Protein Family IF11269

Metagenome Metatranscriptome Isolate
725 Members
315 Samples
524 Scaffolds
232.43 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2681812870|2682010921|
Length
266 aa
Sequence
MSLPVLDRQAVAGSARIRRPRLLDKEKQMATRSKAYRAAAEKIDRDELYTPLQAVRLAKETSPTKYDATVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFANGEKAEQARAAGADIVGGDELIEKVAAGYTDFDSAVATPDLMGKVGRLGKVLGPRGLMPNPKTGTVTMDVAKAVEDIKGGKIEFRVDKHSNLHFIIGKVSFDEKALVENYAAAIEEVLRLKPSSSKGRYISKATLSTTMGPGIPVDPSKATKLLEDDAA

πŸ“Š Sample Types

Isolate 27.7%
Metagenome 71.6%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 28.1%
Termitidae 16.9%
Formicidae 11.6%
Apidae 7.9%
Culicidae 4.6%
Kalotermitidae 4.3%
Anthocoridae 3.3%
Cambaridae 3.0%
Scarabaeidae 2.6%
Elmidae 2.3%
Tenebrionidae 2.3%
Armadillidiidae 1.7%
Hydrophilidae 1.0%
Rhinotermitidae 1.0%
Dytiscidae 1.0%
Termopsidae 1.0%
Blattidae 0.7%
Passalidae 0.7%
Drosophilidae 0.7%
Curculionidae 0.7%
Thomisidae 0.3%
Delphacidae 0.3%
Hodotermitidae 0.3%
Pyralidae 0.3%
Pentatomidae 0.3%
Pyroglyphidae 0.3%
Crambidae 0.3%
Cerambycidae 0.3%
Reduviidae 0.3%
Monophlebidae 0.3%
Ixodidae 0.3%
Chironomidae 0.3%
Cimicidae 0.3%
Siricidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 666
Eukaryota 0
Viruses 0
Unclassified 59

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
2 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
3 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
4 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
5 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
6 2832343623 Apibacter adventoris wkB180 Isolate Apidae
7 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
8 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
9 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
10 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
11 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
12 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
13 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
14 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
15 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
16 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
17 2504756063 Isoptericola variabilis J5 Isolate Unclassified
18 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
19 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
20 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
21 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
22 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
23 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
27 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
28 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
29 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
30 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
31 3000336795 Cardinium endosymbiont of Sogatella furcifera cSfur Isolate Delphacidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
34 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
37 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
38 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
48 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
51 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
52 2832372155 Apibacter adventoris wkB301 Isolate Apidae
53 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
54 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
55 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
56 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
57 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
58 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
59 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
60 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
61 2900368070 Nocardia aurantia RB56 Isolate Termitidae
62 2912749649 Streptomyces sp. GS7 Isolate Termitidae
63 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
64 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
65 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
66 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
67 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
68 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
69 8062747827 Yimella sp. cx-51 Isolate Cambaridae
70 3000153175 Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 Isolate Pyroglyphidae
71 3006461590 Streptomyces sp. RB5 Isolate Termitidae
72 3006667155 Streptomyces sp. SID9727 Isolate
73 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
74 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
75 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
78 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
79 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
80 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
81 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
82 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
83 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
84 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
85 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
86 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
87 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
88 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
89 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
90 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
91 2547132081 Streptomyces sp. S4 Isolate Formicidae
