Protein Family IF13577

Metagenome Isolate
236 Members
208 Samples
68 Scaffolds
219.15 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|651285005|651303070|
Length
248 aa
Sequence
MAAFFFYLGDKRLQPVAKFAIMRAASDEDKKLMAEKSDLNALSDRFRGFYPVVIDVETAGFNAKTDALLEIAAVTLKMDEGGWLQQDETLHFHVEPFEGANLQPEALAFNGIDPHNPLRGAVSEYDALHAIFKTVRAGIKHRGCNRAIIVAHNANFDHSFLMAAAERASLKRNPFHPFATFDTAALSGLVLGQTVLAKACTAAGMPFDSSQAHSALYDTEQTALLFCELVNRWKRLGGWPLTLGDLGG

📊 Sample Types

Isolate 71.2%
Metagenome 28.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 15.4%
Aphididae 13.9%
Drosophilidae 8.0%
Apidae 7.0%
Anthocoridae 7.0%
Muscidae 6.5%
Curculionidae 5.0%
Tenebrionidae 4.5%
Calliphoridae 4.5%
Termitidae 3.5%
Elmidae 3.0%
Tephritidae 2.5%
Culicidae 2.5%
Formicidae 2.0%
Cerambycidae 2.0%
Passalidae 1.0%
Plutellidae 1.0%
Armadillidiidae 1.0%
Pentatomidae 1.0%
Sarcophagidae 1.0%
Cicadellidae 0.5%
Pteromalidae 0.5%
Pseudococcidae 0.5%
Aphalaridae 0.5%
Aleyrodidae 0.5%
Daphniidae 0.5%
Triozidae 0.5%
Crambidae 0.5%
Thripidae 0.5%
Anthomyiidae 0.5%
Rhopalidae 0.5%
Glossinidae 0.5%
Carabidae 0.5%
Scarabaeidae 0.5%
Ceratophyllidae 0.5%
Majidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 219
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
2 2515154048 Candidatus Gilliamella apicola wkB11 Isolate Apidae
3 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
4 2521172698 Candidatus Blochmannia chromaiodes 640 Isolate Unclassified
5 2528768011 Serratia symbiotica SCt-VLC Isolate Aphididae
6 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
7 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
8 2648501856 Candidatus Baumannia cicadellinicola BGSS Isolate Cicadellidae
9 2751185823 Erwinia haradaeae 3056 Isolate Aphididae
10 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
11 2978161719 Serratia marcescens KZ2 Isolate Apidae
12 3000861951 Budvicia diplopodorum D9 Isolate
13 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
16 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
17 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
18 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
21 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
22 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
23 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
24 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
25 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
26 2884499693 Buchnera aphidicola BuCikochiana/2762 Isolate Aphididae
27 2898975184 Erwinia dacicola IL Isolate Tephritidae
28 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
29 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
30 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
31 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
32 637000057 Candidatus Blochmannia pennsylvanicus BPEN Isolate Formicidae
33 650716016 Candidatus Moranella endobia PCIT Isolate Pseudococcidae
34 8018312681 Enterobacter sp. OLF Isolate Tephritidae
35 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
36 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
37 8076032775 Erwinia haradaeae ErCicurvipes/3402 Isolate Aphididae
38 8099192374 Erwinia typographi IC4 Isolate Curculionidae
39 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
40 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
41 2509601000 Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 Isolate Aphalaridae
42 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
43 2548876931 Candidatus Hamiltonella defensa MED (Bemisia tabaci) Isolate Aleyrodidae
44 2574179716 Serratia sp. DD3 Isolate Daphniidae
45 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
46 2718217944 Serratia marcescens AS1 Isolate Culicidae
47 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
48 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
49 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
50 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
51 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
52 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
53 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
54 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
55 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
56 2864768727 Aeromonas veronii S00020 Isolate Elmidae
57 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
58 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
59 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
60 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
61 8076029003 Erwinia haradaeae ErCipiceae/3303 Isolate Aphididae
62 8076031238 Erwinia haradaeae ErCicurtihirsuta/3053 Isolate Aphididae
63 8100176769 Kosakonia sp. S57 Isolate Curculionidae
64 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
65 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
66 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
67 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
68 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
69 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
70 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
71 2978102237 Serratia fonticola AeS1 Isolate Culicidae
72 3007994558 Escherichia alba B35 Isolate Tenebrionidae
73 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
74 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
75 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
76 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
77 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
78 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
79 2841132873 Buchnera aphidicola BTs Pazieg Isolate Aphididae
