Protein Family IF10891
Metagenome
Isolate
910
Members
713
Samples
284
Scaffolds
296.91
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2529292851|2530233170|
- Length
- 350 aa
- Sequence
- MWFNGTKLHTGANQKSIRRKGPLMSWIEKILKKGNLTQSHKANIPEGVWTKCDSCGQVLYGAELERNLSVCPKCDHHMRIHARQRLETFLDENSTTELGSELEPKDILKFKDSKKYKDRISAAQKETGEKDAIIVMKGTLKSMPIVAASFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSSSGGARMQEALLSLMQMAKTSAALAKLQERGLPYISVLTDPTMGGVSASLAMLGDINVAEPKALIGFAGPRVIEQTVREKLPHGFQRSEFLLEKGAIDIIIRRPDMRNKLADILAMLMNKPSFNTAELASVDEDEEVTIDIIEDDVIIGSPEHEKDLAKHKKDNE
Sample Types
Isolate
68.8%
Metagenome
31.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
25.3%
Unclassified
19.8%
Coreidae
11.7%
Elmidae
3.4%
Formicidae
3.4%
Termitidae
3.2%
Anthocoridae
2.9%
Drosophilidae
2.6%
Curculionidae
2.5%
Culicidae
2.5%
Aphididae
2.2%
Muscidae
1.9%
Kalotermitidae
1.6%
Armadillidiidae
1.5%
Tenebrionidae
1.5%
Sarcophagidae
1.3%
Calliphoridae
1.3%
Ixodidae
0.9%
Cerambycidae
0.6%
Tephritidae
0.6%
Argasidae
0.6%
Talitridae
0.4%
Aleyrodidae
0.4%
Palinuridae
0.4%
Psyllidae
0.4%
Nephropidae
0.4%
Passalidae
0.4%
Rhinotermitidae
0.4%
Pteromalidae
0.4%
Termopsidae
0.4%
Pentatomidae
0.3%
Berytidae
0.3%
Majidae
0.3%
Largidae
0.3%
Crambidae
0.3%
Alydidae
0.3%
Reduviidae
0.1%
Penaeidae
0.1%
Glossinidae
0.1%
Carabidae
0.1%
Lysianassidae
0.1%
Aphalaridae
0.1%
Daphniidae
0.1%
Hodotermitidae
0.1%
Cixiidae
0.1%
Gryllidae
0.1%
Hippoboscidae
0.1%
Stratiomyidae
0.1%
Thripidae
0.1%
Anthomyiidae
0.1%
Artemiidae
0.1%
Cicadellidae
0.1%
Pseudococcidae
0.1%
Scarabaeidae
0.1%
Ceratophyllidae
0.1%
Trigoniulidae
0.1%
Siricidae
0.1%
Taxonomy
Archaea
0
Bacteria
871
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 2 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 3 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 4 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 5 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 6 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 7 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 8 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 9 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 10 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 11 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 12 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 13 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 14 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 15 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 16 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 17 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 18 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 19 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 20 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 21 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 22 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 23 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 24 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 25 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 26 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 27 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 28 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 29 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 30 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 31 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 32 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 33 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 34 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 35 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 36 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 37 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 38 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 39 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 40 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 41 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 42 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 43 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 44 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 45 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 46 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 47 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 48 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 49 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 50 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 51 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 52 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 53 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 54 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 55 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 56 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 57 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 58 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 59 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 60 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 61 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 62 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 63 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 64 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 65 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 66 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 67 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 68 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 69 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 70 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 71 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 72 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 73 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 74 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 75 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 76 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 77 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 78 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 79 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 80 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 81 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 82 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 83 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 84 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 85 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 86 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 87 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 88 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 89 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 92 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 93 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 94 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 95 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 96 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 97 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 98 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 99 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 100 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 101 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 102 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 103 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 104 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 105 