92 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
93 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
94 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
95 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
96 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
97 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
98 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
99 2585427656 Endosymbiont of Llaveia axin axin Isolate Monophlebidae
100 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
101 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
102 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
103 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
104 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
105 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
106 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
107 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
108 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
109 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
110 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
111 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
112 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
113 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
114 3300026545 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 Metagenome Formicidae
115 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
116 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
117 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
118 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
119 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
120 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
121 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
122 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
123 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
124 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
125 2896955351 Streptomyces sp. GF20 Isolate Termitidae
126 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
127 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
128 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
129 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
130 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
131 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
132 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
133 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
134 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
135 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
136 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
137 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
138 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
139 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
140 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
141 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
142 649989992 Pseudonocardia sp. P1 Isolate Formicidae
143 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
144 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
145 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
146 8073544309 Actinomadura sp. RB99 Isolate Termitidae
147 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
148 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
149 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
150 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
151 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
152 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
153 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
154 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
155 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
156 2832298047 Apibacter sp. wkB309 Isolate Apidae
157 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
158 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
159 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
160 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
161 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
162 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
163 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
164 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
165 2908241010 Streptomyces sp. HF10 Isolate Termitidae
166 2912817845 Streptomyces griseus SID164 Isolate
167 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
168 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
169 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
170 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
171 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
172 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
173 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
174 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
175 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
176 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
177 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
178 3006468911 Streptomyces sp. RB17 Isolate Termitidae
179 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
180 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
181 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
182 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
183 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
184 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
