Protein Family IF13648
Metagenome
Isolate
461
Members
428
Samples
87
Scaffolds
173.98
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8006199443|8006203770|
- Length
- 208 aa
- Sequence
- MAITLAKLVQPGLIGLAQRTAVRYSAHFTNIRLTENMVDKRESYTKEDLEASGRGELFGAGGPPLPAGNMLMMDRIVKMIEDGGSHNKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPDAKKVTYRINFKRVIMRKLIMGVADGEVLVDGKVIYTATDLKVGLFKDTNAF
Sample Types
Isolate
81.1%
Metagenome
18.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
26.5%
Unclassified
23.8%
Drosophilidae
6.4%
Aphididae
4.7%
Anthocoridae
3.4%
Muscidae
3.2%
Elmidae
2.9%
Culicidae
2.7%
Tenebrionidae
2.5%
Curculionidae
2.5%
Calliphoridae
2.2%
Formicidae
1.7%
Termitidae
1.2%
Pediculidae
1.2%
Sarcophagidae
1.2%
Tephritidae
1.2%
Armadillidiidae
1.2%
Cerambycidae
1.0%
Aleyrodidae
0.7%
Palinuridae
0.7%
Pteromalidae
0.7%
Pentatomidae
0.5%
Glossinidae
0.5%
Cicadellidae
0.5%
Passalidae
0.5%
Majidae
0.5%
Talitridae
0.5%
Lysianassidae
0.2%
Aphalaridae
0.2%
Psyllidae
0.2%
Daphniidae
0.2%
Aphrophoridae
0.2%
Acrididae
0.2%
Scarabaeidae
0.2%
Ceratophyllidae
0.2%
Nephropidae
0.2%
Plutellidae
0.2%
Pseudococcidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Carabidae
0.2%
Hippoboscidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Artemiidae
0.2%
Siricidae
0.2%
Triozidae
0.2%
Crambidae
0.2%
Taxonomy
Archaea
0
Bacteria
434
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 3 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 4 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 5 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 6 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 7 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 8 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 9 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 10 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 11 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 12 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 13 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 14 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 15 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 16 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 17 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 18 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 19 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 20 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 21 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 22 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 23 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 24 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 25 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 26 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 27 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 28 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 29 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 30 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 31 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 32 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 33 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 34 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 35 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 36 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 37 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 38 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 39 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 40 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 41 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 42 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 43 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 44 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 45 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 46 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 47 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 48 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 49 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 50 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 51 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 52 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 53 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 54 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 55 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 56 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 57 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 58 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 59 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 60 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 61 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 62 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 63 | 2510065001 | Arsenophonus pediculi ArP | Isolate | Pediculidae |
| 64 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 65 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 66 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 67 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 68 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 69 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 70 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 71 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 72 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 73 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 74 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 75 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 76 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 77 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 78 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 79 | 3300005311 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut | Metagenome | Drosophilidae |
| 80 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 81 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 82 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 83 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 84 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 85 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 86 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 87 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 88 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 89 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 90 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 91 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 92 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 93 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 94 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 95 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 96 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 97 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 98 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 99 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 100 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 101 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 102 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 103 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 104 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 105 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 106 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 107 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 108 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 109 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 110 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 111 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 112 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 113 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 114 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 115 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 116 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 117 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 118 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 119 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 120 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 121 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 122 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 123 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 124 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 125 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 126 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 127 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 128 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 129 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 130 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 131 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 132 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 133 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 134 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 135 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 136 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 137 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 138 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 139 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 140 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 141 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 142 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 143 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 144 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 145 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 146 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 147 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 148 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 149 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 150 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 151 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 152 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 153 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 154 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 155 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 156 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 157 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 158 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 159 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 160 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 161 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 162 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 163 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 164 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 165 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 166 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 167 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 168 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 169 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 170 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 171 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 172 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 173 | 2772190787 | Candidatus Riesia pediculicola HHAC | Isolate | Pediculidae |