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 106 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 107 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 108 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 109 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 110 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 111 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 112 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 113 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 114 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 115 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 116 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 117 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 118 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 119 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 120 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 121 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 122 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 123 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 124 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 125 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 126 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 127 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 128 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 129 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 130 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 131 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 132 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 133 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 134 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 135 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 136 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 137 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 138 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 139 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 140 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 141 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 142 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 143 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 144 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 145 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 146 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 147 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 148 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 149 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 150 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 151 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 152 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 153 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 154 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 155 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 156 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 157 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 158 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 159 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 160 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 161 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 162 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 163 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 164 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 165 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 166 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 167 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 168 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 169 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 170 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 171 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 172 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 173 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 174 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 175 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 176 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 177 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 178 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 179 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 180 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 181 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 182 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 183 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 184 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 185 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 186 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 187 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 188 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 189 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 190 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 191 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 192 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 193 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 194 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 195 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 196 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 197 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 198 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 199 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 200 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 201 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 202 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 203 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 204 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 205 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 206 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 207 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 208 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 209 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 210 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 211 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 212 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 213 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 214 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 215 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 216 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 217 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 218 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 219 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 220 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 221 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 222 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 223 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 224 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 225 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 226 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 227 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 228 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 229 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 230 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 231 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 232 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 233 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 234 