185 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
186 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
187 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
188 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
189 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
190 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
191 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
192 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
193 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
194 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
195 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
196 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
197 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
198 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
199 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
200 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
201 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
202 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
203 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
204 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
205 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
206 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
207 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
208 2505679068 Isoptericola variabilis 225 Isolate Unclassified
209 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
210 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
211 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
212 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
213 2785510743 Apibacter sp. ESL0404 Isolate Apidae
214 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
215 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
216 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
217 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
218 8062637095 Yimella sp. cx-51 Isolate Cambaridae
219 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
220 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
221 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
222 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
223 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
224 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
225 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
226 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
227 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
228 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
229 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
230 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
231 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
232 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
233 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
234 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
235 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
236 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
237 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
238 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
239 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
240 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
241 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
242 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
243 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
244 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
245 2862784999 Streptomyces sp. M41 Isolate Unclassified
246 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
247 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
248 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
249 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
250 2909412500 Yimella sp. cx-573 Isolate Cambaridae
251 2931425734 Nocardioides sp. J2M5 Isolate
252 2931430189 Tessaracoccus palaemonis J1M15 Isolate
253 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
254 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
255 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
256 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
257 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
258 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
259 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
260 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
261 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
262 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
263 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
264 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
265 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
266 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
267 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
268 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
269 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
270 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
271 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
272 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
273 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
274 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
275 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
276 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
277 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
278 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
