Protein Family IF11217
Metagenome
Isolate
342
Members
296
Samples
100
Scaffolds
286.28
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2648501158|2648748924|
- Length
- 277 aa
- Sequence
- MDKTEYHPPKVWTWDAESGGEWAKINRPTAGARYESTLPTGQHALRLYSLATPNGQKVTIMLEELLELGIEAAEYDAYMIKIGDGEQFSSGFTELNPNSKIPALFDTKNNVRVFESGSILLYLAEQFGAFLPSDVAKRAETLNWLFWLQGSAPYLGGGFGHFYYYAPEKFQYPINRFTMEVKRQLDVLDKELGKNRYLGGDEYTIADIATWPWYGNLVRGLQYDAGEFLQVDQYKNVQRWADEISNRPAVQRGRRVNRNWGPEEEQLPERHSRADFD
Sample Types
Isolate
70.8%
Metagenome
29.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.0%
Coreidae
20.8%
Curculionidae
7.5%
Termitidae
5.7%
Muscidae
4.7%
Culicidae
4.3%
Drosophilidae
4.3%
Calliphoridae
2.9%
Anthocoridae
2.9%
Tenebrionidae
2.5%
Armadillidiidae
2.2%
Palinuridae
1.1%
Elmidae
1.1%
Talitridae
1.1%
Tephritidae
1.1%
Aphididae
0.7%
Sarcophagidae
0.7%
Majidae
0.7%
Formicidae
0.7%
Pentatomidae
0.7%
Plutellidae
0.7%
Cerambycidae
0.7%
Aphrophoridae
0.4%
Passalidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Artemiidae
0.4%
Largidae
0.4%
Ceratophyllidae
0.4%
Nephropidae
0.4%
Alydidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Carabidae
0.4%
Berytidae
0.4%
Crambidae
0.4%
Taxonomy
Archaea
0
Bacteria
319
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 3 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 4 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 5 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 6 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 7 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 8 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 9 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 10 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 11 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 12 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 13 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 16 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 17 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 22 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 26 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 27 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 28 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 29 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 30 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 31 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 32 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 33 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 34 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 35 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 36 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 37 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 38 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 39 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 40 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 41 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 42 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 43 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 44 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 45 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 46 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 47 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 48 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 49 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 50 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 56 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 57 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 58 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 59 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 60 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 61 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 62 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 63 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 64 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 65 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 66 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 67 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 68 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 69 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 70 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 71 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 72 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 73 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 74 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 75 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 76 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 77 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 78 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 79 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 80 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 81 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 82 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 83 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 84 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 85 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 86 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 87 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 88 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 89 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 90 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 91 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 92 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 93 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 94 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 95 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 96 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 97 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 98 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 99 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 100 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 101 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 102 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 103 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 104 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 105 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 106 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 107 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 108 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 109 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 110 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 111 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 112 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 113 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 114 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 115 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 116 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 117 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 118 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 119 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 120 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 121 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 122 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 123 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 124 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 125 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 126 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 127 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 128 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 129 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 130 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 131 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 132 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 133 