Protein Family IF11350
Metagenome
Isolate
408
Members
199
Samples
311
Scaffolds
180.07
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2718217749|2718707349|
- Length
- 200 aa
- Sequence
- MAQKSEYLPQMAKSLTYKAKNMVELQELYKKTIIPTLQKEFGFKSVMAVPGIEKITLNMGIGEAVADKKVIERAMEDMMRISGQKPIITYARKSEAGFKIRTGWPIGCKVTLRRERMYEFLKRLISIAIPRIRDFRGFNAKSFDGRGNFSLGIREQIVFPEIQYDKIDAIRGMDITITTRARTNEEGQALLKAFGFPLKD
Sample Types
Isolate
23.8%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.2%
Termitidae
15.5%
Coreidae
13.0%
Formicidae
8.8%
Kalotermitidae
7.3%
Elmidae
6.2%
Culicidae
5.7%
Sarcophagidae
3.1%
Drosophilidae
3.1%
Curculionidae
2.1%
Armadillidiidae
2.1%
Termopsidae
2.1%
Psyllidae
1.6%
Rhinotermitidae
1.6%
Ixodidae
1.0%
Largidae
1.0%
Apidae
1.0%
Passalidae
1.0%
Alydidae
1.0%
Hydrophilidae
0.5%
Hodotermitidae
0.5%
Cixiidae
0.5%
Crambidae
0.5%
Noctuidae
0.5%
Stratiomyidae
0.5%
Pediculidae
0.5%
Taxonomy
Archaea
0
Bacteria
345
Eukaryota
0
Viruses
0
Unclassified
63
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 2 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 3 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 4 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 5 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 6 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 9 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 10 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 11 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 19 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 20 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 29 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 30 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 31 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 32 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 33 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 34 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 35 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 36 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 37 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 38 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 39 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 40 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 44 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 45 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 46 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 47 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 48 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 49 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 50 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 51 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 52 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 53 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 58 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 59 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 60 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 61 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 62 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 63 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 64 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 65 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 66 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 69 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 70 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 71 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 72 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 73 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 74 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 75 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 76 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 77 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 82 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 83 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 84 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 85 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 86 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 87 