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 63 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 64 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 65 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 66 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 67 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 68 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 69 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 70 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 71 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 72 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 73 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 74 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 75 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 76 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 77 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 78 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 79 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 80 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 81 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 82 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 83 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 84 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 85 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 86 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 87 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 88 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 89 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 90 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 91 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 92 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 93 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 94 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 95 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 96 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 97 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 98 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 99 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 100 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 101 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 102 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 103 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 104 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 105 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 106 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 107 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 108 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 109 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 110 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 111 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 112 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 113 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 114 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 115 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 116 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 117 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 118 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 119 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 120 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 121 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 122 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 123 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 124 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 125 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 126 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 127 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 128 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 129 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 130 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 131 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 132 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 133 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 134 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 135 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 136 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 137 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 138 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 139 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 140 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 141 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 142 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 143 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 144 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 145 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 146 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 147 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 148 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 149 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 150 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 151 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 152 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 153 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 154 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 155 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 156 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 157 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 158 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 159 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 160 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 161 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 162 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 163 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 164 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 165 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 166 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 167 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 168 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 169 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 170 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 171 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 172 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 173 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 174 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 175 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 176 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 177 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 178 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 179 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 180 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 181 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 182 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 183 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 184 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 185 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 186 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 187 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 188 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 189 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 190 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 191 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 192 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 193 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 194 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 195 | 2958255616 | Serratia marcescens TM | Isolate | |
| 196 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 197 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 198 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 199 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 200 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 201 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 202 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 203 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 204 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 205 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 206 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 207 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 208 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 209 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 210 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 211 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 212 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 213 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 214 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 215 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 216 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 217 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 218 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 219 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 220 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 221 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 222 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 223 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 224 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 225 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 226 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 227 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 228 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 229 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 230 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 231 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 232 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 233 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 234 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 235 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 236 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 237 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 238 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 239 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 240 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 241 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 242 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 243 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 244 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 245 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 246 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 247 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 248 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 249 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 250 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 251 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 252 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 253 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 254 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 255 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 256 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 257 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 258 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 259 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 260 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 261 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 262 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 263 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 264 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 265 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 266 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 267 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 268 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 269 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 