279 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
280 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
281 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
282 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
283 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
284 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
285 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
286 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
287 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
288 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
289 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
290 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
291 2568526170 Bifidobacterium sp. A11 Isolate Apidae
292 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
293 2603880170 Burkholderiales A2 Isolate Unclassified
294 2603880172 Burkholderiales C Isolate Unclassified
295 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
296 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
297 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
298 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
299 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
300 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
301 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
302 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
303 3002678670 Agromyces sp. G127AT Isolate Unclassified
304 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
305 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
306 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
307 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
308 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
309 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
310 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
311 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
312 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
313 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
314 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
315 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_185216 3300042659 Bacteria 77937
2 Ga0562379_0161 3300056790 Bacteria 199917
3 Ga0562379_0191 3300056790 Bacteria 175707
4 Ga0562375_1477 3300056856 Bacteria 31484
5 Ga0562376_0055 3300056857 Bacteria 289184
6 Ga0562374_0154 3300057007 Bacteria 161028
7 Ga0466705_440196 3300042612 Bacteria 3072
8 Ga0466710_094078 3300042613 Bacteria 1155
9 Ga0466711_058099 3300042615 Bacteria 7184
10 Ga0466715_034798 3300042616 Bacteria 6327
11 Ga0466723_078474 3300042618 Bacteria 7667
12 Ga0466723_117996 3300042618 Bacteria 30718
13 Ga0466723_234427 3300042618 Bacteria 17603
14 Ga0466726_371457 3300042619 Bacteria 3098
15 Ga0466728_454406 3300042620 Bacteria 14071
16 Ga0160432_100253 3300012818 Bacteria 45732
17 Ga0160459_102647 3300012831 Bacteria 2823
18 Ga0160447_100164 3300012849 Bacteria 44087
19 Ga0160435_1003834 3300012857 Bacteria 3520
20 Ga0415639_256637 3300038395 Bacteria 1211
21 Ga0466692_127049 3300042591 Bacteria 3012
22 Ga0466696_366828 3300042596 Unclassified 4175
23 2227535714 2225789004 Bacteria 63282
24 JGI24702J35022_10001523 3300002462 Bacteria 14396
25 JGI24699J35502_11132030 3300002509 Bacteria 6294
26 JGI24696J40584_12829721 3300002834 Bacteria 927
27 CVPL010W_10007946 3300002931 Bacteria 10343
28 Ga0072941_1081391 3300005201 Bacteria 8066
29 Ga0072941_1092639 3300005201 Unclassified 13811
30 Ga0104045_1005631 3300007085 Bacteria 4901
31 Ga0102738_1000044 3300007141 Bacteria 91568
32 Ga0103264_1000132 3300007188 Bacteria 42832
33 Ga0103264_1000374 3300007188 Unclassified 23636
34 Ga0123355_10401057 3300009826 Bacteria 1769
35 Ga0123356_10003051 3300010049 Bacteria 17703
36 Ga0123353_10014575 3300010167 Bacteria 11346
37 Ga0123353_10058330 3300010167 Bacteria 6185
38 Ga0123354_10061263 3300010882 Bacteria 5555
39 Ga0466735_142045 3300042624 Bacteria 10879
40 Ga0466730_068856 3300042625 Bacteria 20075
41 Ga0466703_056304 3300042636 Bacteria 4548
42 Ga0466703_166237 3300042636 Bacteria 199031
43 Ga0466704_078630 3300042643 Bacteria 15990
44 Ga0466724_44239 3300042649 Bacteria 2001
45 Ga0466727_215359 3300042655 Bacteria 55489
46 Ga0466701_070234 3300042598 Bacteria 2559
47 Ga0466701_076667 3300042598 Bacteria 2950
48 Ga0466706_102548 3300042599 Bacteria 2865
49 Ga0466706_139418 3300042599 Bacteria 7718
50 Ga0466707_243269 3300042601 Bacteria 6521
51 Ga0466707_273399 3300042601 Bacteria 64548
52 Ga0466713_016256 3300042602 Bacteria 3124
53 Ga0466713_033141 3300042602 Bacteria 29242
54 Ga0466713_091678 3300042602 Bacteria 37271
55 Ga0466713_123761 3300042602 Bacteria 17729
56 Ga0466717_116989 3300042604 Bacteria 1978
57 Ga0466719_356838 3300042606 Bacteria 2027
58 Ga0466698_146662 3300042610 Bacteria 2916
59 Ga0466697_188858 3300042611 Bacteria 2278
60 Ga0466705_099663 3300042612 Bacteria 6936
61 Ga0466705_106782 3300042612 Bacteria 11995
62 Ga0466732_082349 3300042656 Bacteria 5142
63 Ga0466733_127447 3300042659 Bacteria 2807
64 Ga0562379_0012 3300056790 Bacteria 1590196
65 Ga0562377_0931 3300056842 Bacteria 37296
66 Ga0562375_0080 3300056856 Bacteria 309561
67 Ga0562376_0246 3300056857 Bacteria 106482
68 Ga0466705_448275 3300042612 Bacteria 17701
69 Ga0466711_122381 3300042615 Bacteria 8223
70 Ga0466715_119678 3300042616 Bacteria 6351
71 Ga0466723_051735 3300042618 Bacteria 4722
72 Ga0466723_289517 3300042618 Bacteria 37052