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 88 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 89 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 90 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 91 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 92 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 93 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 94 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 95 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 96 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 97 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 98 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 99 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 100 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 101 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 102 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 103 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 104 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 105 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 106 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 107 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 108 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 109 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 110 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 111 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 112 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 113 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 114 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 115 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 116 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 117 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 118 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 119 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 120 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 121 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 122 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 123 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 124 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 125 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 126 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 127 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 128 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 129 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 130 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 131 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 132 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 133 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 134 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 135 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 136 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 137 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 138 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 139 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 140 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 141 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 142 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 143 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 144 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 145 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 146 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 147 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 148 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 149 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 150 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 151 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 152 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 153 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 154 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 155 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 156 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 157 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 158 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 159 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 160 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 161 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 162 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 163 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 164 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 165 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 166 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 167 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 168 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 169 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 170 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 171 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 172 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 173 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 174 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 175 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 176 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 177 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 178 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 179 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 180 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 181 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 182 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 183 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 184 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 185 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 186 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 187 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 188 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 189 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 190 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 191 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 192 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 193 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 194 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 195 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 196 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 197 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 198 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 199 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_069381 | 3300042612 | Unclassified | 7318 |
| 2 | Ga0160447_119094 | 3300012849 | Unclassified | 1147 |
| 3 | Ga0466656_233770 | 3300042550 | Bacteria | 3515 |
| 4 | Ga0466657_044938 | 3300042582 | Unclassified | 3573 |
| 5 | Ga0466657_390228 | 3300042582 | Bacteria | 1578 |
| 6 | Ga0466692_128697 | 3300042591 | Bacteria | 29218 |
| 7 | Ga0466693_116240 | 3300042592 | Unclassified | 4740 |
| 8 | Ga0466696_042576 | 3300042596 | Bacteria | 13410 |
| 9 | IMNBL1DRAFT_c0010256 | 3300000062 | Bacteria | 4516 |
| 10 | CVPL010W_10012209 | 3300002931 | Bacteria | 6905 |
| 11 | CVPL010W_10032043 | 3300002931 | Bacteria | 2007 |
| 12 | CVPL005W_1000434 | 3300002934 | Unclassified | 16988 |
| 13 | Ga0068305_10277852 | 3300005083 | Bacteria | 15502 |
| 14 | Ga0072941_1125686 | 3300005201 | Bacteria | 4666 |
| 15 | Ga0072941_1340102 | 3300005201 | Bacteria | 2801 |
| 16 | Ga0102736_1000277 | 3300007052 | Bacteria | 11410 |
| 17 | Ga0102739_1000381 | 3300007095 | Bacteria | 9630 |
| 18 | Ga0102739_1002286 | 3300007095 | Unclassified | 2989 |
| 19 | Ga0102734_1011377 | 3300007129 | Bacteria | 3259 |
| 20 | Ga0103264_1013761 | 3300007188 | Bacteria | 3973 |
| 21 | Ga0466710_211598 | 3300042613 | Bacteria | 14971 |
| 22 | Ga0466723_233813 | 3300042618 | Bacteria | 18111 |
| 23 | Ga0466734_085482 | 3300042623 | Bacteria | 4977 |
| 24 | Ga0466730_008869 | 3300042625 | Bacteria | 313970 |
| 25 | Ga0466703_276609 | 3300042636 | Bacteria | 60964 |
| 26 | Ga0466704_501270 | 3300042643 | Bacteria | 6076 |
| 27 | Ga0466725_128862 | 3300042654 | Unclassified | 4263 |
| 28 | Ga0466725_172464 | 3300042654 | Bacteria | 4063 |
| 29 | Ga0466725_183948 | 3300042654 | Bacteria | 1926 |
| 30 | Ga0123356_10098973 | 3300010049 | Bacteria | 2794 |
| 31 | Ga0123356_11324145 | 3300010049 | Bacteria | 883 |