270 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 271 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 272 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 273 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 274 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 275 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 276 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 277 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 278 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 279 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 280 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 281 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 282 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 283 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 284 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 285 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 286 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 287 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 288 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 289 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 290 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 291 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 292 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 293 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 294 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 295 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 296 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 297 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 298 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 299 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 300 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 301 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 302 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 303 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 304 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 305 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 306 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 307 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 308 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 309 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 310 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 311 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 312 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 313 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 314 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 315 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 316 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 317 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 318 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 319 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 320 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 321 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 322 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 323 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 324 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 325 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 326 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 327 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 328 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 329 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 330 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 331 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 332 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 333 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 334 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 335 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 336 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 337 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 338 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 339 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 340 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 341 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 342 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 343 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_005798 | 3300042625 | Bacteria | 3944 |
| 2 | Ga0466730_086547 | 3300042625 | Bacteria | 310448 |
| 3 | Ga0466703_120977 | 3300042636 | Bacteria | 86906 |
| 4 | Ga0466704_414870 | 3300042643 | Bacteria | 4187 |
| 5 | Ga0466724_01971 | 3300042649 | Bacteria | 27453 |
| 6 | Ga0466724_26044 | 3300042649 | Bacteria | 8325 |
| 7 | Ga0466725_122789 | 3300042654 | Bacteria | 24832 |
| 8 | Ga0123355_10042919 | 3300009826 | Bacteria | 7359 |
| 9 | Ga0123356_10008394 | 3300010049 | Bacteria | 10270 |
| 10 | Ga0160470_100058 | 3300012813 | Bacteria | 160171 |
| 11 | Ga0466713_014808 | 3300042602 | Bacteria | 349625 |
| 12 | Ga0160472_100032 | 3300012839 | Bacteria | 274326 |
| 13 | Ga0160433_100423 | 3300012846 | Bacteria | 22491 |
| 14 | Ga0160443_100915 | 3300012848 | Unclassified | 13717 |
| 15 | Ga0160448_104524 | 3300012854 | Bacteria | 3836 |
| 16 | Ga0247290_00017 | 3300035364 | Unclassified | 64435 |
| 17 | DPOL_contig00262 | 2035918003 | Bacteria | 18404 |
| 18 | JGI24700J35501_10930849 | 3300002508 | Bacteria | 27960 |
| 19 | CVPL010L_1000037 | 3300002932 | Bacteria | 103923 |
| 20 | Ga0063521_1000031 | 3300003973 | Bacteria | 119916 |
| 21 | Ga0104045_1076481 | 3300007085 | Bacteria | 1678 |
| 22 | Ga0104050_1026477 | 3300007153 | Bacteria | 3651 |
| 23 | Ga0103267_1000036 | 3300007190 | Bacteria | 58694 |
| 24 | Ga0103268_1000156 | 3300007192 | Bacteria | 22306 |
| 25 | Ga0466730_022576 | 3300042625 | Bacteria | 23531 |
| 26 | Ga0466730_048978 | 3300042625 | Bacteria | 20818 |
| 27 | Ga0466730_085838 | 3300042625 | Bacteria | 2812 |
| 28 | Ga0466724_36753 | 3300042649 | Bacteria | 164646 |
| 29 | Ga0466724_38169 | 3300042649 | Bacteria | 71039 |