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 235 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 236 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 237 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 238 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 239 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 240 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 241 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 242 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 243 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 244 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 245 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 246 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 247 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 248 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 249 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 250 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 251 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 252 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 253 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 254 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 255 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 256 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 257 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 258 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 259 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 260 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 261 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 262 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 263 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 264 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 265 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 266 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 267 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 268 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 269 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 270 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 271 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 272 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 273 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 274 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 275 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 276 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 277 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 278 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 279 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 280 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 281 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 282 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 283 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 284 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 285 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 286 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 287 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 288 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 289 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 290 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 291 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 292 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 293 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 294 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 295 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 296 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 297 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 298 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 299 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 300 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 301 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 302 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 303 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 304 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 305 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 306 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 307 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 308 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 309 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 310 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 311 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 312 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 313 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 314 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 315 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 316 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 317 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 318 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 319 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 320 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 321 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 322 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 323 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 324 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 325 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 326 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 327 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 328 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 329 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 330 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 331 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 332 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 333 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 334 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 335 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 336 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 337 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 338 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 339 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 340 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 341 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 342 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 343 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 344 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 345 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 346 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 347 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 348 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 349 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 350 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 351 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 352 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 353 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 354 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 355 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 356 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 357 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 358 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 359 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 360 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 361 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 362 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 