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 134 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 135 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 136 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 137 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 138 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 139 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 140 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 141 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 142 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 143 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 144 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 145 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 146 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 147 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 148 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 149 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 150 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 151 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 152 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 153 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 154 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 155 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 156 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 157 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 158 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 159 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 160 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 161 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 162 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 163 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 164 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 165 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 166 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 167 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 168 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 169 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 170 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 171 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 172 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 173 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 174 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 175 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 176 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 177 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 178 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 179 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 180 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 181 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 182 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 183 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 184 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 185 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 186 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 187 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 188 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 189 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 190 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 191 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 192 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 193 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 194 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 195 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 196 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 197 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 198 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 199 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 200 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 201 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 202 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 203 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 204 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 205 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 206 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 207 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 208 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 209 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 210 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 211 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 212 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 213 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 214 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 215 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 216 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 217 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 218 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 219 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 220 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 221 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 222 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 223 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 224 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 225 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 226 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 227 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 228 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 229 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 230 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 231 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 232 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 233 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 234 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 235 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 236 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 237 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 238 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 239 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 240 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 241 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 242 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 243 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 244 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 245 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 246 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 247 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 248 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 249 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 250 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 251 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 252 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 253 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 254 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 255 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 256 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 257 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 258 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 259 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 260 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 261 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 262 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 263 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 264 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 265 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 266 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 267 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 268 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 269 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 270 