| 30 | Ga0466724_40729 | 3300042649 | Bacteria | 24497 |
| 31 | Ga0466725_163161 | 3300042654 | Unclassified | 6427 |
| 32 | Ga0123356_10008177 | 3300010049 | Unclassified | 10408 |
| 33 | Ga0123356_10012675 | 3300010049 | Bacteria | 8170 |
| 34 | Ga0123353_10075978 | 3300010167 | Bacteria | 5398 |
| 35 | Ga0466701_017095 | 3300042598 | Bacteria | 76328 |
| 36 | Ga0466701_025182 | 3300042598 | Bacteria | 2217 |
| 37 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 38 | Ga0466722_182501 | 3300042609 | Bacteria | 26510 |
| 39 | Ga0160446_103122 | 3300012835 | Bacteria | 2706 |
| 40 | Ga0160444_100182 | 3300012841 | Bacteria | 58003 |
| 41 | Ga0160460_101230 | 3300012845 | Bacteria | 9531 |
| 42 | Ga0160433_100029 | 3300012846 | Bacteria | 174368 |
| 43 | Ga0160445_100056 | 3300012847 | Bacteria | 130429 |
| 44 | Ga0160447_100918 | 3300012849 | Bacteria | 12414 |
| 45 | Ga0160447_104788 | 3300012849 | Unclassified | 3909 |
| 46 | Ga0160434_108281 | 3300012850 | Unclassified | 1713 |
| 47 | Ga0466657_105083 | 3300042582 | Bacteria | 15681 |
| 48 | Ga0466657_217169 | 3300042582 | Bacteria | 65749 |
| 49 | SPBB_contig00951 | 2044078006 | Bacteria | 21600 |
| 50 | Ga0103263_101384 | 3300007042 | Bacteria | 3149 |
| 51 | Ga0102739_1001108 | 3300007095 | Bacteria | 4581 |
| 52 | Ga0103267_1000141 | 3300007190 | Bacteria | 30888 |
| 53 | Ga0103267_1003172 | 3300007190 | Bacteria | 7361 |
| 54 | Ga0466710_204208 | 3300042613 | Bacteria | 2477 |
| 55 | Ga0466734_030971 | 3300042623 | Bacteria | 17562 |
| 56 | Ga0466734_075113 | 3300042623 | Bacteria | 12658 |
| 57 | Ga0466734_131958 | 3300042623 | Bacteria | 1135 |
| 58 | Ga0466730_096512 | 3300042625 | Bacteria | 3854 |
| 59 | Ga0466703_186795 | 3300042636 | Bacteria | 3876 |
| 60 | Ga0466724_12366 | 3300042649 | Bacteria | 33377 |
| 61 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 62 | Ga0466724_45417 | 3300042649 | Unclassified | 42426 |
| 63 | Ga0466724_55964 | 3300042649 | Bacteria | 144069 |
| 64 | Ga0123355_10158521 | 3300009826 | Unclassified | 3417 |
| 65 | Ga0123356_10001992 | 3300010049 | Bacteria | 22100 |
| 66 | Ga0160466_100386 | 3300012809 | Bacteria | 24872 |
| 67 | Ga0160471_100421 | 3300012812 | Bacteria | 12400 |
| 68 | Ga0466701_064891 | 3300042598 | Bacteria | 8625 |
| 69 | Ga0466717_085298 | 3300042604 | Bacteria | 6199 |
| 70 | Ga0160453_101071 | 3300012814 | Bacteria | 11879 |
| 71 | Ga0160469_100419 | 3300012824 | Bacteria | 21080 |
| 72 | Ga0160441_100709 | 3300012825 | Bacteria | 18592 |
| 73 | Ga0160467_100024 | 3300012829 | Bacteria | 296626 |
| 74 | Ga0160459_100846 | 3300012831 | Unclassified | 9780 |
| 75 | Ga0160460_103723 | 3300012845 | Unclassified | 2580 |
| 76 | Ga0160433_100199 | 3300012846 | Bacteria | 48442 |
| 77 | Ga0160435_1004496 | 3300012857 | Bacteria | 3230 |
| 78 | Ga0466657_046937 | 3300042582 | Bacteria | 3388 |
| 79 | Ga0466657_189399 | 3300042582 | Bacteria | 5319 |
| 80 | Ga0466694_019291 | 3300042594 | Bacteria | 4750 |
| 81 | DPO_contig07628 | 2032320009 | Bacteria | 104304 |
| 82 | DPOL_contig19208 | 2035918003 | Bacteria | 31872 |
| 83 | CVPL005L_10004397 | 3300002938 | Bacteria | 15110 |
| 84 | Ga0104019_1002995 | 3300007150 | Unclassified | 8019 |
| 85 | Ga0103268_1001409 | 3300007192 | Bacteria | 5985 |
| 86 | Ga0123357_10000130 | 3300009784 | Bacteria | 64947 |
| 87 | Ga0123357_10000190 | 3300009784 | Bacteria | 57536 |
| 88 | Ga0466705_403369 | 3300042612 | Bacteria | 7864 |
| 89 | Ga0466710_012610 | 3300042613 | Bacteria | 2685 |
| 90 | Ga0466730_006481 | 3300042625 | Bacteria | 3997 |
| 91 | Ga0466730_052106 | 3300042625 | Bacteria | 78279 |
| 92 | Ga0466724_14140 | 3300042649 | Bacteria | 36535 |
| 93 | Ga0466724_68165 | 3300042649 | Bacteria | 85235 |
| 94 | Ga0466708_201924 | 3300042652 | Bacteria | 2172 |
| 95 | Ga0466725_041366 | 3300042654 | Bacteria | 51248 |
| 96 | Ga0123355_10087585 | 3300009826 | Bacteria | 4948 |
| 97 | Ga0123355_10383586 | 3300009826 | Unclassified | 1828 |
| 98 | Ga0160454_100218 | 3300012798 | Bacteria | 59432 |
| 99 | Ga0160441_100589 | 3300012825 | Bacteria | 23421 |
| 100 | Ga0160452_106296 | 3300012834 | Bacteria | 1656 |
| 101 | Ga0160460_100435 | 3300012845 | Bacteria | 25366 |
| 102 | Ga0160460_103585 | 3300012845 | Unclassified | 2687 |
| 103 | Ga0160447_101821 | 3300012849 | Unclassified | 7936 |
| 104 | Ga0160430_105688 | 3300012852 | Bacteria | 2806 |
| 105 | SPBB_contig00125 | 2044078006 | Bacteria | 17926 |
| 106 | SWWA_contig03097__length_1953___numreads_29 | 2100351016 | Unclassified | 1953 |
| 107 | Meta3P_1000325 | 3300002464 | Bacteria | 53316 |
| 108 | Meta3P_1005860 | 3300002464 | Bacteria | 3087 |
| 109 | JGI24700J35501_10930889 | 3300002508 | Bacteria | 34606 |
| 110 | CVPL010L_1000201 | 3300002932 | Bacteria | 32973 |
| 111 | Ga0074278_139080 | 3300005721 | Bacteria | 14623 |
| 112 | Ga0466705_107760 | 3300042612 | Unclassified | 6422 |
| 113 | Ga0562378_1360 | 3300056814 | Bacteria | 27164 |
| 114 | Ga0466734_071231 | 3300042623 | Bacteria | 5714 |
| 115 | Ga0466730_000972 | 3300042625 | Bacteria | 36260 |
| 116 | Ga0466730_005767 | 3300042625 | Bacteria | 24953 |
| 117 | Ga0466730_054746 | 3300042625 | Unclassified | 18833 |
| 118 | Ga0466730_102566 | 3300042625 | Bacteria | 15273 |
| 119 | Ga0466704_090546 | 3300042643 | Bacteria | 6767 |
| 120 | Ga0466724_51092 | 3300042649 | Bacteria | 27189 |
| 121 | Ga0123355_10152494 | 3300009826 | Bacteria | 3506 |
| 122 | Ga0123356_10090413 | 3300010049 | Bacteria | 2915 |
| 123 | Ga0160465_102228 | 3300012803 | Unclassified | 4507 |
| 124 | Ga0160470_100076 | 3300012813 | Bacteria | 133554 |
| 125 | Ga0466701_083531 | 3300042598 | Bacteria | 172160 |
| 126 | Ga0466706_275822 | 3300042599 | Bacteria | 4118 |
| 127 | Ga0466707_328566 | 3300042601 | Bacteria | 6098 |
| 128 | Ga0466713_056481 | 3300042602 | Unclassified | 4337 |
| 129 | Ga0466713_066285 | 3300042602 | Bacteria | 14665 |
| 130 | Ga0160432_100901 | 3300012818 | Bacteria | 12820 |
| 131 | Ga0160469_100326 | 3300012824 | Unclassified | 28120 |