| 32 | Ga0123354_10002414 | 3300010882 | Bacteria | 24635 |
| 33 | Ga0466701_066530 | 3300042598 | Bacteria | 6962 |
| 34 | Ga0466701_083530 | 3300042598 | Bacteria | 21770 |
| 35 | Ga0466701_093913 | 3300042598 | Bacteria | 9709 |
| 36 | Ga0466707_398396 | 3300042601 | Bacteria | 9298 |
| 37 | Ga0466717_091910 | 3300042604 | Bacteria | 9410 |
| 38 | Ga0160444_100021 | 3300012841 | Bacteria | 297202 |
| 39 | Ga0415639_085138 | 3300038395 | Bacteria | 1282 |
| 40 | Ga0466657_093175 | 3300042582 | Bacteria | 1079 |
| 41 | Ga0466657_141958 | 3300042582 | Bacteria | 2300 |
| 42 | Ga0466692_058899 | 3300042591 | Bacteria | 20827 |
| 43 | Ga0466691_209335 | 3300042593 | Bacteria | 25069 |
| 44 | CVPL010W_10002681 | 3300002931 | Bacteria | 20768 |
| 45 | CVPL010W_10003429 | 3300002931 | Bacteria | 18525 |
| 46 | CVPL005L_10000204 | 3300002938 | Bacteria | 52271 |
| 47 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 48 | Ga0102736_1001354 | 3300007052 | Bacteria | 7087 |
| 49 | Ga0102740_1030512 | 3300007140 | Unclassified | 837 |
| 50 | Ga0104048_1021965 | 3300007143 | Unclassified | 3447 |
| 51 | Ga0103264_1000318 | 3300007188 | Bacteria | 26213 |
| 52 | Ga0103264_1010575 | 3300007188 | Bacteria | 4505 |
| 53 | Ga0103267_1000117 | 3300007190 | Bacteria | 30369 |
| 54 | Ga0466710_048207 | 3300042613 | Bacteria | 5505 |
| 55 | Ga0466710_051504 | 3300042613 | Bacteria | 4169 |
| 56 | Ga0466711_145003 | 3300042615 | Bacteria | 32111 |
| 57 | Ga0466728_179152 | 3300042620 | Bacteria | 4284 |
| 58 | Ga0466729_165527 | 3300042621 | Bacteria | 3812 |
| 59 | Ga0466734_015756 | 3300042623 | Bacteria | 28187 |
| 60 | Ga0466735_221921 | 3300042624 | Bacteria | 30703 |
| 61 | Ga0466709_317533 | 3300042648 | Bacteria | 2747 |
| 62 | Ga0466724_03072 | 3300042649 | Bacteria | 18268 |
| 63 | Ga0466708_117775 | 3300042652 | Bacteria | 15479 |
| 64 | Ga0466725_461929 | 3300042654 | Bacteria | 22391 |
| 65 | Ga0123356_10581044 | 3300010049 | Bacteria | 1284 |
| 66 | Ga0123353_10000519 | 3300010167 | Bacteria | 47639 |
| 67 | Ga0160442_100028 | 3300012806 | Bacteria | 266276 |
| 68 | Ga0466706_199859 | 3300042599 | Bacteria | 9363 |
| 69 | Ga0466706_241347 | 3300042599 | Bacteria | 14034 |
| 70 | Ga0466707_378605 | 3300042601 | Bacteria | 1962 |
| 71 | Ga0466713_091546 | 3300042602 | Bacteria | 18477 |
| 72 | Ga0466713_109624 | 3300042602 | Bacteria | 13785 |
| 73 | Ga0466714_006309 | 3300042603 | Bacteria | 1145 |
| 74 | Ga0466717_222166 | 3300042604 | Bacteria | 3124 |
| 75 | Ga0466719_157184 | 3300042606 | Bacteria | 16488 |
| 76 | Ga0466697_090556 | 3300042611 | Bacteria | 7645 |
| 77 | Ga0160456_100416 | 3300012820 | Bacteria | 14373 |
| 78 | Ga0160446_103994 | 3300012835 | Bacteria | 2246 |
| 79 | Ga0160430_109942 | 3300012852 | Unclassified | 1672 |
| 80 | Ga0160448_100555 | 3300012854 | Bacteria | 12673 |
| 81 | Ga0160448_131554 | 3300012854 | Bacteria | 764 |
| 82 | Ga0160435_1013143 | 3300012857 | Unclassified | 1644 |
| 83 | Ga0415639_084109 | 3300038395 | Bacteria | 5592 |
| 84 | Ga0466657_051167 | 3300042582 | Bacteria | 10371 |
| 85 | Ga0466657_320365 | 3300042582 | Bacteria | 1515 |
| 86 | Ga0466657_322606 | 3300042582 | Bacteria | 9653 |
| 87 | Ga0466690_149138 | 3300042590 | Bacteria | 14715 |
| 88 | Ga0466690_289774 | 3300042590 | Bacteria | 3568 |
| 89 | Ga0466690_321140 | 3300042590 | Bacteria | 25918 |
| 90 | Ga0466701_001027 | 3300042598 | Bacteria | 90142 |
| 91 | JGI24702J35022_10033351 | 3300002462 | Bacteria | 2755 |
| 92 | JGI24705J35276_12235518 | 3300002504 | Bacteria | 6624 |
| 93 | CVPL005L_10000093 | 3300002938 | Bacteria | 63243 |
| 94 | Ga0072941_1141096 | 3300005201 | Bacteria | 10652 |
| 95 | Ga0102735_1002079 | 3300007080 | Unclassified | 7934 |
| 96 | Ga0104047_1124693 | 3300007088 | Unclassified | 885 |
| 97 | Ga0102734_1000504 | 3300007129 | Bacteria | 12926 |
| 98 | Ga0103260_1005442 | 3300007139 | Unclassified | 1873 |
| 99 | Ga0102737_1001244 | 3300007142 | Unclassified | 7310 |
| 100 | Ga0103267_1000450 | 3300007190 | Unclassified | 13045 |
| 101 | Ga0103268_1001471 | 3300007192 | Unclassified | 5814 |
| 102 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 103 | Ga0466710_058355 | 3300042613 | Bacteria | 1849 |