73 Ga0466726_011258 3300042619 Bacteria 19089
74 Ga0466729_175617 3300042621 Bacteria 10686
75 Ga0160430_100679 3300012852 Unclassified 16659
76 Ga0255808_1000406 3300023282 Bacteria 2041
77 Ga0466657_256790 3300042582 Bacteria 8916
78 Ga0466693_423245 3300042592 Unclassified 3644
79 Ga0466694_251668 3300042594 Bacteria 2782
80 Ga0466696_365393 3300042596 Bacteria 3005
81 Ga0466699_440635 3300042597 Bacteria 1499
82 Ga0466701_008631 3300042598 Bacteria 14466
83 IMNBL1DRAFT_c0016570 3300000062 Bacteria 3147
84 IMNBL1DRAFT_c0030742 3300000062 Bacteria 1964
85 JGI24702J35022_10013322 3300002462 Bacteria 4556
86 JGI24696J40584_12902835 3300002834 Bacteria 1197
87 JGI24696J40584_12939235 3300002834 Bacteria 1647
88 Ga0103264_1000468 3300007188 Bacteria 30094
89 Ga0103264_1000513 3300007188 Unclassified 19751
90 Ga0123357_10007348 3300009784 Bacteria 13605
91 Ga0123357_10119097 3300009784 Unclassified 3334
92 Ga0123357_10145937 3300009784 Bacteria 2890
93 Ga0123357_10146265 3300009784 Unclassified 2885
94 Ga0123356_10001142 3300010049 Bacteria 29321
95 Ga0123356_10018156 3300010049 Bacteria 6680
96 Ga0123356_10110251 3300010049 Bacteria 2657
97 Ga0123353_10017322 3300010167 Bacteria 10583
98 Ga0123353_10019017 3300010167 Bacteria 10191
99 Ga0123353_10621736 3300010167 Bacteria 1537
100 Ga0123354_10028907 3300010882 Bacteria 8726
101 Ga0123354_10538058 3300010882 Bacteria 888
102 Ga0123354_10550613 3300010882 Bacteria 870
103 Ga0466734_007465 3300042623 Bacteria 1177
104 Ga0466735_156384 3300042624 Bacteria 1241
105 Ga0466730_019368 3300042625 Bacteria 1430
106 Ga0466730_074967 3300042625 Bacteria 1751
107 Ga0466704_449682 3300042643 Bacteria 3196
108 Ga0466704_490400 3300042643 Bacteria 1447
109 Ga0466704_546614 3300042643 Bacteria 12463
110 Ga0466724_62423 3300042649 Bacteria 1130
111 Ga0466706_175840 3300042599 Bacteria 8687
112 Ga0466706_227550 3300042599 Bacteria 1923
113 Ga0466707_093680 3300042601 Bacteria 71749
114 Ga0466707_189132 3300042601 Bacteria 18291
115 Ga0466713_027045 3300042602 Bacteria 6895
116 Ga0466713_070245 3300042602 Bacteria 20718
117 Ga0466713_071425 3300042602 Bacteria 5004
118 Ga0466713_073736 3300042602 Bacteria 61051
119 Ga0466716_467546 3300042605 Unclassified 2274
120 Ga0466719_103466 3300042606 Unclassified 5223
121 Ga0466721_332902 3300042608 Bacteria 2523
122 Ga0466722_024827 3300042609 Bacteria 13981
123 Ga0466698_204071 3300042610 Bacteria 2497
124 Ga0466697_039353 3300042611 Bacteria 6345
125 Ga0466697_250597 3300042611 Bacteria 2384
126 Ga0466705_086814 3300042612 Bacteria 1746
127 Ga0466705_325004 3300042612 Bacteria 3087
128 Ga0466733_133556 3300042659 Bacteria 9921
129 Ga0562375_0511 3300056856 Bacteria 79486
130 Ga0562375_0569 3300056856 Bacteria 72979
131 Ga0466711_435413 3300042615 Bacteria 16458
132 Ga0466715_149316 3300042616 Bacteria 3291
133 Ga0466718_126774 3300042617 Bacteria 1105
134 Ga0466723_106153 3300042618 Bacteria 3443
135 Ga0466723_353373 3300042618 Unclassified 2876
136 Ga0466728_232311 3300042620 Bacteria 15242
137 Ga0160440_104218 3300012815 Unclassified 1367
138 Ga0160459_100207 3300012831 Bacteria 31214
139 Ga0160452_100230 3300012834 Bacteria 57210
140 Ga0160460_101653 3300012845 Unclassified 6839
141 Ga0160447_117712 3300012849 Bacteria 1234
142 Ga0160430_101062 3300012852 Bacteria 11455
143 Ga0160457_1003697 3300012858 Unclassified 2601
144 Ga0466693_041491 3300042592 Bacteria 1819
145 Ga0466693_060256 3300042592 Bacteria 3170
146 Ga0466693_128047 3300042592 Unclassified 5974
147 Ga0466691_005789 3300042593 Bacteria 8937
148 Ga0466691_169002 3300042593 Bacteria 9559
149 Ga0466695_269537 3300042595 Bacteria 1174
150 Ga0466695_388832 3300042595 Bacteria 4424
151 Ga0466696_046205 3300042596 Bacteria 46066
152 Ga0466696_186256 3300042596 Bacteria 19319
153 Ga0466696_255883 3300042596 Bacteria 1191
154 Ga0466696_371432 3300042596 Bacteria 9280
155 Ga0466696_375780 3300042596 Bacteria 7399
156 Ga0466699_008495 3300042597 Bacteria 2196
157 Ga0466699_109225 3300042597 Bacteria 2160
158 HBC_ctgsDRAFT_1047487 3300000333 Bacteria 1046
159 JGI24698J34947_10102941 3300002449 Unclassified 1279
160 JGI24696J40584_12910432 3300002834 Unclassified 1251
161 CVPL005W_1002456 3300002934 Unclassified 3608
162 CVPL005L_10000306 3300002938 Bacteria 48097
163 Ga0072940_1164920 3300005200 Bacteria 2070
164 Ga0102735_1000088 3300007080 Bacteria 28320
165 Ga0103268_1000292 3300007192 Bacteria 40849
166 Ga0123357_10000517 3300009784 Unclassified 37763
167 Ga0123357_10088888 3300009784 Bacteria 4035
168 Ga0123356_10000385 3300010049 Bacteria 50352
169 Ga0123356_10057564 3300010049 Bacteria 3623
170 Ga0123353_10169880 3300010167 Bacteria 3462
171 Ga0123353_10503009 3300010167 Bacteria 1765
172 Ga0123354_10188767 3300010882 Bacteria 2318
173 Ga0466731_321484 3300042622 Bacteria 1848
174 Ga0466735_171206 3300042624 Bacteria 98562
175 Ga0466703_019759 3300042636 Bacteria 14140
176 Ga0466703_244912 3300042636 Bacteria 5908
177 Ga0466704_175019 3300042643 Bacteria 20080
178 Ga0466724_47439 3300042649 Bacteria 410820
179 Ga0466708_412697 3300042652 Bacteria 54168
180 Ga0466725_330813 3300042654 Bacteria 1023
181 Ga0466706_196757 3300042599 Bacteria 4486
182 Ga0466713_032884 3300042602 Bacteria 4116
183 Ga0466713_092579 3300042602 Bacteria 53429
184 Ga0466713_092950 3300042602 Bacteria 117604
185 Ga0466713_101252 3300042602 Bacteria 9711
186 Ga0466720_177826 3300042607 Bacteria 1607