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 271 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 272 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 273 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 274 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 275 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 276 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 277 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 278 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 279 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 280 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 281 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 282 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 283 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 284 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 285 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 286 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 287 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 288 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 289 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 290 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 291 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 292 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 293 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 294 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 295 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 296 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_022623 | 3300042625 | Unclassified | 4863 |
| 2 | Ga0466730_034854 | 3300042625 | Unclassified | 1331 |
| 3 | Ga0466724_36753 | 3300042649 | Bacteria | 164646 |
| 4 | Ga0160433_100035 | 3300012846 | Bacteria | 160128 |
| 5 | Ga0466694_094774 | 3300042594 | Bacteria | 12850 |
| 6 | Ga0104042_1033474 | 3300007130 | Unclassified | 7066 |
| 7 | Ga0466701_103278 | 3300042598 | Bacteria | 115318 |
| 8 | Ga0160440_100039 | 3300012815 | Bacteria | 192879 |
| 9 | Ga0160469_100171 | 3300012824 | Bacteria | 64125 |
| 10 | Ga0160444_102424 | 3300012841 | Bacteria | 2873 |
| 11 | Ga0160447_100782 | 3300012849 | Bacteria | 13731 |
| 12 | Ga0160447_108279 | 3300012849 | Bacteria | 2505 |
| 13 | Ga0160436_1002057 | 3300012861 | Bacteria | 5275 |
| 14 | Ga0415639_104518 | 3300038395 | Bacteria | 3206 |
| 15 | Ga0160465_100732 | 3300012803 | Bacteria | 12534 |
| 16 | Ga0160442_100068 | 3300012806 | Bacteria | 139461 |
| 17 | DPOL_contig12646 | 2035918003 | Bacteria | 137161 |
| 18 | FGTW_contig31929 | 2065487013 | Unclassified | 3102 |
| 19 | Ga0063521_1000066 | 3300003973 | Bacteria | 89303 |
| 20 | Ga0072941_1167907 | 3300005201 | Bacteria | 4447 |
| 21 | Ga0104019_1190478 | 3300007150 | Bacteria | 2362 |
| 22 | Ga0466713_155774 | 3300042602 | Bacteria | 154049 |
| 23 | Ga0466710_222272 | 3300042613 | Bacteria | 1111 |
| 24 | Ga0466724_37332 | 3300042649 | Bacteria | 112894 |
| 25 | Ga0160458_101877 | 3300012832 | Bacteria | 3163 |
| 26 | Ga0160446_100139 | 3300012835 | Bacteria | 60353 |
| 27 | Ga0160433_100720 | 3300012846 | Unclassified | 12496 |
| 28 | Ga0160435_1004586 | 3300012857 | Bacteria | 3197 |
| 29 | Ga0123356_10332632 | 3300010049 | Bacteria | 1636 |
| 30 | DPOL_contig10995 | 2035918003 | Unclassified | 13283 |
| 31 | CVPL010L_1000050 | 3300002932 | Unclassified | 39230 |
| 32 | Ga0063521_1000251 | 3300003973 | Unclassified | 35991 |
| 33 | Ga0466701_067097 | 3300042598 | Bacteria | 124546 |
| 34 | Ga0466731_198300 | 3300042622 | Bacteria | 2356 |
| 35 | Ga0466731_205885 | 3300042622 | Bacteria | 2053 |
| 36 | Ga0466730_009296 | 3300042625 | Bacteria | 1086 |
| 37 | Ga0466730_027383 | 3300042625 | Unclassified | 38162 |
| 38 | Ga0466730_082681 | 3300042625 | Bacteria | 25280 |
| 39 | Ga0160441_101016 | 3300012825 | Bacteria | 12099 |
| 40 | Ga0160467_103300 | 3300012829 | Unclassified | 2824 |
| 41 | Ga0265387_1000069 | 3300024582 | Bacteria | 32444 |
| 42 | Ga0466699_282758 | 3300042597 | Bacteria | 1862 |
| 43 | Ga0123356_10686487 | 3300010049 | Bacteria | 1192 |
| 44 | Ga0160442_101765 | 3300012806 | Unclassified | 2506 |
| 45 | FGTW_contig02702 | 2065487013 | Unclassified | 3104 |
| 46 | FGTW_contig12961 | 2065487013 | Unclassified | 3251 |
| 47 | Ga0104049_1131994 | 3300007103 | Bacteria | 1956 |
| 48 | Ga0104147_1013471 | 3300007224 | Bacteria | 22083 |
| 49 | Ga0105005_1007096 | 3300007505 | Bacteria | 1993 |
| 50 | Ga0466707_017806 | 3300042601 | Unclassified | 4863 |
| 51 | Ga0466724_20255 | 3300042649 | Bacteria | 63771 |
| 52 | Ga0466724_43776 | 3300042649 | Bacteria | 17666 |
| 53 | Ga0466724_67835 | 3300042649 | Bacteria | 278968 |
| 54 | Ga0466725_205280 | 3300042654 | Bacteria | 80780 |
| 55 | Ga0160472_100097 | 3300012839 | Bacteria | 140831 |
| 56 | Ga0123357_10207535 | 3300009784 | Bacteria | 2211 |
| 57 | SPBB_contig00035 | 2044078006 | Bacteria | 249649 |
| 58 | FGTW_contig22071 | 2065487013 | Bacteria | 27619 |
| 59 | Ga0063521_1000159 | 3300003973 | Bacteria | 50813 |
| 60 | Ga0466701_101989 | 3300042598 | Bacteria | 16101 |
| 61 | Ga0530661_000331 | 3300056564 | Bacteria | 36443 |
| 62 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 63 | Ga0466734_041766 | 3300042623 | Bacteria | 2245 |
| 64 | Ga0466730_030029 | 3300042625 | Bacteria | 423027 |
| 65 | Ga0160467_100628 | 3300012829 | Bacteria | 28463 |
| 66 | Ga0160455_100212 | 3300012837 | Bacteria | 49059 |
| 67 | Ga0160444_104089 | 3300012841 | Unclassified | 2018 |
| 68 | Ga0160460_100449 | 3300012845 | Unclassified | 25154 |
| 69 | Ga0160433_104517 | 3300012846 | Bacteria | 2232 |
| 70 | Ga0160435_1000891 | 3300012857 | Bacteria | 8153 |
| 71 | Ga0247289_0076 | 3300035363 | Unclassified | 28084 |
| 72 | Ga0247289_0317 | 3300035363 | Bacteria | 8350 |
| 73 | Ga0466657_177751 | 3300042582 | Bacteria | 1917 |
| 74 | Ga0123356_10013668 | 3300010049 | Unclassified | 7822 |
| 75 | Ga0123356_10099491 | 3300010049 | Bacteria | 2787 |
| 76 | Ga0123353_10461519 | 3300010167 | Bacteria | 1866 |
| 77 | FGTW_contig30676 | 2065487013 | Bacteria | 11675 |
| 78 | Ga0063521_1000205 | 3300003973 | Bacteria | 42394 |
| 79 | Ga0466697_005633 | 3300042611 | Bacteria | 3760 |
| 80 | Ga0466697_049466 | 3300042611 | Bacteria | 5114 |
| 81 | Ga0466730_072105 | 3300042625 | Bacteria | 12056 |
| 82 | Ga0160445_101118 | 3300012847 | Bacteria | 8481 |
| 83 | Ga0316159_10169 | 3300030930 | Bacteria | 11360 |
| 84 | Ga0247290_00463 | 3300035364 | Unclassified | 7675 |
| 85 | DPO_contig06940 | 2032320009 | Bacteria | 15795 |
| 86 | IMNBGM34_c000160 | 3300000036 | Bacteria | 19919 |
| 87 | Meta3P_1008565 | 3300002464 | Unclassified | 3408 |
| 88 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 89 | Ga0466730_002746 | 3300042625 | Bacteria | 26732 |
| 90 | Ga0466730_022391 | 3300042625 | Unclassified | 21449 |
| 91 | Ga0466724_07600 | 3300042649 | Bacteria | 52659 |
| 92 | Ga0466724_69636 | 3300042649 | Bacteria | 1310 |
| 93 | Ga0160440_100478 | 3300012815 | Bacteria | 12993 |
| 94 | Ga0160472_102733 | 3300012839 | Unclassified | 3826 |
| 95 | Ga0123355_10228927 | 3300009826 | Bacteria | 2658 |
| 96 | DPO_contig06387 | 2032320009 | Bacteria | 13061 |
| 97 | FGTW_contig00956 | 2065487013 | Bacteria | 1730 |
| 98 | CVPL010L_1000159 | 3300002932 | Bacteria | 34250 |
| 99 | Ga0466701_070824 | 3300042598 | Unclassified | 1035 |
| 100 | Ga0466713_065409 | 3300042602 | Bacteria | 88416 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00043 | GST_C | Glutathione S-transferase, C-terminal domain | 180 | 248 | 0.96 |
| PF13410 | GST_C_2 | Glutathione S-transferase, C-terminal domain | 174 | 242 | 0.85 |
| PF02798 | GST_N | Glutathione S-transferase, N-terminal domain | 45 | 125 | 0.84 |
| PF13409 | GST_N_2 | Glutathione S-transferase, N-terminal domain | 53 | 126 | 0.8 |
| PF14497 | GST_C_3 | Glutathione S-transferase, C-terminal domain | 176 | 251 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.