363 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 364 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 365 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 366 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 367 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 368 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 369 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 370 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 371 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 372 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 373 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 374 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 375 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 376 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 377 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 378 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 379 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 380 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 381 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 382 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 383 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 384 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 385 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 386 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 387 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 388 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 389 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 390 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 391 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 392 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 393 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 394 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 395 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 396 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 397 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 398 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 399 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 400 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 401 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 402 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 403 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 404 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 405 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 406 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 407 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 408 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 409 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 410 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 411 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 412 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 413 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 414 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 415 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 416 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 417 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 418 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 419 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 420 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 421 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 422 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 423 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 424 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 425 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 426 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 427 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 428 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 429 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 430 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 431 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 432 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 433 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 434 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 435 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 436 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 437 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 438 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 439 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 440 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 441 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 442 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 443 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 444 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 445 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 446 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 447 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 448 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 449 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 450 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 451 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 452 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 453 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 454 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 455 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 456 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 457 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 458 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 459 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 460 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 461 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 462 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 463 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 464 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 465 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 466 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 467 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 468 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 469 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 470 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 471 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 472 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 473 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 474 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 475 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 476 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 477 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 478 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 479 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 480 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 481 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 482 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 483 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 484 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 485 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 486 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 487 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 488 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 489 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 490 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 491 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 