| 132 | Ga0160467_102267 | 3300012829 | Unclassified | 4552 |
| 133 | Ga0160459_100618 | 3300012831 | Unclassified | 12773 |
| 134 | Ga0160446_100022 | 3300012835 | Bacteria | 226564 |
| 135 | Ga0160443_103435 | 3300012848 | Unclassified | 2763 |
| 136 | Ga0160430_107384 | 3300012852 | Bacteria | 2204 |
| 137 | Ga0160435_1000581 | 3300012857 | Unclassified | 11158 |
| 138 | DPOL_contig14991 | 2035918003 | Bacteria | 9786 |
| 139 | FGTW_contig26730 | 2065487013 | Unclassified | 8280 |
| 140 | SWWA_contig31687__length_19047___numreads_976 | 2100351016 | Bacteria | 19047 |
| 141 | Meta3P_1000152 | 3300002464 | Bacteria | 60402 |
| 142 | CVPL010L_1000006 | 3300002932 | Bacteria | 148663 |
| 143 | Ga0063521_1000053 | 3300003973 | Bacteria | 101634 |
| 144 | Ga0074306_1117551 | 3300005309 | Bacteria | 3153 |
| 145 | Ga0103267_1000166 | 3300007190 | Bacteria | 25917 |
| 146 | Ga0105005_1013675 | 3300007505 | Bacteria | 1806 |
| 147 | Ga0105005_1093000 | 3300007505 | Bacteria | 3558 |
| 148 | Ga0105005_1110604 | 3300007505 | Unclassified | 1945 |
| 149 | Ga0466733_086240 | 3300042659 | Bacteria | 6416 |
| 150 | Ga0466733_151882 | 3300042659 | Bacteria | 3149 |
| 151 | Ga0530661_000181 | 3300056564 | Bacteria | 53937 |
| 152 | Ga0562379_3875 | 3300056790 | Unclassified | 8806 |
| 153 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 154 | Ga0466730_054015 | 3300042625 | Bacteria | 10241 |
| 155 | Ga0466709_204823 | 3300042648 | Bacteria | 202980 |
| 156 | Ga0466724_11533 | 3300042649 | Unclassified | 33457 |
| 157 | Ga0466724_22252 | 3300042649 | Bacteria | 197662 |
| 158 | Ga0466724_59099 | 3300042649 | Unclassified | 3758 |
| 159 | Ga0466725_347379 | 3300042654 | Bacteria | 6110 |
| 160 | Ga0123355_10050562 | 3300009826 | Bacteria | 6750 |
| 161 | Ga0123356_10036734 | 3300010049 | Bacteria | 4573 |
| 162 | Ga0123353_10001641 | 3300010167 | Unclassified | 27542 |
| 163 | Ga0160465_100272 | 3300012803 | Bacteria | 35457 |
| 164 | Ga0466701_022059 | 3300042598 | Bacteria | 8860 |
| 165 | Ga0466713_096430 | 3300042602 | Bacteria | 298472 |
| 166 | Ga0160440_100444 | 3300012815 | Unclassified | 14411 |
| 167 | Ga0160459_100436 | 3300012831 | Unclassified | 16959 |
| 168 | Ga0160446_100079 | 3300012835 | Bacteria | 95757 |
| 169 | Ga0160460_100527 | 3300012845 | Unclassified | 21588 |
| 170 | Ga0160447_100064 | 3300012849 | Bacteria | 100230 |
| 171 | Ga0466701_012403 | 3300042598 | Unclassified | 55784 |
| 172 | DPOL_contig00393 | 2035918003 | Unclassified | 22270 |
| 173 | DPOL_contig02922 | 2035918003 | Bacteria | 4608 |
| 174 | 2227080771 | 2225789004 | Bacteria | 224496 |
| 175 | Meta3P_1000440 | 3300002464 | Unclassified | 26759 |
| 176 | Ga0104045_1021774 | 3300007085 | Bacteria | 2113 |
| 177 | Ga0103260_1000839 | 3300007139 | Bacteria | 5770 |
| 178 | Ga0466705_175383 | 3300042612 | Bacteria | 3878 |
| 179 | Ga0466734_112060 | 3300042623 | Bacteria | 2084 |
| 180 | Ga0466734_161367 | 3300042623 | Bacteria | 4098 |
| 181 | Ga0466730_007173 | 3300042625 | Bacteria | 65008 |
| 182 | Ga0466730_012999 | 3300042625 | Bacteria | 66772 |
| 183 | Ga0466704_028717 | 3300042643 | Bacteria | 14019 |
| 184 | Ga0466724_62794 | 3300042649 | Bacteria | 39531 |
| 185 | Ga0123355_10000982 | 3300009826 | Bacteria | 39603 |
| 186 | Ga0123355_10001759 | 3300009826 | Bacteria | 30283 |
| 187 | Ga0123355_10245180 | 3300009826 | Bacteria | 2531 |
| 188 | Ga0160466_103192 | 3300012809 | Bacteria | 2811 |
| 189 | Ga0466701_053268 | 3300042598 | Bacteria | 2498 |
| 190 | Ga0466701_089314 | 3300042598 | Bacteria | 182031 |
| 191 | Ga0466707_212931 | 3300042601 | Bacteria | 1740 |
| 192 | Ga0466717_309955 | 3300042604 | Unclassified | 6248 |
| 193 | Ga0160467_100004 | 3300012829 | Bacteria | 695711 |
| 194 | Ga0160467_101726 | 3300012829 | Bacteria | 7053 |
| 195 | Ga0160459_100041 | 3300012831 | Bacteria | 228416 |
| 196 | Ga0160433_100574 | 3300012846 | Bacteria | 15790 |
| 197 | Ga0160448_101190 | 3300012854 | Unclassified | 8521 |
| 198 | Ga0265387_1000002 | 3300024582 | Bacteria | 132289 |
| 199 | DPO_contig07629 | 2032320009 | Unclassified | 20577 |
| 200 | FGTW_contig16533 | 2065487013 | Bacteria | 1784 |
| 201 | Ga0123357_10000183 | 3300009784 | Bacteria | 57952 |
| 202 | Ga0466697_240824 | 3300042611 | Bacteria | 8844 |
| 203 | Ga0466730_002361 | 3300042625 | Bacteria | 25664 |
| 204 | Ga0466730_007804 | 3300042625 | Bacteria | 147947 |
| 205 | Ga0466730_077918 | 3300042625 | Bacteria | 3464 |
| 206 | Ga0466703_041286 | 3300042636 | Bacteria | 5213 |
| 207 | Ga0466709_343812 | 3300042648 | Bacteria | 8883 |
| 208 | Ga0466724_17079 | 3300042649 | Unclassified | 10251 |
| 209 | Ga0466724_25559 | 3300042649 | Bacteria | 176427 |
| 210 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 211 | Ga0123355_10068907 | 3300009826 | Unclassified | 5689 |
| 212 | Ga0160465_100371 | 3300012803 | Bacteria | 25143 |
| 213 | Ga0160464_100016 | 3300012805 | Bacteria | 270761 |
| 214 | Ga0466701_030483 | 3300042598 | Bacteria | 21462 |
| 215 | Ga0466713_013506 | 3300042602 | Bacteria | 11862 |
| 216 | Ga0160468_100012 | 3300012819 | Bacteria | 410397 |
| 217 | Ga0160459_100716 | 3300012831 | Bacteria | 11341 |
| 218 | Ga0160444_103799 | 3300012841 | Bacteria | 2118 |
| 219 | Ga0247289_0010 | 3300035363 | Bacteria | 70416 |
| 220 | Ga0415639_009990 | 3300038395 | Bacteria | 22731 |
| 221 | DPOL_contig05631 | 2035918003 | Bacteria | 4714 |
| 222 | SPBB_contig07226 | 2044078006 | Bacteria | 63389 |
| 223 | FGTW_contig30680 | 2065487013 | Unclassified | 11220 |
| 224 | CVPL010W_10002778 | 3300002931 | Bacteria | 20410 |
| 225 | Ga0063521_1000040 | 3300003973 | Bacteria | 112648 |
| 226 | Ga0104019_1001891 | 3300007150 | Bacteria | 4597 |
| 227 | Ga0104019_1002212 | 3300007150 | Unclassified | 12437 |
| 228 | Ga0105524_101751 | 3300007733 | Bacteria | 3052 |
| 229 | Ga0123357_10000145 | 3300009784 | Bacteria | 62746 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02803 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.