| 104 | Ga0466710_115345 | 3300042613 | Bacteria | 8153 |
| 105 | Ga0466711_226259 | 3300042615 | Bacteria | 4193 |
| 106 | Ga0466729_051623 | 3300042621 | Unclassified | 2596 |
| 107 | Ga0466729_084932 | 3300042621 | Bacteria | 104590 |
| 108 | Ga0466734_005435 | 3300042623 | Bacteria | 6040 |
| 109 | Ga0466734_030009 | 3300042623 | Unclassified | 1693 |
| 110 | Ga0466704_332081 | 3300042643 | Bacteria | 1506 |
| 111 | Ga0466725_164280 | 3300042654 | Bacteria | 17642 |
| 112 | Ga0466725_185939 | 3300042654 | Bacteria | 36509 |
| 113 | Ga0466725_296922 | 3300042654 | Bacteria | 3248 |
| 114 | Ga0123357_10219977 | 3300009784 | Unclassified | 2109 |
| 115 | Ga0123353_10008266 | 3300010167 | Bacteria | 14186 |
| 116 | Ga0123354_10026109 | 3300010882 | Bacteria | 9212 |
| 117 | Ga0123354_10038081 | 3300010882 | Bacteria | 7471 |
| 118 | Ga0466701_038995 | 3300042598 | Bacteria | 5162 |
| 119 | Ga0466706_278377 | 3300042599 | Bacteria | 1359 |
| 120 | Ga0466707_258979 | 3300042601 | Bacteria | 7487 |
| 121 | Ga0466719_486350 | 3300042606 | Bacteria | 13185 |
| 122 | Ga0466722_202204 | 3300042609 | Bacteria | 5956 |
| 123 | Ga0466697_178025 | 3300042611 | Bacteria | 8041 |
| 124 | Ga0466732_077377 | 3300042656 | Bacteria | 3461 |
| 125 | Ga0466657_099882 | 3300042582 | Unclassified | 1499 |
| 126 | Ga0466692_184437 | 3300042591 | Bacteria | 20938 |
| 127 | Ga0466694_302740 | 3300042594 | Bacteria | 3330 |
| 128 | 2227301894 | 2225789004 | Bacteria | 1221 |
| 129 | JGI24696J40584_12933683 | 3300002834 | Unclassified | 1525 |
| 130 | Ga0072941_1289878 | 3300005201 | Bacteria | 6081 |
| 131 | Ga0103266_1000200 | 3300007067 | Bacteria | 16981 |
| 132 | Ga0102735_1000064 | 3300007080 | Bacteria | 53865 |
| 133 | Ga0103261_1000695 | 3300007083 | Unclassified | 9466 |
| 134 | Ga0102740_1001232 | 3300007140 | Unclassified | 6635 |
| 135 | Ga0103264_1000188 | 3300007188 | Bacteria | 52510 |
| 136 | Ga0466705_389907 | 3300042612 | Bacteria | 51380 |
| 137 | Ga0466710_017414 | 3300042613 | Bacteria | 1039 |
| 138 | Ga0466710_276996 | 3300042613 | Bacteria | 1413 |
| 139 | Ga0466711_247281 | 3300042615 | Bacteria | 5801 |
| 140 | Ga0466715_193807 | 3300042616 | Bacteria | 17352 |
| 141 | Ga0466723_124011 | 3300042618 | Bacteria | 17539 |
| 142 | Ga0466734_079060 | 3300042623 | Bacteria | 8664 |
| 143 | Ga0466735_033269 | 3300042624 | Bacteria | 5749 |
| 144 | Ga0466730_059466 | 3300042625 | Bacteria | 59728 |
| 145 | Ga0466704_150483 | 3300042643 | Bacteria | 8168 |
| 146 | Ga0466708_308504 | 3300042652 | Bacteria | 17035 |
| 147 | Ga0466708_431611 | 3300042652 | Bacteria | 17147 |
| 148 | Ga0466725_146840 | 3300042654 | Bacteria | 3520 |
| 149 | Ga0466725_366896 | 3300042654 | Unclassified | 3228 |
| 150 | Ga0466725_399048 | 3300042654 | Bacteria | 14201 |
| 151 | Ga0466706_231592 | 3300042599 | Bacteria | 4461 |
| 152 | Ga0466700_386178 | 3300042600 | Bacteria | 3495 |
| 153 | Ga0466719_047699 | 3300042606 | Bacteria | 11168 |
| 154 | Ga0466719_079825 | 3300042606 | Bacteria | 11953 |
| 155 | Ga0466722_141657 | 3300042609 | Bacteria | 8529 |
| 156 | Ga0466697_099832 | 3300042611 | Bacteria | 2564 |
| 157 | Ga0466705_276363 | 3300042612 | Bacteria | 19722 |
| 158 | Ga0466733_059229 | 3300042659 | Bacteria | 36946 |
| 159 | Ga0160470_102347 | 3300012813 | Unclassified | 3628 |
| 160 | Ga0160458_100594 | 3300012832 | Unclassified | 13044 |
| 161 | Ga0160447_107843 | 3300012849 | Unclassified | 2622 |
| 162 | Ga0160434_119020 | 3300012850 | Unclassified | 1059 |
| 163 | Ga0160436_1000158 | 3300012861 | Bacteria | 34161 |
| 164 | Ga0466657_295945 | 3300042582 | Bacteria | 10947 |
| 165 | Ga0466692_193948 | 3300042591 | Bacteria | 9758 |
| 166 | Ga0466695_379396 | 3300042595 | Unclassified | 2769 |
| 167 | Ga0466696_283703 | 3300042596 | Bacteria | 19581 |
| 168 | JGI24702J35022_10074246 | 3300002462 | Bacteria | 1835 |
| 169 | CVPL010W_10005074 | 3300002931 | Bacteria | 14271 |
| 170 | CVPL005W_1001807 | 3300002934 | Unclassified | 6782 |
| 171 | Ga0068302_10000086 | 3300005071 | Bacteria | 8701 |
| 172 | Ga0103265_1000457 | 3300007068 | Unclassified | 6945 |