492 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 493 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 494 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 495 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 496 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 497 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 498 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 499 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 500 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 501 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 502 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 503 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 504 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 505 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 506 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 507 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 508 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 509 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 510 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 511 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 512 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 513 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 514 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 515 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 516 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 517 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 518 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 519 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 520 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 521 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 522 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 523 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 524 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 525 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 526 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 527 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 528 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 529 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 530 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 531 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 532 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 533 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 534 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 535 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 536 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 537 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 538 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 539 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 540 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 541 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 542 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 543 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 544 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 545 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 546 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 547 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 548 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 549 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 550 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 551 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 552 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 553 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 554 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 555 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 556 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 557 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 558 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 559 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 560 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 561 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 562 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 563 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 564 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 565 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 566 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 567 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 568 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 569 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 570 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 571 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 572 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 573 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 574 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 575 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 576 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 577 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 578 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 579 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 580 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 581 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 582 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 583 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 584 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 585 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 586 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 587 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 588 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 589 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 590 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 591 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 592 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 593 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 594 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 595 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 596 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 597 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 598 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 599 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 600 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 601 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 602 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 603 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 604 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 605 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 606 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 607 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 608 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 609 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 610 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 611 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 612 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 613 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 614 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 615 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 616 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 617 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 618 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 619 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 620 