| 174 | 2772190788 | Candidatus Riesia pediculischaeffi PTSK | Isolate | Pediculidae |
| 175 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 176 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 177 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 178 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 179 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 180 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 181 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 182 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 183 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 184 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 185 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 186 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 187 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 188 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 189 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 190 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 191 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 192 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 193 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 194 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 195 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 196 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 197 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 198 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 199 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 200 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 201 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 202 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 203 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 204 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 205 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 206 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 207 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 208 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 209 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 210 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 211 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 212 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 213 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 214 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 215 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 216 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 217 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 218 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 219 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 220 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 221 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 222 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 223 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 224 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 225 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 226 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 227 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 228 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 229 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 230 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 231 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 232 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 233 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 234 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 235 | 3300005308 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut | Metagenome | Drosophilidae |
| 236 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 237 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 238 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 239 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 240 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 241 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 242 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 243 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 244 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 245 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 246 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 247 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 248 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 249 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 250 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 251 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 252 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 253 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 254 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 255 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 256 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 257 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 258 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 259 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 260 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 261 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 262 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 263 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 264 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 265 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 266 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 267 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 268 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 269 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 270 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 271 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 272 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 273 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 274 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 275 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 276 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 277 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 278 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 279 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 280 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 281 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 282 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 283 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 284 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 285 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 286 | 2773858019 | Candidatus Riesia pediculicola HHBH | Isolate | Pediculidae |
| 287 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 288 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 289 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 290 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 291 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 292 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 293 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 294 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 295 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 296 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 297 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 298 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 299 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 300 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 301 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 302 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 303 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 304 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 305 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 306 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 307 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 308 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 309 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 310 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 311 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 312 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 313 | 2958255616 | Serratia marcescens TM | Isolate | |