187 Ga0466721_358188 3300042608 Bacteria 1369
188 Ga0466698_189369 3300042610 Bacteria 8458
189 Ga0466705_379349 3300042612 Bacteria 8842
190 Ga0466732_415454 3300042656 Bacteria 3520
191 Ga0466733_075930 3300042659 Bacteria 14265
192 Ga0466733_087265 3300042659 Bacteria 208960
193 Ga0466733_117626 3300042659 Bacteria 1997
194 Ga0466733_158876 3300042659 Bacteria 3877
195 Ga0562376_0256 3300056857 Bacteria 105356
196 Ga0466705_404631 3300042612 Unclassified 4925
197 Ga0466710_068695 3300042613 Bacteria 6553
198 Ga0466712_156123 3300042614 Bacteria 2267
199 Ga0466726_245772 3300042619 Bacteria 4462
200 Ga0466726_390837 3300042619 Bacteria 1907
201 Ga0466726_484479 3300042619 Bacteria 6917
202 Ga0466728_194825 3300042620 Bacteria 21549
203 Ga0466728_426707 3300042620 Bacteria 1349
204 Ga0160456_100953 3300012820 Bacteria 7616
205 Ga0160469_100032 3300012824 Bacteria 268332
206 Ga0160458_114116 3300012832 Bacteria 867
207 Ga0160443_100074 3300012848 Bacteria 181634
208 Ga0233288_1009206 3300022232 Bacteria 2167
209 Ga0255808_1001293 3300023282 Bacteria 2274
210 Ga0255574_1000019 3300026545 Bacteria 82376
211 Ga0415639_149170 3300038395 Bacteria 2089
212 Ga0466656_163020 3300042550 Bacteria 1940
213 Ga0466690_028688 3300042590 Bacteria 10308
214 Ga0466690_218913 3300042590 Unclassified 6452
215 Ga0466692_124959 3300042591 Bacteria 5752
216 Ga0466693_448516 3300042592 Bacteria 20696
217 Ga0466691_061025 3300042593 Bacteria 20465
218 Ga0466691_221380 3300042593 Bacteria 15148
219 Ga0466699_060280 3300042597 Unclassified 2080
220 IMNBL1DRAFT_c0001223 3300000062 Bacteria 19402
221 AustNasuHG_c1000390 3300000089 Bacteria 15232
222 JGI24702J35022_10000267 3300002462 Bacteria 30031
223 JGI24705J35276_11966182 3300002504 Bacteria 810
224 JGI24705J35276_12201724 3300002504 Bacteria 1623
225 CVPL010W_10004965 3300002931 Bacteria 14662
226 Ga0068305_10015932 3300005083 Bacteria 27809
227 Ga0072941_1185484 3300005201 Bacteria 2835
228 Ga0072941_1421363 3300005201 Bacteria 2415
229 Ga0102740_1000658 3300007140 Bacteria 9354
230 Ga0123357_10071996 3300009784 Unclassified 4582
231 Ga0123357_10257377 3300009784 Bacteria 1853
232 Ga0123357_10261815 3300009784 Bacteria 1826
233 Ga0123356_10003775 3300010049 Bacteria 15775
234 Ga0123353_10030295 3300010167 Bacteria 8361
235 Ga0123353_10199891 3300010167 Bacteria 3146
236 Ga0123353_10473288 3300010167 Bacteria 1836
237 Ga0466731_136929 3300042622 Unclassified 2906
238 Ga0466735_074223 3300042624 Bacteria 6601
239 Ga0466730_063625 3300042625 Bacteria 1740
240 Ga0466730_089360 3300042625 Bacteria 1121
241 Ga0466703_013076 3300042636 Bacteria 3327
242 Ga0466703_180492 3300042636 Bacteria 25666
243 Ga0466704_380863 3300042643 Bacteria 21447
244 Ga0466704_541260 3300042643 Bacteria 9204
245 Ga0466724_43696 3300042649 Bacteria 561295
246 Ga0466724_64705 3300042649 Unclassified 4780
247 Ga0466708_025171 3300042652 Unclassified 34338
248 Ga0466706_049498 3300042599 Bacteria 7511
249 Ga0466706_065083 3300042599 Bacteria 14584
250 Ga0466706_123047 3300042599 Bacteria 432554
251 Ga0466706_183342 3300042599 Bacteria 5616
252 Ga0466700_106611 3300042600 Bacteria 8627
253 Ga0466707_164308 3300042601 Bacteria 5061
254 Ga0466707_336977 3300042601 Bacteria 11625
255 Ga0466717_245139 3300042604 Bacteria 2261
256 Ga0466717_300154 3300042604 Bacteria 4849
257 Ga0466716_128955 3300042605 Bacteria 1788
258 Ga0466721_001270 3300042608 Bacteria 2250
259 Ga0466722_208926 3300042609 Bacteria 1769
260 Ga0466705_091744 3300042612 Bacteria 7576
261 Ga0466733_120603 3300042659 Bacteria 1357
262 Ga0466733_207774 3300042659 Bacteria 1430
263 Ga0562377_0137 3300056842 Bacteria 212469
264 Ga0562374_0149 3300057007 Bacteria 167116
265 Ga0466711_462443 3300042615 Bacteria 12576
266 Ga0466715_223437 3300042616 Bacteria 30992
267 Ga0466718_160337 3300042617 Bacteria 7528
268 Ga0466723_119111 3300042618 Unclassified 13004
269 Ga0466726_251535 3300042619 Bacteria 6616
270 Ga0466728_080257 3300042620 Bacteria 11995
271 Ga0466728_341550 3300042620 Bacteria 38650
272 Ga0466728_406593 3300042620 Bacteria 5843
273 Ga0160446_112382 3300012835 Bacteria 1059
274 Ga0160444_102397 3300012841 Bacteria 2900
275 Ga0160434_120832 3300012850 Bacteria 998
276 Ga0160435_1000012 3300012857 Bacteria 210190
277 Ga0466690_074052 3300042590 Unclassified 3328
278 Ga0466693_238750 3300042592 Bacteria 2551
279 Ga0466694_389511 3300042594 Bacteria 1079
280 Ga0466696_040070 3300042596 Bacteria 5365
281 Ga0466696_205463 3300042596 Bacteria 14851
282 Ga0466696_258694 3300042596 Bacteria 2903
283 Ga0466696_377181 3300042596 Bacteria 59848
284 2227507940 2225789004 Bacteria 76787
285 IMNBL1DRAFT_c0000131 3300000062 Bacteria 66549
286 IMNBL1DRAFT_c0032977 3300000062 Bacteria 1861
287 JGI24702J35022_10017399 3300002462 Bacteria 3928
288 JGI24703J35330_11725092 3300002501 Bacteria 2508
289 JGI24705J35276_12222374 3300002504 Bacteria 2416
290 JGI24705J35276_12229827 3300002504 Bacteria 3475
291 CVPL010W_10024367 3300002931 Unclassified 3006
292 CVPL005W_1008997 3300002934 Bacteria 1673
293 Ga0102734_1013590 3300007129 Bacteria 3467
294 Ga0102737_1001558 3300007142 Bacteria 6802
295 Ga0103264_1000005 3300007188 Bacteria 151532
296 Ga0123357_10000765 3300009784 Bacteria 32455
297 Ga0123357_10268528 3300009784 Bacteria 1787
298 Ga0123356_10006983 3300010049 Bacteria 11333
299 Ga0123356_10106883 3300010049 Bacteria 2695