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 621 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 622 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 623 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 624 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 625 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 626 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 627 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 628 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 629 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 630 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 631 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 632 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 633 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 634 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 635 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 636 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 637 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 638 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 639 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 640 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 641 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 642 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 643 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 644 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 645 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 646 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 647 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 648 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 649 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 650 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 651 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 652 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 653 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 654 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 655 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 656 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 657 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 658 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 659 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 660 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 661 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 662 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 663 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 664 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 665 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 666 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 667 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 668 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 669 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 670 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 671 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 672 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 673 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 674 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 675 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 676 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 677 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 678 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 679 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 680 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 681 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 682 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 683 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 684 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 685 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 686 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 687 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 688 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 689 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 690 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 691 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 692 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 693 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 694 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 695 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 696 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 697 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 698 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 699 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 700 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 701 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 702 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 703 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 704 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 705 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 706 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 707 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 708 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 709 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 710 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 711 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 712 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 713 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_214888 | 3300042612 | Bacteria | 1300 |
| 2 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 3 | Ga0466734_023558 | 3300042623 | Bacteria | 3986 |
| 4 | Ga0466734_136305 | 3300042623 | Bacteria | 2738 |
| 5 | Ga0466730_030188 | 3300042625 | Bacteria | 32749 |
| 6 | Ga0466730_035913 | 3300042625 | Bacteria | 2936 |
| 7 | Ga0466725_152994 | 3300042654 | Bacteria | 69484 |
| 8 | Ga0160470_103797 | 3300012813 | Bacteria | 2316 |
| 9 | Ga0160441_102486 | 3300012825 | Unclassified | 3709 |
| 10 | Ga0160446_100107 | 3300012835 | Bacteria | 76250 |
| 11 | Ga0160444_100279 | 3300012841 | Bacteria | 38044 |
| 12 | Ga0160445_100021 | 3300012847 | Bacteria | 204981 |
| 13 | Ga0160447_106537 | 3300012849 | Bacteria | 3063 |
| 14 | Ga0316159_11144 | 3300030930 | Bacteria | 3491 |
| 15 | Ga0466657_047577 | 3300042582 | Bacteria | 20534 |
| 16 | Ga0466694_004253 | 3300042594 | Bacteria | 3457 |
| 17 | Ga0466695_204136 | 3300042595 | Bacteria | 6226 |
| 18 | Ga0466701_002451 | 3300042598 | Bacteria | 107637 |
| 19 | Ga0466710_009675 | 3300042613 | Bacteria | 2785 |
| 20 | Ga0466710_021228 | 3300042613 | Bacteria | 41506 |
| 21 | Ga0466715_109569 | 3300042616 | Bacteria | 40670 |
| 22 | Ga0466723_252477 | 3300042618 | Bacteria | 5277 |
| 23 | Ga0466728_423964 | 3300042620 | Bacteria | 8746 |
| 24 | Ga0123356_10361804 | 3300010049 | Bacteria | 1578 |
| 25 | Ga0136159_1000020 | 3300010217 | Bacteria | 104555 |
| 26 | Ga0466701_019302 | 3300042598 | Bacteria | 5731 |
| 27 | Ga0466701_044390 | 3300042598 | Bacteria | 12742 |
| 28 | Ga0466701_092887 | 3300042598 | Bacteria | 1197 |
| 29 | Ga0466707_408960 | 3300042601 | Bacteria | 6891 |
| 30 | Ga0466717_091907 | 3300042604 | Bacteria | 4200 |
| 31 | 2227080778 | 2225789004 | Bacteria | 173705 |
| 32 | IMNBGM34_c000109 | 3300000036 | Bacteria | 23365 |
| 33 | HBC_ctgsDRAFT_1001964 | 3300000333 | Bacteria | 4590 |
| 34 | SCG598J21_12829 | 3300000475 | Bacteria | 52532 |
| 35 | CVPL010W_10002887 | 3300002931 | Bacteria | 29318 |
| 36 | CVPL005W_1001293 | 3300002934 | Bacteria | 6901 |