80 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
81 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
82 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
83 2892972412 Sodalis-like symbiont of Bactericera trigonica IL Isolate Triozidae
84 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
85 2937735258 Serratia marcescens KZ11 Isolate Apidae
86 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
87 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
88 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
89 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
90 8076029720 Erwinia haradaeae ErCisplendens/3004 Isolate Aphididae
91 8100181737 Kosakonia sp. S58 Isolate Curculionidae
92 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
93 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
94 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
95 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
96 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
97 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
98 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
99 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
100 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
101 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
102 2887836388 Buchnera aphidicola BuCisplendens/3004 Isolate Aphididae
103 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
104 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
105 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
106 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
107 2958255616 Serratia marcescens TM Isolate
108 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
109 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
110 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
111 8071333649 Escherichia coli PN108 Isolate Calliphoridae
112 8071338694 Escherichia coli PN87 Isolate Calliphoridae
113 2505679062 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
114 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
115 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
116 2971189173 Yersinia pestis A-1249 Isolate Unclassified
117 2984883310 Serratia symbiotica SCifornacula/2912 Isolate Aphididae
118 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
119 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
120 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
121 2836714267 Shimwellia blattae NCTC10965 Isolate
122 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
123 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
124 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
125 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
126 8021546568 Klebsiella sp. Kps Isolate Tephritidae
127 8071322446 Escherichia coli PN122 Isolate Calliphoridae
128 8076033509 Erwinia haradaeae ErCicuneomaculata/2628 Isolate Aphididae
129 8100171289 Kosakonia sp. S42 Isolate Curculionidae
130 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
131 8103002986 Erwinia sp. S38 Isolate Curculionidae
132 8103008710 Erwinia sp. S43 Isolate Curculionidae
133 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
134 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
135 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
136 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
137 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
138 3300010217 Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 Metagenome Aphididae
139 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
140 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
141 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
142 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
143 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
144 2864791955 Aeromonas veronii S00030 Isolate Elmidae
145 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
146 2876014139 Gilliamella apicola wkB18 Isolate Apidae
147 2884498641 Buchnera aphidicola BuCicurvipes/3402 Isolate Aphididae
148 2884500114 Buchnera aphidicola BuCicuneomaculata/2628 Isolate Aphididae
149 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
150 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
151 637000338 Wigglesworthia glossinidia Isolate Unclassified
152 649633028 Candidatus Blochmannia vafer BVAF Isolate Formicidae
153 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
154 8071343737 Escherichia coli PN119 Isolate Calliphoridae
155 8076028257 Erwinia haradaeae ErCisplendens/pseudotsugae/3390 Isolate Aphididae
156 8076047169 Erwinia haradaeae ErCipseudotsugae/2889 Isolate Aphididae
157 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
158 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
159 2645727860 Winslowiella iniecta B120 Isolate Aphididae
160 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
161 2703719240 Serratia marcescens ano2 Isolate Unclassified
162 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
163 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
164 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
165 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
166 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
167 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
168 2884492481 Buchnera aphidicola BuCicurtihirsuta/3053 Isolate Aphididae
169 2884500535 Buchnera aphidicola BuCilaricifoliae/3058 Isolate Aphididae
170 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
171 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
172 643348521 Buchnera aphidicola Cc Isolate Aphididae