300 Ga0123353_10000842 3300010167 Bacteria 37294
301 Ga0123353_10574444 3300010167 Bacteria 1619
302 Ga0123353_11311642 3300010167 Bacteria 939
303 Ga0160464_103015 3300012805 Bacteria 2642
304 Ga0466729_317575 3300042621 Bacteria 5499
305 Ga0466731_358898 3300042622 Bacteria 87251
306 Ga0466735_160808 3300042624 Bacteria 4713
307 Ga0466730_018891 3300042625 Bacteria 23265
308 Ga0466703_005313 3300042636 Bacteria 2960
309 Ga0466703_107779 3300042636 Bacteria 13228
310 Ga0466704_111178 3300042643 Bacteria 22429
311 Ga0466704_422555 3300042643 Unclassified 4172
312 Ga0466724_11598 3300042649 Bacteria 1723
313 Ga0466724_45518 3300042649 Bacteria 226122
314 Ga0466727_305684 3300042655 Bacteria 3825
315 Ga0466701_088316 3300042598 Bacteria 4166
316 Ga0466706_231257 3300042599 Bacteria 218825
317 Ga0466707_089675 3300042601 Bacteria 1533
318 Ga0466713_019737 3300042602 Bacteria 21280
319 Ga0466714_004290 3300042603 Bacteria 1322
320 Ga0466714_059729 3300042603 Bacteria 25353
321 Ga0466714_077470 3300042603 Bacteria 4738
322 Ga0466721_092389 3300042608 Unclassified 1379
323 Ga0466697_008582 3300042611 Unclassified 1222
324 Ga0466697_127416 3300042611 Bacteria 1856
325 Ga0466733_001223 3300042659 Bacteria 19502
326 Ga0562379_4056 3300056790 Bacteria 8234
327 Ga0562376_1490 3300056857 Bacteria 32454
328 Ga0562376_1904 3300056857 Unclassified 27153
329 Ga0562376_3599 3300056857 Bacteria 15203
330 Ga0466710_223104 3300042613 Bacteria 2114
331 Ga0466711_035701 3300042615 Bacteria 9190
332 Ga0466715_017612 3300042616 Bacteria 40510
333 Ga0466715_320647 3300042616 Bacteria 41067
334 Ga0466715_438412 3300042616 Bacteria 13369
335 Ga0466715_522030 3300042616 Bacteria 1888
336 Ga0466718_023592 3300042617 Bacteria 7502
337 Ga0466726_080548 3300042619 Bacteria 1855
338 Ga0466726_305980 3300042619 Bacteria 10959
339 Ga0466728_413699 3300042620 Bacteria 25364
340 Ga0466729_015989 3300042621 Bacteria 1572
341 Ga0160440_100031 3300012815 Bacteria 222224
342 Ga0160447_118971 3300012849 Bacteria 1154
343 Ga0160434_100001 3300012850 Bacteria 617314
344 Ga0160457_1000015 3300012858 Bacteria 420875
345 Ga0233288_1011272 3300022232 Bacteria 2013
346 Ga0255809_1030828 3300022820 Bacteria 2333
347 Ga0466657_231035 3300042582 Unclassified 2779
348 Ga0466657_312435 3300042582 Unclassified 10167
349 Ga0466692_061574 3300042591 Bacteria 5326
350 Ga0466694_124228 3300042594 Unclassified 3646
351 Ga0466696_414784 3300042596 Bacteria 4614
352 Ga0466701_011778 3300042598 Bacteria 7311
353 IMNBL1DRAFT_c0003165 3300000062 Bacteria 10808
354 JGI24703J35330_11729412 3300002501 Bacteria 2660
355 JGI24699J35502_11039982 3300002509 Unclassified 1568
356 JGI24699J35502_11131105 3300002509 Bacteria 5464
357 JGI24699J35502_11131476 3300002509 Bacteria 5736
358 CVPL005W_1001124 3300002934 Unclassified 7784
359 Ga0102737_1000057 3300007142 Bacteria 33680
360 Ga0104048_1004381 3300007143 Unclassified 3942
361 Ga0103264_1059523 3300007188 Bacteria 2476
362 Ga0103267_1000428 3300007190 Bacteria 14398
363 Ga0123357_10008114 3300009784 Bacteria 13084
364 Ga0123357_10165649 3300009784 Bacteria 2633
365 Ga0123357_10392674 3300009784 Bacteria 1273
366 Ga0123356_10152770 3300010049 Bacteria 2295
367 Ga0123353_10052189 3300010167 Bacteria 6527
368 Ga0123353_10540214 3300010167 Unclassified 1685
369 Ga0123354_10067388 3300010882 Bacteria 5214
370 Ga0466729_275689 3300042621 Bacteria 1524
371 Ga0466734_098512 3300042623 Bacteria 1616
372 Ga0466734_148249 3300042623 Bacteria 1284
373 Ga0466730_013469 3300042625 Bacteria 2958
374 Ga0466703_392899 3300042636 Bacteria 9467
375 Ga0466724_11250 3300042649 Bacteria 7782
376 Ga0466724_33972 3300042649 Bacteria 12208
377 Ga0466724_66581 3300042649 Bacteria 665985
378 Ga0466708_290641 3300042652 Bacteria 3564
379 Ga0466727_251923 3300042655 Bacteria 11796
380 Ga0466727_259707 3300042655 Bacteria 31935
381 Ga0466701_024740 3300042598 Bacteria 2895
382 Ga0466707_119789 3300042601 Bacteria 5009
383 Ga0466707_184928 3300042601 Bacteria 90796
384 Ga0466713_075160 3300042602 Bacteria 2920
385 Ga0466713_105765 3300042602 Bacteria 92337
386 Ga0466714_020760 3300042603 Bacteria 14729
387 Ga0466717_067494 3300042604 Bacteria 1885
388 Ga0466716_254877 3300042605 Unclassified 10681
389 Ga0466716_524773 3300042605 Bacteria 15682
390 Ga0466719_084507 3300042606 Unclassified 1468
391 Ga0466719_497602 3300042606 Bacteria 8433
392 Ga0466722_030921 3300042609 Bacteria 4813
393 Ga0466705_273715 3300042612 Bacteria 53499
394 Ga0466705_361466 3300042612 Bacteria 3109
395 Ga0466732_075298 3300042656 Unclassified 2004
396 Ga0466733_189877 3300042659 Bacteria 1853
397 Ga0562375_0001 3300056856 Bacteria 3661630
398 Ga0562375_0265 3300056856 Bacteria 135455
399 Ga0562376_4978 3300056857 Bacteria 9708
400 Ga0562374_0453 3300057007 Bacteria 70067
401 Ga0466711_057703 3300042615 Bacteria 8833
402 Ga0466718_009529 3300042617 Bacteria 1933
403 Ga0466718_058112 3300042617 Bacteria 2583
404 Ga0466723_355784 3300042618 Bacteria 3021
405 Ga0466726_401873 3300042619 Bacteria 1166
406 Ga0466728_043258 3300042620 Bacteria 15558
407 Ga0466728_390129 3300042620 Bacteria 16264
408 Ga0160456_100138 3300012820 Bacteria 68367
409 Ga0160443_100129 3300012848 Bacteria 114665
410 Ga0255572_1000064 3300026175 Unclassified 85032
411 Ga0415639_024051 3300038395 Bacteria 2741
412 Ga0415639_140027 3300038395 Bacteria 2858
413 Ga0466692_062031 3300042591 Bacteria 2916