| 37 | Ga0074278_121704 | 3300005721 | Unclassified | 3147 |
| 38 | Ga0103263_101453 | 3300007042 | Unclassified | 3067 |
| 39 | Ga0102736_1000051 | 3300007052 | Bacteria | 111370 |
| 40 | Ga0103261_1002565 | 3300007083 | Bacteria | 4656 |
| 41 | Ga0102734_1003589 | 3300007129 | Bacteria | 3825 |
| 42 | Ga0102734_1003674 | 3300007129 | Bacteria | 3471 |
| 43 | Ga0102734_1012163 | 3300007129 | Bacteria | 2837 |
| 44 | Ga0103260_1000583 | 3300007139 | Bacteria | 6955 |
| 45 | Ga0466733_042826 | 3300042659 | Bacteria | 2063 |
| 46 | Ga0466734_028212 | 3300042623 | Bacteria | 8400 |
| 47 | Ga0466734_167251 | 3300042623 | Bacteria | 1856 |
| 48 | Ga0466725_007421 | 3300042654 | Bacteria | 9147 |
| 49 | Ga0466725_038809 | 3300042654 | Bacteria | 70980 |
| 50 | Ga0160468_101113 | 3300012819 | Unclassified | 7580 |
| 51 | Ga0160441_100053 | 3300012825 | Unclassified | 154313 |
| 52 | Ga0160446_105142 | 3300012835 | Unclassified | 1891 |
| 53 | Ga0160444_100169 | 3300012841 | Bacteria | 63082 |
| 54 | Ga0160447_100812 | 3300012849 | Bacteria | 13449 |
| 55 | Ga0466657_190021 | 3300042582 | Bacteria | 1290 |
| 56 | Ga0466691_212791 | 3300042593 | Bacteria | 15373 |
| 57 | Ga0466699_032868 | 3300042597 | Bacteria | 2278 |
| 58 | Ga0466701_001205 | 3300042598 | Bacteria | 13085 |
| 59 | Ga0466710_127478 | 3300042613 | Bacteria | 8977 |
| 60 | Ga0466718_170410 | 3300042617 | Bacteria | 4044 |
| 61 | Ga0466723_063649 | 3300042618 | Bacteria | 21326 |
| 62 | Ga0123354_10000618 | 3300010882 | Bacteria | 37182 |
| 63 | Ga0123354_10072547 | 3300010882 | Bacteria | 4955 |
| 64 | Ga0123354_10367397 | 3300010882 | Bacteria | 1260 |
| 65 | Ga0466706_135847 | 3300042599 | Bacteria | 5128 |
| 66 | Ga0466706_289648 | 3300042599 | Bacteria | 2540 |
| 67 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 68 | Ga0466717_009074 | 3300042604 | Bacteria | 10608 |
| 69 | Ga0466717_048255 | 3300042604 | Bacteria | 11616 |
| 70 | DPOL_contig20116 | 2035918003 | Bacteria | 22145 |
| 71 | HBC_ctgsDRAFT_1002547 | 3300000333 | Unclassified | 4146 |
| 72 | CVPL010W_10000552 | 3300002931 | Bacteria | 40634 |
| 73 | Ga0068302_10102607 | 3300005071 | Bacteria | 6024 |
| 74 | Ga0103261_1000024 | 3300007083 | Bacteria | 66582 |
| 75 | Ga0102739_1002751 | 3300007095 | Bacteria | 2654 |
| 76 | Ga0102734_1034911 | 3300007129 | Bacteria | 2134 |
| 77 | Ga0102740_1000751 | 3300007140 | Bacteria | 11526 |
| 78 | Ga0102737_1000080 | 3300007142 | Bacteria | 44203 |
| 79 | Ga0102737_1000283 | 3300007142 | Bacteria | 17179 |
| 80 | Ga0102737_1000992 | 3300007142 | Bacteria | 10266 |
| 81 | Ga0103264_1000090 | 3300007188 | Bacteria | 60653 |
| 82 | Ga0127656_100968 | 3300009453 | Bacteria | 23282 |
| 83 | Ga0466697_065029 | 3300042611 | Unclassified | 1318 |
| 84 | Ga0466697_267004 | 3300042611 | Bacteria | 4155 |
| 85 | Ga0466705_327301 | 3300042612 | Bacteria | 101504 |
| 86 | Ga0466733_096607 | 3300042659 | Bacteria | 89302 |
| 87 | Ga0562379_0520 | 3300056790 | Bacteria | 76275 |
| 88 | Ga0466730_101923 | 3300042625 | Unclassified | 2949 |
| 89 | Ga0466724_50202 | 3300042649 | Bacteria | 22667 |
| 90 | Ga0466708_096807 | 3300042652 | Bacteria | 14346 |
| 91 | Ga0466708_357211 | 3300042652 | Bacteria | 12180 |
| 92 | Ga0466725_004926 | 3300042654 | Bacteria | 9383 |
| 93 | Ga0160467_101360 | 3300012829 | Bacteria | 10074 |
| 94 | Ga0160455_100002 | 3300012837 | Bacteria | 1193112 |
| 95 | Ga0160460_101164 | 3300012845 | Bacteria | 10068 |
| 96 | Ga0160436_1001300 | 3300012861 | Unclassified | 7013 |
| 97 | Ga0466657_115842 | 3300042582 | Bacteria | 1646 |
| 98 | Ga0466657_184390 | 3300042582 | Bacteria | 1379 |
| 99 | Ga0466715_316385 | 3300042616 | Bacteria | 19410 |
| 100 | Ga0466715_487864 | 3300042616 | Bacteria | 8065 |
| 101 | Ga0466726_216753 | 3300042619 | Unclassified | 1793 |
| 102 | Ga0123356_10050451 | 3300010049 | Bacteria | 3872 |
| 103 | Ga0123354_10000381 | 3300010882 | Bacteria | 42382 |
| 104 | Ga0160454_100223 | 3300012798 | Unclassified | 57400 |
| 105 | Ga0160465_100448 | 3300012803 | Bacteria | 20976 |
| 106 | Ga0160471_101814 | 3300012812 | Unclassified | 3893 |
| 107 | Ga0466706_042019 | 3300042599 | Bacteria | 5136 |
| 108 | Ga0466707_066024 | 3300042601 | Bacteria | 4986 |
| 109 | Ga0466714_075489 | 3300042603 | Bacteria | 1524 |
| 110 | DPOL_contig07789 | 2035918003 | Bacteria | 4323 |
| 111 | SWWA_contig02621__length_6605___numreads_117 | 2100351016 | Bacteria | 6605 |
| 112 | 2218139220 | 2209111014 | Bacteria | 955 |
| 113 | HBC_ctgsDRAFT_1000009 | 3300000333 | Bacteria | 57482 |
| 114 | HBC_ctgsDRAFT_1000658 | 3300000333 | Bacteria | 7678 |
| 115 | JGI24705J35276_12231993 | 3300002504 | Bacteria | 4140 |
| 116 | WW0001_100248 | 3300002732 | Bacteria | 167261 |
| 117 | CVPL010W_10002936 | 3300002931 | Bacteria | 19809 |
| 118 | CVPL010L_1000111 | 3300002932 | Bacteria | 91591 |
| 119 | Ga0063521_1000204 | 3300003973 | Bacteria | 42441 |
| 120 | Ga0103266_1000059 | 3300007067 | Unclassified | 46305 |
| 121 | Ga0102740_1001265 | 3300007140 | Bacteria | 6547 |
| 122 | Ga0103264_1000001 | 3300007188 | Bacteria | 204769 |
| 123 | Ga0103264_1001003 | 3300007188 | Bacteria | 12661 |
| 124 | Ga0103268_1000010 | 3300007192 | Bacteria | 89501 |
| 125 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 126 | Ga0466724_31779 | 3300042649 | Bacteria | 22407 |
| 127 | Ga0160456_100927 | 3300012820 | Unclassified | 7802 |
| 128 | Ga0160469_100002 | 3300012824 | Bacteria | 1020748 |
| 129 | Ga0160472_100507 | 3300012839 | Bacteria | 25850 |
| 130 | Ga0160472_104814 | 3300012839 | Bacteria | 2290 |
| 131 | Ga0160430_100141 | 3300012852 | Bacteria | 55429 |
| 132 | Ga0466657_298956 | 3300042582 | Bacteria | 10575 |
| 133 | Ga0466657_301284 | 3300042582 | Bacteria | 63202 |
| 134 | Ga0466690_292632 | 3300042590 | Bacteria | 16499 |
| 135 | Ga0466710_381390 | 3300042613 | Bacteria | 32855 |
| 136 | Ga0466715_110147 | 3300042616 | Bacteria | 16968 |
| 137 | Ga0160454_100009 | 3300012798 | Bacteria | 406749 |
| 138 | Ga0466701_068827 | 3300042598 | Bacteria | 109676 |
| 139 | Ga0466719_127554 | 3300042606 | Bacteria | 16081 |
| 140 | SWWA_contig11852__length_1526___numreads_28 | 2100351016 | Bacteria | 1526 |
| 141 | gam1t_NODE_493132_length=3137_GC=34_9_Contigs=2 | 2189573031 | Unclassified | 3147 |
| 142 | JGI24702J35022_10000310 | 3300002462 | Bacteria | 28806 |
| 143 | CVPL010W_10027441 | 3300002931 | Bacteria | 2797 |
| 144 | Ga0063521_1000229 | 3300003973 | Bacteria | 38732 |
| 145 | Ga0074278_105479 | 3300005721 | Bacteria | 10588 |
| 146 | Ga0103266_1000207 | 3300007067 | Bacteria | 16473 |
| 147 | Ga0102734_1010331 | 3300007129 | Bacteria | 2166 |
| 148 | Ga0102740_1004345 | 3300007140 | Bacteria | 2829 |
| 149 | Ga0102737_1001056 | 3300007142 | Unclassified | 8069 |
| 150 | Ga0103267_1000799 | 3300007190 | Bacteria | 19916 |
| 151 | Ga0103268_1002833 | 3300007192 | Unclassified | 3755 |
| 152 | Ga0105008_1102060 | 3300007507 | Unclassified | 3783 |
| 153 | Ga0127645_101857 | 3300009461 | Bacteria | 11206 |
| 154 | Ga0123357_10000285 | 3300009784 | Bacteria | 48399 |
| 155 | Ga0530661_000160 | 3300056564 | Unclassified | 59803 |
| 156 | Ga0466734_168748 | 3300042623 | Bacteria | 14491 |
| 157 | Ga0466730_068667 | 3300042625 | Unclassified | 3004 |
| 158 | Ga0466709_040584 | 3300042648 | Bacteria | 8454 |
| 159 | Ga0466724_08038 | 3300042649 | Bacteria | 50733 |
| 160 | Ga0466724_43013 | 3300042649 | Bacteria | 36848 |
| 161 | Ga0466708_355353 | 3300042652 | Bacteria | 40735 |