| 173 | Ga0102734_1000029 | 3300007129 | Bacteria | 68380 |
| 174 | Ga0102738_1000014 | 3300007141 | Bacteria | 90212 |
| 175 | Ga0103264_1000587 | 3300007188 | Bacteria | 23529 |
| 176 | Ga0103268_1005849 | 3300007192 | Bacteria | 2491 |
| 177 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 178 | Ga0123357_10001915 | 3300009784 | Bacteria | 22651 |
| 179 | Ga0466710_458456 | 3300042613 | Unclassified | 1223 |
| 180 | Ga0466715_030743 | 3300042616 | Bacteria | 4935 |
| 181 | Ga0466726_067584 | 3300042619 | Bacteria | 4925 |
| 182 | Ga0466734_083453 | 3300042623 | Bacteria | 6358 |
| 183 | Ga0466734_128631 | 3300042623 | Unclassified | 1951 |
| 184 | Ga0466702_420939 | 3300042635 | Bacteria | 6684 |
| 185 | Ga0466725_025670 | 3300042654 | Bacteria | 15034 |
| 186 | Ga0466725_408172 | 3300042654 | Bacteria | 1529 |
| 187 | Ga0466727_137609 | 3300042655 | Bacteria | 15927 |
| 188 | Ga0123357_10018066 | 3300009784 | Bacteria | 9365 |
| 189 | Ga0123356_10005609 | 3300010049 | Bacteria | 12758 |
| 190 | Ga0123356_10979075 | 3300010049 | Bacteria | 1016 |
| 191 | Ga0123353_10354942 | 3300010167 | Unclassified | 2207 |
| 192 | Ga0466701_048756 | 3300042598 | Bacteria | 9025 |
| 193 | Ga0466701_057745 | 3300042598 | Bacteria | 2351 |
| 194 | Ga0466701_060092 | 3300042598 | Bacteria | 2343 |
| 195 | Ga0466717_222936 | 3300042604 | Bacteria | 2706 |
| 196 | Ga0466717_280629 | 3300042604 | Unclassified | 3870 |
| 197 | Ga0160441_100201 | 3300012825 | Unclassified | 60884 |
| 198 | Ga0160455_100048 | 3300012837 | Bacteria | 254011 |
| 199 | Ga0160435_1001779 | 3300012857 | Bacteria | 5325 |
| 200 | Ga0466690_406175 | 3300042590 | Bacteria | 69346 |
| 201 | Ga0466701_005098 | 3300042598 | Unclassified | 2222 |
| 202 | JGI24702J35022_10008095 | 3300002462 | Bacteria | 5983 |
| 203 | Ga0102735_1005860 | 3300007080 | Unclassified | 2343 |
| 204 | Ga0103261_1000039 | 3300007083 | Bacteria | 43477 |
| 205 | Ga0102739_1000001 | 3300007095 | Bacteria | 120035 |
| 206 | Ga0104042_1073570 | 3300007130 | Unclassified | 709 |
| 207 | Ga0102738_1004908 | 3300007141 | Unclassified | 1899 |
| 208 | Ga0102738_1032118 | 3300007141 | Unclassified | 789 |
| 209 | Ga0102737_1003109 | 3300007142 | Bacteria | 3899 |
| 210 | Ga0104019_1191147 | 3300007150 | Bacteria | 1928 |
| 211 | Ga0103264_1000443 | 3300007188 | Bacteria | 21903 |
| 212 | Ga0103268_1049146 | 3300007192 | Unclassified | 1667 |
| 213 | Ga0105005_1097781 | 3300007505 | Unclassified | 1204 |
| 214 | Ga0466723_001810 | 3300042618 | Bacteria | 1041 |
| 215 | Ga0466726_032824 | 3300042619 | Bacteria | 12093 |
| 216 | Ga0466726_188842 | 3300042619 | Bacteria | 15083 |
| 217 | Ga0466729_129497 | 3300042621 | Bacteria | 7258 |
| 218 | Ga0466734_029421 | 3300042623 | Bacteria | 26553 |
| 219 | Ga0466704_473875 | 3300042643 | Bacteria | 7315 |
| 220 | Ga0466709_407126 | 3300042648 | Bacteria | 3997 |
| 221 | Ga0466724_62199 | 3300042649 | Bacteria | 9065 |
| 222 | Ga0466708_158539 | 3300042652 | Bacteria | 14078 |
| 223 | Ga0466708_215602 | 3300042652 | Bacteria | 15739 |
| 224 | Ga0466725_167598 | 3300042654 | Bacteria | 15022 |
| 225 | Ga0466727_335351 | 3300042655 | Bacteria | 67580 |
| 226 | Ga0123353_10389727 | 3300010167 | Bacteria | 2079 |
| 227 | Ga0466701_092728 | 3300042598 | Bacteria | 2092 |
| 228 | Ga0466714_165404 | 3300042603 | Bacteria | 1984 |
| 229 | Ga0466719_055618 | 3300042606 | Bacteria | 10384 |
| 230 | Ga0466697_086601 | 3300042611 | Bacteria | 3052 |
| 231 | Ga0466657_021707 | 3300042582 | Bacteria | 36648 |
| 232 | Ga0466657_144931 | 3300042582 | Bacteria | 5126 |
| 233 | Ga0466657_165250 | 3300042582 | Bacteria | 1218 |
| 234 | Ga0466691_077504 | 3300042593 | Bacteria | 2153 |
| 235 | Ga0466691_106582 | 3300042593 | Bacteria | 7070 |
| 236 | Ga0466696_110075 | 3300042596 | Bacteria | 5185 |
| 237 | Ga0466699_121087 | 3300042597 | Bacteria | 3662 |
| 238 | 2217907778 | 2209111014 | Unclassified | 2556 |
| 239 | JGI24702J35022_10004800 | 3300002462 | Bacteria | 7988 |
| 240 | Ga0104045_1080481 | 3300007085 | Unclassified | 1197 |
| 241 | Ga0102734_1034942 | 3300007129 | Unclassified | 1303 |
| 242 | Ga0103260_1000020 | 3300007139 | Bacteria | 70191 |