414 Ga0466693_197064 3300042592 Bacteria 94166
415 Ga0466694_064374 3300042594 Bacteria 1780
416 Ga0466696_016424 3300042596 Bacteria 6335
417 Ga0466701_004357 3300042598 Bacteria 5056
418 HBC_ctgsDRAFT_1000044 3300000333 Bacteria 30906
419 JGI24702J35022_10031965 3300002462 Bacteria 2818
420 JGI24699J35502_10796266 3300002509 Bacteria 874
421 JGI24699J35502_11133601 3300002509 Bacteria 12391
422 Ga0103261_1005302 3300007083 Unclassified 1906
423 Ga0103260_1001224 3300007139 Bacteria 4666
424 Ga0102737_1002041 3300007142 Bacteria 5205
425 Ga0103268_1000172 3300007192 Bacteria 21394
426 Ga0123357_10002228 3300009784 Bacteria 21406
427 Ga0123357_10065178 3300009784 Bacteria 4865
428 Ga0123357_10148867 3300009784 Bacteria 2848
429 Ga0123355_10000692 3300009826 Bacteria 45836
430 Ga0123356_10021135 3300010049 Bacteria 6151
431 Ga0123356_10086130 3300010049 Bacteria 2982
432 Ga0123356_10094368 3300010049 Bacteria 2857
433 Ga0123353_10001114 3300010167 Bacteria 32700
434 Ga0123354_10100558 3300010882 Bacteria 3912
435 Ga0123354_10221268 3300010882 Bacteria 2010
436 Ga0466731_014740 3300042622 Bacteria 4331
437 Ga0466735_132989 3300042624 Bacteria 1001
438 Ga0466730_051888 3300042625 Bacteria 1370
439 Ga0466703_135101 3300042636 Bacteria 119691
440 Ga0466703_335846 3300042636 Bacteria 3386
441 Ga0466704_034783 3300042643 Bacteria 163660
442 Ga0466704_363032 3300042643 Bacteria 24824
443 Ga0466708_045890 3300042652 Bacteria 13303
444 Ga0466708_183984 3300042652 Bacteria 148491
445 Ga0466708_228583 3300042652 Bacteria 25073
446 Ga0466725_023268 3300042654 Bacteria 7029
447 Ga0466725_136486 3300042654 Bacteria 1949
448 Ga0466727_202463 3300042655 Bacteria 15593
449 Ga0466727_266077 3300042655 Bacteria 1603
450 Ga0466727_307077 3300042655 Bacteria 3818
451 Ga0466701_102875 3300042598 Bacteria 2487
452 Ga0466706_002696 3300042599 Bacteria 4951
453 Ga0466706_082691 3300042599 Bacteria 3249
454 Ga0466706_240792 3300042599 Bacteria 18647
455 Ga0466707_023003 3300042601 Bacteria 59191
456 Ga0466713_027259 3300042602 Bacteria 27092
457 Ga0466713_044001 3300042602 Bacteria 42258
458 Ga0466717_113186 3300042604 Unclassified 3425
459 Ga0466716_058478 3300042605 Bacteria 30197
460 Ga0466716_100238 3300042605 Bacteria 2154
461 Ga0466716_194820 3300042605 Bacteria 32151
462 Ga0466721_183802 3300042608 Unclassified 1804
463 Ga0466698_207235 3300042610 Bacteria 4866
464 Ga0466697_131393 3300042611 Bacteria 1453
465 Ga0466705_126013 3300042612 Bacteria 17284
466 Ga0466733_122875 3300042659 Bacteria 7035
467 Ga0530661_000002 3300056564 Bacteria 530532
468 Ga0562377_0020 3300056842 Bacteria 1019711
469 Ga0562374_3375 3300057007 Bacteria 9200
470 Ga0466710_002340 3300042613 Bacteria 4033
471 Ga0466710_353826 3300042613 Bacteria 1279
472 Ga0466711_390809 3300042615 Bacteria 1267
473 Ga0466711_501759 3300042615 Bacteria 10416
474 Ga0466723_144613 3300042618 Bacteria 6447
475 Ga0466723_176554 3300042618 Unclassified 14677
476 Ga0466723_228319 3300042618 Bacteria 1951
477 Ga0466728_071660 3300042620 Bacteria 25955
478 Ga0466728_327386 3300042620 Unclassified 17345
479 Ga0466729_018894 3300042621 Bacteria 13874
480 Ga0160453_106543 3300012814 Bacteria 1706
481 Ga0160432_104961 3300012818 Unclassified 1364
482 Ga0160431_101531 3300012828 Bacteria 6495
483 Ga0160430_102216 3300012852 Bacteria 6318
484 Ga0160430_104608 3300012852 Unclassified 3372
485 Ga0160448_100538 3300012854 Unclassified 12901
486 Ga0160436_1000020 3300012861 Bacteria 107309
487 Ga0264413_148120 3300024493 Bacteria 4771
488 Ga0466690_241545 3300042590 Bacteria 13899
489 Ga0466690_410627 3300042590 Bacteria 3708
490 Ga0466691_055990 3300042593 Bacteria 16255
491 Ga0466694_127666 3300042594 Bacteria 12120
492 Ga0466696_064205 3300042596 Bacteria 16478
493 Ga0466696_111192 3300042596 Bacteria 22526
494 Ga0466696_395468 3300042596 Bacteria 1971
495 IMNBL1DRAFT_c0001850 3300000062 Bacteria 15404
496 AustNasuHG_c1031771 3300000089 Unclassified 1482
497 JGI24695J34938_10004207 3300002450 Bacteria 9572
498 JGI24702J35022_10025283 3300002462 Bacteria 3205
499 Ga0068305_10530792 3300005083 Bacteria 1664
500 Ga0072940_1080362 3300005200 Unclassified 2573
501 Ga0072941_1002776 3300005201 Bacteria 13429
502 Ga0072941_1025981 3300005201 Bacteria 15699
503 Ga0103261_1000935 3300007083 Unclassified 4527
504 Ga0103268_1000274 3300007192 Bacteria 18089
505 Ga0123357_10063960 3300009784 Unclassified 4919
506 Ga0123356_10251768 3300010049 Unclassified 1844
507 Ga0123353_10030362 3300010167 Bacteria 8351
508 Ga0123353_10287146 3300010167 Bacteria 2521
509 Ga0123353_10667088 3300010167 Bacteria 1468
510 Ga0123353_10836510 3300010167 Bacteria 1264
511 Ga0123354_10000316 3300010882 Bacteria 44271
512 Ga0123354_10008410 3300010882 Bacteria 15681
513 Ga0123354_10011874 3300010882 Bacteria 13485
514 Ga0123354_10121237 3300010882 Unclassified 3376
515 Ga0466735_205507 3300042624 Bacteria 1653
516 Ga0466703_249168 3300042636 Bacteria 12929
517 Ga0466704_122589 3300042643 Bacteria 11744
518 Ga0466724_25327 3300042649 Unclassified 1988
519 Ga0466706_212298 3300042599 Bacteria 2201
520 Ga0466700_411547 3300042600 Bacteria 3818
521 Ga0466713_017715 3300042602 Bacteria 2196
522 Ga0466716_217183 3300042605 Bacteria 1791
523 Ga0466719_016723 3300042606 Bacteria 32213
524 Ga0466697_027534 3300042611 Bacteria 2254

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 59 248 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.