| 314 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 315 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 316 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 317 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 318 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 319 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 320 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 321 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 322 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 323 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 324 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 325 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 326 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 327 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 328 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 329 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 330 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 331 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 332 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 333 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 334 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 335 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 336 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 337 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 338 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 339 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 340 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 341 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 342 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 343 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 344 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 345 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 346 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 347 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 348 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 349 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 350 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 351 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 352 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 353 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 354 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 355 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 356 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 357 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 358 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 359 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 360 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 361 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 362 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 363 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 364 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 365 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 366 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 367 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 368 | 646564517 | Candidatus Riesia pediculicola USDA | Isolate | Pediculidae |
| 369 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 370 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 371 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 372 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 373 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 374 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 375 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 376 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 377 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 378 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 379 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 380 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 381 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 382 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 383 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 384 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 385 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 386 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 387 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 388 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 389 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 390 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 391 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 392 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 393 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 394 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 395 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 396 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 397 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 398 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 399 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 400 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 401 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 402 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 403 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 404 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 405 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 406 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 407 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 408 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 409 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 410 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 411 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 412 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 413 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 414 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 415 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 416 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 417 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 418 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 419 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 420 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 421 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 422 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 423 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 424 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 425 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 426 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 427 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 428 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 2 | SWWA_contig31633__length_60250___numreads_3145 | 2100351016 | Bacteria | 60250 |
| 3 | HBC_ctgsDRAFT_1004445 | 3300000333 | Unclassified | 3250 |
| 4 | Ga0063521_1001389 | 3300003973 | Unclassified | 6747 |
| 5 | Ga0127656_100486 | 3300009453 | Bacteria | 19231 |
| 6 | Ga0466730_093534 | 3300042625 | Unclassified | 1751 |
| 7 | Ga0160433_100005 | 3300012846 | Bacteria | 450229 |
| 8 | Ga0160457_1009711 | 3300012858 | Unclassified | 1372 |
| 9 | Ga0466657_166782 | 3300042582 | Bacteria | 1685 |
| 10 | Ga0562378_0040 | 3300056814 | Bacteria | 437506 |
| 11 | Ga0562374_0128 | 3300057007 | Bacteria | 193000 |
| 12 | Ga0466710_122388 | 3300042613 | Bacteria | 1686 |
| 13 | Ga0466701_097121 | 3300042598 | Bacteria | 81630 |
| 14 | GhopperDRAF_NODE_123396_len_1692_cov_7_430851 | 2035265001 | Unclassified | 1722 |
| 15 | HBC_ctgsDRAFT_1000877 | 3300000333 | Unclassified | 6613 |
| 16 | CVPL005L_10051692 | 3300002938 | Bacteria | 774 |
| 17 | Ga0063521_1001068 | 3300003973 | Unclassified | 8499 |
| 18 | Ga0562377_0082 | 3300056842 | Bacteria | 346138 |
| 19 | DPOL_contig16588 | 2035918003 | Bacteria | 14088 |
| 20 | FGTW_contig09010 | 2065487013 | Unclassified | 7693 |
| 21 | FGTW_contig13480 | 2065487013 | Bacteria | 71589 |
| 22 | Meta3P_1000467 | 3300002464 | Bacteria | 75239 |
| 23 | Ga0104042_1124830 | 3300007130 | Unclassified | 1303 |
| 24 | Ga0105005_1136514 | 3300007505 | Bacteria | 5766 |
| 25 | Ga0105005_1287363 | 3300007505 | Bacteria | 1519 |
| 26 | Ga0466730_019643 | 3300042625 | Unclassified | 10803 |
| 27 | Ga0466730_081149 | 3300042625 | Bacteria | 2328 |
| 28 | Ga0466724_40676 | 3300042649 | Unclassified | 1251 |
| 29 | Ga0466724_52552 | 3300042649 | Bacteria | 241703 |
| 30 | Ga0160433_103674 | 3300012846 | Unclassified | 2657 |
| 31 | Ga0160434_100494 | 3300012850 | Bacteria | 10635 |
| 32 | Ga0247290_00308 | 3300035364 | Unclassified | 11234 |
| 33 | Ga0466707_096100 | 3300042601 | Bacteria | 163276 |
| 34 | FGTW_contig31923 | 2065487013 | Unclassified | 3179 |
| 35 | FGTW_contig31925 | 2065487013 | Unclassified | 3166 |
| 36 | gam1t_NODE_689636_length=159105_GC=32_4_Contigs=24 | 2189573031 | Bacteria | 159335 |
| 37 | Ga0063521_1000021 | 3300003973 | Bacteria | 135065 |
| 38 | Ga0063521_1000028 | 3300003973 | Bacteria | 125624 |
| 39 | Ga0074310_1000823 | 3300005308 | Bacteria | 727 |
| 40 | Ga0104041_1112201 | 3300007106 | Bacteria | 1764 |
| 41 | Ga0105005_1018522 | 3300007505 | Unclassified | 2213 |
| 42 | Ga0247290_01432 | 3300035364 | Unclassified | 2689 |
| 43 | Ga0466701_103385 | 3300042598 | Bacteria | 106939 |
| 44 | gam1t_NODE_232935_length=10061_GC=32_9_Contigs=4 | 2189573031 | Bacteria | 10091 |
| 45 | WW0001_100241 | 3300002732 | Bacteria | 118798 |
| 46 | CVPL010L_1000028 | 3300002932 | Bacteria | 51224 |
| 47 | Ga0063521_1000006 | 3300003973 | Bacteria | 230945 |
| 48 | Ga0074306_1117494 | 3300005309 | Bacteria | 3508 |
| 49 | Ga0074300_1135117 | 3300005311 | Unclassified | 1870 |
| 50 | Ga0074278_110888 | 3300005721 | Bacteria | 159335 |
| 51 | Ga0105553_1034337 | 3300007767 | Bacteria | 11347 |
| 52 | Ga0466730_027788 | 3300042625 | Bacteria | 4032 |
| 53 | Ga0466724_53799 | 3300042649 | Bacteria | 82059 |
| 54 | Ga0160469_100030 | 3300012824 | Bacteria | 270033 |
| 55 | Ga0160472_100023 | 3300012839 | Bacteria | 328468 |
| 56 | Ga0265387_1001746 | 3300024582 | Unclassified | 3122 |
| 57 | Ga0136160_1000095 | 3300010225 | Bacteria | 227703 |
| 58 | Ga0466701_050252 | 3300042598 | Bacteria | 107300 |
| 59 | gam1t_NODE_271136_length=37950_GC=34_8_Contigs=6 | 2189573031 | Bacteria | 38000 |
| 60 | SCG598B02_11643 | 3300000472 | Unclassified | 22313 |
| 61 | Ga0074303_1074432 | 3300005306 | Unclassified | 3212 |
| 62 | Ga0104041_1110604 | 3300007106 | Unclassified | 2550 |
| 63 | Ga0104040_1001917 | 3300007149 | Bacteria | 5394 |
| 64 | Ga0103268_1000973 | 3300007192 | Bacteria | 7702 |
| 65 | Ga0104147_1062562 | 3300007224 | Unclassified | 8612 |
| 66 | Ga0127657_103045 | 3300009457 | Bacteria | 31964 |
| 67 | Ga0466724_66570 | 3300042649 | Unclassified | 31258 |
| 68 | Ga0160443_100946 | 3300012848 | Bacteria | 13243 |
| 69 | 2227563504 | 2225789004 | Bacteria | 52505 |
| 70 | Ga0063521_1000016 | 3300003973 | Bacteria | 145760 |
| 71 | Ga0074278_108760 | 3300005721 | Bacteria | 38000 |
| 72 | Ga0103266_1000007 | 3300007067 | Bacteria | 130661 |
| 73 | Ga0127649_135094 | 3300009460 | Bacteria | 2107 |
| 74 | Ga0466730_002048 | 3300042625 | Bacteria | 29313 |
| 75 | Ga0466724_25478 | 3300042649 | Bacteria | 14168 |
| 76 | Ga0160444_105908 | 3300012841 | Bacteria | 1610 |
| 77 | Ga0160435_1003146 | 3300012857 | Unclassified | 3938 |
| 78 | Ga0160436_1000041 | 3300012861 | Bacteria | 72279 |
| 79 | Ga0265387_1000045 | 3300024582 | Bacteria | 40641 |
| 80 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 81 | Ga0562379_0013 | 3300056790 | Bacteria | 1548004 |
| 82 | IMNBL1DRAFT_c0001400 | 3300000062 | Bacteria | 18122 |
| 83 | SCG598I22_11110 | 3300000462 | Bacteria | 16671 |
| 84 | Ga0104044_1149896 | 3300007136 | Bacteria | 1081 |
| 85 | Ga0466724_68414 | 3300042649 | Unclassified | 18680 |
| 86 | Ga0160472_100029 | 3300012839 | Bacteria | 280179 |
| 87 | Ga0160447_109817 | 3300012849 | Unclassified | 2157 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07977 | FabA | FabA-like domain | 65 | 194 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.