| 162 | Ga0466725_082831 | 3300042654 | Bacteria | 99829 |
| 163 | Ga0466725_422509 | 3300042654 | Bacteria | 1778 |
| 164 | Ga0160470_101658 | 3300012813 | Bacteria | 5088 |
| 165 | Ga0160440_100002 | 3300012815 | Bacteria | 1234951 |
| 166 | Ga0160459_100012 | 3300012831 | Bacteria | 435648 |
| 167 | Ga0160452_100549 | 3300012834 | Bacteria | 22255 |
| 168 | Ga0160472_100992 | 3300012839 | Unclassified | 10340 |
| 169 | Ga0160443_100318 | 3300012848 | Bacteria | 45289 |
| 170 | Ga0160448_103824 | 3300012854 | Unclassified | 4318 |
| 171 | Ga0160436_1000560 | 3300012861 | Bacteria | 13532 |
| 172 | Ga0466657_114824 | 3300042582 | Bacteria | 3827 |
| 173 | Ga0466657_390823 | 3300042582 | Bacteria | 58911 |
| 174 | Ga0466690_186749 | 3300042590 | Bacteria | 19530 |
| 175 | Ga0466715_515755 | 3300042616 | Bacteria | 2450 |
| 176 | Ga0123357_10056108 | 3300009784 | Bacteria | 5300 |
| 177 | Ga0123357_10339608 | 3300009784 | Bacteria | 1454 |
| 178 | Ga0123356_10022425 | 3300010049 | Bacteria | 5963 |
| 179 | Ga0123353_10339007 | 3300010167 | Bacteria | 2271 |
| 180 | Ga0123354_10010775 | 3300010882 | Bacteria | 14105 |
| 181 | Ga0466701_019515 | 3300042598 | Bacteria | 190398 |
| 182 | Ga0466701_095197 | 3300042598 | Bacteria | 28237 |
| 183 | Ga0466701_096949 | 3300042598 | Bacteria | 149718 |
| 184 | Ga0466706_165204 | 3300042599 | Bacteria | 2680 |
| 185 | DPOL_contig03825 | 2035918003 | Unclassified | 13630 |
| 186 | SPBB_contig11544 | 2044078006 | Bacteria | 50017 |
| 187 | gam1t_NODE_504253_length=35188_GC=34_5_Contigs=4 | 2189573031 | Unclassified | 35218 |
| 188 | IMNBL1DRAFT_c0008992 | 3300000062 | Bacteria | 5014 |
| 189 | Meta3P_1000398 | 3300002464 | Bacteria | 24268 |
| 190 | CVPL010W_10000959 | 3300002931 | Bacteria | 60398 |
| 191 | CVPL010W_10002380 | 3300002931 | Bacteria | 22060 |
| 192 | Ga0063521_1032378 | 3300003973 | Unclassified | 1213 |
| 193 | Ga0103263_100266 | 3300007042 | Bacteria | 8755 |
| 194 | Ga0102735_1000102 | 3300007080 | Bacteria | 51875 |
| 195 | Ga0102740_1000016 | 3300007140 | Bacteria | 44745 |
| 196 | Ga0103264_1000247 | 3300007188 | Bacteria | 42675 |
| 197 | Ga0103268_1000089 | 3300007192 | Unclassified | 28602 |
| 198 | Ga0127657_102487 | 3300009457 | Bacteria | 5120 |
| 199 | Ga0466704_258426 | 3300042643 | Bacteria | 95131 |
| 200 | Ga0466724_19878 | 3300042649 | Unclassified | 14818 |
| 201 | Ga0466724_21305 | 3300042649 | Bacteria | 11335 |
| 202 | Ga0466725_222144 | 3300042654 | Bacteria | 4744 |
| 203 | Ga0466725_319241 | 3300042654 | Bacteria | 2602 |
| 204 | Ga0160431_102964 | 3300012828 | Unclassified | 3708 |
| 205 | Ga0160433_100236 | 3300012846 | Bacteria | 40426 |
| 206 | Ga0160445_101152 | 3300012847 | Unclassified | 8237 |
| 207 | Ga0160435_1000430 | 3300012857 | Unclassified | 14575 |
| 208 | Ga0466657_229971 | 3300042582 | Bacteria | 1074 |
| 209 | Ga0466657_397350 | 3300042582 | Bacteria | 14367 |
| 210 | Ga0466692_040365 | 3300042591 | Bacteria | 62446 |
| 211 | Ga0466692_061546 | 3300042591 | Bacteria | 13118 |
| 212 | Ga0466710_147154 | 3300042613 | Bacteria | 1445 |
| 213 | Ga0466718_138922 | 3300042617 | Bacteria | 3723 |
| 214 | Ga0466729_033765 | 3300042621 | Bacteria | 7329 |
| 215 | Ga0160465_106683 | 3300012803 | Bacteria | 1276 |
| 216 | Ga0466707_100099 | 3300042601 | Bacteria | 8192 |
| 217 | Ga0466717_045026 | 3300042604 | Bacteria | 5666 |
| 218 | SPBB_contig09082 | 2044078006 | Bacteria | 25723 |
| 219 | SCG598L16_135915 | 3300000490 | Unclassified | 59345 |
| 220 | Meta3P_1000074 | 3300002464 | Bacteria | 143082 |
| 221 | CVPL010W_10000642 | 3300002931 | Bacteria | 63793 |
| 222 | CVPL005L_10000471 | 3300002938 | Bacteria | 73084 |
| 223 | Ga0074188_1000313 | 3300005318 | Bacteria | 52641 |
| 224 | Ga0102736_1001042 | 3300007052 | Bacteria | 7630 |
| 225 | Ga0102735_1000028 | 3300007080 | Bacteria | 57043 |
| 226 | Ga0102735_1001501 | 3300007080 | Bacteria | 3934 |
| 227 | Ga0103260_1000037 | 3300007139 | Unclassified | 44687 |
| 228 | Ga0102738_1000280 | 3300007141 | Bacteria | 9780 |
| 229 | Ga0103264_1000066 | 3300007188 | Bacteria | 73748 |
| 230 | Ga0103264_1000251 | 3300007188 | Bacteria | 30261 |
| 231 | Ga0103264_1000332 | 3300007188 | Bacteria | 25568 |
| 232 | Ga0466705_087780 | 3300042612 | Bacteria | 84355 |
| 233 | Ga0562374_0373 | 3300057007 | Bacteria | 82846 |
| 234 | Ga0466734_053344 | 3300042623 | Bacteria | 92534 |
| 235 | Ga0466730_002014 | 3300042625 | Bacteria | 1632 |
| 236 | Ga0466730_022639 | 3300042625 | Bacteria | 1393 |
| 237 | Ga0466702_174582 | 3300042635 | Bacteria | 2329 |
| 238 | Ga0466725_432355 | 3300042654 | Bacteria | 1887 |
| 239 | Ga0160432_101146 | 3300012818 | Unclassified | 9792 |
| 240 | Ga0160472_100289 | 3300012839 | Bacteria | 53316 |
| 241 | Ga0160435_1001847 | 3300012857 | Bacteria | 5226 |
| 242 | Ga0466657_269597 | 3300042582 | Bacteria | 13405 |
| 243 | Ga0466711_296130 | 3300042615 | Bacteria | 15232 |
| 244 | Ga0466711_297774 | 3300042615 | Bacteria | 3536 |
| 245 | Ga0123356_10013613 | 3300010049 | Bacteria | 7841 |
| 246 | Ga0123356_10023966 | 3300010049 | Bacteria | 5742 |
| 247 | Ga0466719_418506 | 3300042606 | Bacteria | 16122 |
| 248 | Ga0466719_513396 | 3300042606 | Bacteria | 4112 |
| 249 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 250 | Ga0103263_100826 | 3300007042 | Bacteria | 4134 |
| 251 | Ga0102739_1005008 | 3300007095 | Bacteria | 1838 |
| 252 | Ga0102739_1006538 | 3300007095 | Unclassified | 1563 |
| 253 | Ga0102737_1007161 | 3300007142 | Unclassified | 2056 |
| 254 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 255 | Ga0103264_1000193 | 3300007188 | Bacteria | 58174 |
| 256 | Ga0103264_1008796 | 3300007188 | Bacteria | 7814 |
| 257 | Ga0103267_1000010 | 3300007190 | Bacteria | 73384 |
| 258 | Ga0127657_100965 | 3300009457 | Bacteria | 23708 |
| 259 | Ga0466705_218871 | 3300042612 | Bacteria | 32705 |
| 260 | Ga0466709_062553 | 3300042648 | Bacteria | 13335 |
| 261 | Ga0466708_058088 | 3300042652 | Bacteria | 17528 |
| 262 | Ga0466725_383524 | 3300042654 | Bacteria | 30057 |
| 263 | Ga0466727_203749 | 3300042655 | Bacteria | 45935 |
| 264 | Ga0160470_100305 | 3300012813 | Bacteria | 28741 |
| 265 | Ga0160469_100081 | 3300012824 | Bacteria | 154657 |
| 266 | Ga0160447_102082 | 3300012849 | Unclassified | 7282 |
| 267 | Ga0160434_100002 | 3300012850 | Bacteria | 549793 |
| 268 | Ga0466657_173800 | 3300042582 | Bacteria | 1619 |
| 269 | Ga0466691_027163 | 3300042593 | Bacteria | 18973 |
| 270 | Ga0466691_040559 | 3300042593 | Bacteria | 11718 |
| 271 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 272 | Ga0466726_305508 | 3300042619 | Bacteria | 4451 |
| 273 | Ga0123357_10005581 | 3300009784 | Bacteria | 15113 |
| 274 | Ga0466713_025108 | 3300042602 | Bacteria | 5118 |
| 275 | Ga0466697_013440 | 3300042611 | Bacteria | 1145 |
| 276 | FGTW_contig16506 | 2065487013 | Bacteria | 5054 |
| 277 | SWWA_contig30463__length_6466___numreads_342 | 2100351016 | Unclassified | 6466 |
| 278 | JGI24705J35276_12235467 | 3300002504 | Unclassified | 6562 |
| 279 | Ga0103266_1000608 | 3300007067 | Bacteria | 7501 |
| 280 | Ga0103265_1002949 | 3300007068 | Bacteria | 4536 |
| 281 | Ga0103261_1003512 | 3300007083 | Bacteria | 2425 |
| 282 | Ga0103268_1000243 | 3300007192 | Bacteria | 17933 |
| 283 | Ga0103268_1002261 | 3300007192 | Bacteria | 4344 |
| 284 | Ga0123357_10000031 | 3300009784 | Bacteria | 116101 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.