| 243 | Ga0102737_1000494 | 3300007142 | Bacteria | 12852 |
| 244 | Ga0103268_1000925 | 3300007192 | Unclassified | 8015 |
| 245 | Ga0466710_042268 | 3300042613 | Unclassified | 5941 |
| 246 | Ga0466711_063795 | 3300042615 | Bacteria | 5388 |
| 247 | Ga0466715_438666 | 3300042616 | Bacteria | 23685 |
| 248 | Ga0466723_020620 | 3300042618 | Bacteria | 11703 |
| 249 | Ga0466726_047171 | 3300042619 | Bacteria | 2325 |
| 250 | Ga0466726_079457 | 3300042619 | Bacteria | 4157 |
| 251 | Ga0466728_181251 | 3300042620 | Bacteria | 18833 |
| 252 | Ga0466729_282678 | 3300042621 | Unclassified | 1429 |
| 253 | Ga0466731_247532 | 3300042622 | Unclassified | 1310 |
| 254 | Ga0466730_040457 | 3300042625 | Bacteria | 1598 |
| 255 | Ga0466703_060848 | 3300042636 | Bacteria | 8939 |
| 256 | Ga0466703_320420 | 3300042636 | Bacteria | 23900 |
| 257 | Ga0466704_195288 | 3300042643 | Bacteria | 25757 |
| 258 | Ga0466709_172994 | 3300042648 | Bacteria | 28560 |
| 259 | Ga0466725_087681 | 3300042654 | Bacteria | 5011 |
| 260 | Ga0123355_10317937 | 3300009826 | Bacteria | 2101 |
| 261 | Ga0123356_10020919 | 3300010049 | Bacteria | 6189 |
| 262 | Ga0123354_10116493 | 3300010882 | Bacteria | 3484 |
| 263 | Ga0160454_100702 | 3300012798 | Bacteria | 7292 |
| 264 | Ga0160471_108544 | 3300012812 | Unclassified | 1189 |
| 265 | Ga0466701_045249 | 3300042598 | Unclassified | 102024 |
| 266 | Ga0466701_053737 | 3300042598 | Bacteria | 3550 |
| 267 | Ga0466719_112619 | 3300042606 | Bacteria | 9806 |
| 268 | Ga0466705_144704 | 3300042612 | Bacteria | 26960 |
| 269 | Ga0466733_093838 | 3300042659 | Bacteria | 4293 |
| 270 | Ga0160470_108444 | 3300012813 | Unclassified | 1040 |
| 271 | Ga0160458_100003 | 3300012832 | Bacteria | 774753 |
| 272 | Ga0160460_112876 | 3300012845 | Unclassified | 985 |
| 273 | Ga0160430_100531 | 3300012852 | Bacteria | 20613 |
| 274 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 275 | Ga0415639_012149 | 3300038395 | Bacteria | 25902 |
| 276 | Ga0466657_056362 | 3300042582 | Bacteria | 20258 |
| 277 | Ga0466691_156291 | 3300042593 | Bacteria | 26465 |
| 278 | Ga0466695_078306 | 3300042595 | Bacteria | 5706 |
| 279 | Ga0466701_004340 | 3300042598 | Bacteria | 2227 |
| 280 | HBC_ctgsDRAFT_1021392 | 3300000333 | Bacteria | 1580 |
| 281 | CVPL010W_10006354 | 3300002931 | Bacteria | 21839 |
| 282 | Ga0103266_1000773 | 3300007067 | Unclassified | 6173 |
| 283 | Ga0103265_1026679 | 3300007068 | Unclassified | 772 |
| 284 | Ga0102739_1000846 | 3300007095 | Unclassified | 5451 |
| 285 | Ga0102739_1008447 | 3300007095 | Unclassified | 1356 |
| 286 | Ga0103260_1000257 | 3300007139 | Bacteria | 20061 |
| 287 | Ga0104048_1168521 | 3300007143 | Bacteria | 4147 |
| 288 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 289 | Ga0466712_182347 | 3300042614 | Bacteria | 11394 |
| 290 | Ga0466711_109307 | 3300042615 | Bacteria | 29995 |
| 291 | Ga0466715_109155 | 3300042616 | Bacteria | 3627 |
| 292 | Ga0466715_269641 | 3300042616 | Bacteria | 3729 |
| 293 | Ga0466729_037640 | 3300042621 | Bacteria | 1242 |
| 294 | Ga0466734_034177 | 3300042623 | Unclassified | 2257 |
| 295 | Ga0466734_076859 | 3300042623 | Bacteria | 25073 |
| 296 | Ga0466734_128421 | 3300042623 | Bacteria | 1979 |
| 297 | Ga0466735_207643 | 3300042624 | Unclassified | 1718 |
| 298 | Ga0466709_083350 | 3300042648 | Bacteria | 4650 |
| 299 | Ga0466709_217396 | 3300042648 | Bacteria | 210619 |
| 300 | Ga0466724_07269 | 3300042649 | Unclassified | 5832 |
| 301 | Ga0466725_049736 | 3300042654 | Bacteria | 2193 |
| 302 | Ga0466725_272788 | 3300042654 | Bacteria | 15338 |
| 303 | Ga0123357_10668122 | 3300009784 | Bacteria | 760 |
| 304 | Ga0123356_10811307 | 3300010049 | Unclassified | 1107 |
| 305 | Ga0123354_10120119 | 3300010882 | Bacteria | 3400 |
| 306 | Ga0160464_100135 | 3300012805 | Bacteria | 81696 |
| 307 | Ga0466717_058368 | 3300042604 | Bacteria | 4391 |
| 308 | Ga0466716_288795 | 3300042605 | Bacteria | 12220 |
| 309 | Ga0466719_142224 | 3300042606 | Bacteria | 4621 |
| 310 | Ga0466722_155417 | 3300042609 | Bacteria | 2209 |
| 311 | Ga0466722_196355 | 3300042609 | Bacteria | 12120 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.