173 644736334 Candidatus Hamiltonella defensa 5AT Isolate Aphididae
174 648276708 Pantoea sp. aB Isolate Unclassified
175 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
176 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
177 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
178 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
179 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
180 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
181 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
182 2585427711 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
183 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
184 2648501209 Winslowiella iniecta B149 Isolate Aphididae
185 2703719239 Serratia marcescens ano1 Isolate Unclassified
186 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
187 2811995301 Serratia symbiotica STs Pazieg Isolate Aphididae
188 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
189 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
190 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
191 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
192 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
193 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
194 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
195 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
196 2884497005 Buchnera aphidicola BuCisplendens/pseudotsugae/3390 Isolate Aphididae
197 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
198 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
199 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
200 2843639003 Buchnera aphidicola BuCistrobi/3249 Isolate Aphididae
201 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
202 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
203 651285005 Serratia symbiotica Tuscon Isolate Aphididae
204 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
205 8004541719 Serratia marcescens KZ19 Isolate Apidae
206 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
207 8076030444 Erwinia haradaeae ErCilaricifoliae/3058 Isolate Aphididae
208 8076031980 Erwinia haradaeae ErCikochiana/2762 Isolate Aphididae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_072386 3300042598 Bacteria 20668
2 Ga0466707_106655 3300042601 Bacteria 13837
3 Ga0466724_33172 3300042649 Bacteria 2301
4 FGTW_contig33147 2065487013 Unclassified 1730
5 Meta3P_1000080 3300002464 Bacteria 125210
6 CVPL010L_1000043 3300002932 Unclassified 69639
7 Ga0074306_1116599 3300005309 Bacteria 1627
8 Ga0104048_1039056 3300007143 Bacteria 768
9 Ga0466730_040190 3300042625 Unclassified 21194
10 Ga0466724_07935 3300042649 Unclassified 47916
11 Ga0466724_41349 3300042649 Unclassified 5210
12 FGTW_contig33073 2065487013 Bacteria 1779
13 Ga0562379_1133 3300056790 Bacteria 34663
14 Ga0562375_0371 3300056856 Bacteria 100872
15 Ga0466713_120225 3300042602 Bacteria 135023
16 Ga0466734_013979 3300042623 Bacteria 6340
17 Ga0466724_52709 3300042649 Bacteria 10703
18 FGTW_contig24020 2065487013 Bacteria 1036
19 Ga0063521_1000091 3300003973 Bacteria 72243
20 Ga0074188_1157221 3300005318 Unclassified 1490
21 Ga0074278_109978 3300005721 Bacteria 208050
22 Ga0160468_105672 3300012819 Bacteria 1399
23 Ga0265387_1000031 3300024582 Bacteria 54487
24 Ga0562379_0001 3300056790 Bacteria 4904077
25 Ga0466713_046033 3300042602 Bacteria 104936
26 Ga0466730_026575 3300042625 Bacteria 18773
27 DPOL_contig00086 2035918003 Bacteria 93085
28 FGTW_contig21746 2065487013 Bacteria 10306
29 IMNBL1DRAFT_c0005449 3300000062 Bacteria 7272
30 CVPL010L_1000781 3300002932 Unclassified 5785
31 Ga0063521_1000593 3300003973 Bacteria 15256
32 Ga0105524_102428 3300007733 Bacteria 2138
33 Ga0562377_0003 3300056842 Bacteria 3990310
34 Ga0466710_000204 3300042613 Bacteria 1106
35 Ga0466725_040010 3300042654 Bacteria 26362
36 2227080768 2225789004 Bacteria 273152
37 Ga0063521_1000070 3300003973 Bacteria 87203
38 Ga0063521_1000466 3300003973 Bacteria 19974
39 Ga0063521_1052452 3300003973 Unclassified 863
40 Ga0104147_1037661 3300007224 Bacteria 10165
41 Ga0265387_1005718 3300024582 Bacteria 1676
42 Ga0316159_10001 3300030930 Bacteria 1642808
43 Ga0316159_10386 3300030930 Unclassified 12589
44 Ga0247289_0011 3300035363 Bacteria 70121
45 Ga0562377_0148 3300056842 Bacteria 202186
46 Ga0562375_0008 3300056856 Bacteria 1786936
47 Ga0466725_431887 3300042654 Bacteria 15756
48 DPO_contig00338 2032320009 Unclassified 1870
49 gam1t_NODE_374822_length=207960_GC=33_9_Contigs=10 2189573031 Bacteria 208050
50 WW0001_100081 3300002732 Bacteria 214513
51 CVPL010L_1000041 3300002932 Bacteria 42438
52 Ga0074188_1000410 3300005318 Bacteria 11151
53 Ga0105553_1026034 3300007767 Unclassified 7518
54 Ga0466730_016570 3300042625 Unclassified 18839
55 Ga0466724_68720 3300042649 Bacteria 83149
56 Ga0074188_1161631 3300005318 Unclassified 1074
57 Ga0247290_00022 3300035364 Bacteria 61216
58 Ga0562375_0077 3300056856 Bacteria 319613
59 Ga0136159_1000027 3300010217 Unclassified 41326
60 Ga0466730_020208 3300042625 Bacteria 18908
61 HBC_ctgsDRAFT_1001228 3300000333 Bacteria 5610
62 Ga0104041_1110225 3300007106 Unclassified 3293
63 Ga0104041_1117449 3300007106 Unclassified 1198
64 Ga0104040_1041364 3300007149 Bacteria 4524
65 Ga0105005_1090688 3300007505 Bacteria 9097
66 Ga0160433_110033 3300012846 Bacteria 1231
67 Ga0247289_0018 3300035363 Unclassified 54928
68 Ga0466657_383697 3300042582 Bacteria 17263

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00929 RNase_T Exonuclease 52 226 0.93
PF16473 Rv2179c-like 3'-5' exoribonuclease Rv2179c-like domain 52 224 0.75

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.