Protein Family IF09569
Metagenome
Isolate
274
Members
213
Samples
132
Scaffolds
276.37
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_047354|Ga0466709_047354_106_1104
- Length
- 332 aa
- Sequence
- MLWWCEAKRSNAREMGVGGLCPPLSDHLKRKMLCWFPWKSVQGHKICSCIPHEGGFAMAMKRKDILDKFRKEAAGGRILVGVGAGTGITAKSSEAGGADMLIIYNSGRYRMAGRGSLAGLLSYGDANQIVVDMGAEVLPVVKHTPVLAGVCGTDPFRLMNVFLKQLKEMGFAGVQNFPTVGLIDGVFRQNLEETDMGYGLEVEMIRKAHELDLLTTPYVFDTDQAKAMAKAGADILVAHMGLTTKGSIGAKTALTLDDCVTRVQAIADAGHETNPDIMVICHGGPIAEPEDARYVIEHTKGVDGFFGASSIERFAAEVGIKKQTEAFKKITK
Sample Types
Isolate
51.5%
Metagenome
48.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
27.3%
Drosophilidae
10.2%
Formicidae
9.3%
Anthocoridae
9.3%
Termitidae
9.3%
Unclassified
9.3%
Kalotermitidae
6.3%
Culicidae
2.9%
Tenebrionidae
2.9%
Blattidae
2.0%
Pteromalidae
1.5%
Scarabaeidae
1.5%
Rhinotermitidae
1.0%
Aphididae
1.0%
Passalidae
1.0%
Calliphoridae
1.0%
Curculionidae
1.0%
Gomphidae
0.5%
Stratiomyidae
0.5%
Plutellidae
0.5%
Cerambycidae
0.5%
Armadillidiidae
0.5%
Hodotermitidae
0.5%
Termopsidae
0.5%
Taxonomy
Archaea
1
Bacteria
257
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 2 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 3 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 4 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 5 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 6 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 7 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 8 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 9 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 17 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 18 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 19 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 22 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 23 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 24 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 25 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 26 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 27 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 28 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 29 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 30 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 31 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 32 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 33 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 34 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 39 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 40 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 41 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 42 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 43 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 44 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 45 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 46 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 47 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 48 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 49 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 50 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 51 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 52 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 53 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 54 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 55 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 56 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 57 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 58 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 59 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 60 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 61 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 62 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 63 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 64 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 65 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 66 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 67 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 68 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 69 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 70 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 71 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 73 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 74 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 75 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 76 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 77 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 78 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 79 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 80 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 81 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 82 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 83 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 84 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 85 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 86 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 87 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 88 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 89 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 90 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 91 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 92 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 93 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 94 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 95 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 96 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 97 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 98 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 99 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 100 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 101 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 102 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 103 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 104 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 105 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 106 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 107 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 108 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 109 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 110 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 111 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 112 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 113 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 114 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 115 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 116 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 117 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 118 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 119 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 120 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 121 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 122 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 123 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 124 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 125 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 126 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 127 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 128 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 129 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 130 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 131 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 132 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 133 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 134 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 135 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 136 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 137 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 138 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 139 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 140 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 141 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 142 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 143 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 144 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 145 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 146 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 147 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 148 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 149 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 150 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 151 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 152 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 153 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 154 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 155 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 156 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 157 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 158 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 159 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 160 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 161 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 162 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 163 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 164 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 165 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 166 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 167 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 168 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 169 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 170 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 171 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 172 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 173 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 174 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 175 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 176 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 177 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 178 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 179 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 180 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 181 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 182 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 183 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 184 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 185 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 186 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 187 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 188 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 189 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 190 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 191 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 192 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 193 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 194 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 195 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 196 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 197 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 198 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 199 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 200 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 201 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 202 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 203 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 204 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 205 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 206 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 207 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 208 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 209 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 210 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 211 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 212 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 213 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562374_1736 | 3300057007 | Bacteria | 23868 |
| 2 | Ga0160470_102905 | 3300012813 | Unclassified | 2988 |
| 3 | Ga0160441_103135 | 3300012825 | Unclassified | 2950 |
| 4 | Ga0466657_040236 | 3300042582 | Bacteria | 4282 |
| 5 | Ga0466691_123433 | 3300042593 | Bacteria | 3989 |
| 6 | Ga0466691_211893 | 3300042593 | Bacteria | 2175 |
| 7 | Ga0123355_10051070 | 3300009826 | Bacteria | 6713 |
| 8 | IMNBL1DRAFT_c0004338 | 3300000062 | Bacteria | 8570 |
| 9 | CVPL010W_10022656 | 3300002931 | Bacteria | 3320 |
| 10 | Ga0074278_133645 | 3300005721 | Unclassified | 1917 |
| 11 | Ga0466701_017731 | 3300042598 | Bacteria | 5930 |
| 12 | Ga0466714_049715 | 3300042603 | Bacteria | 54062 |
| 13 | Ga0466716_064456 | 3300042605 | Bacteria | 2515 |
| 14 | Ga0466719_153209 | 3300042606 | Bacteria | 4744 |
| 15 | Ga0466722_224034 | 3300042609 | Unclassified | 2342 |
| 16 | Ga0466703_226660 | 3300042636 | Unclassified | 4238 |
| 17 | Ga0466709_369188 | 3300042648 | Unclassified | 3012 |
| 18 | Ga0466708_242655 | 3300042652 | Bacteria | 1572 |
| 19 | Ga0466727_277455 | 3300042655 | Bacteria | 5579 |
| 20 | Ga0562378_0495 | 3300056814 | Bacteria | 64587 |
| 21 | Ga0562377_0055 | 3300056842 | Bacteria | 513141 |
| 22 | Ga0562376_0475 | 3300056857 | Bacteria | 73577 |
| 23 | Ga0160434_111752 | 3300012850 | Unclassified | 1413 |
| 24 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 25 | Ga0466691_030051 | 3300042593 | Bacteria | 1904 |
| 26 | Ga0123355_10542674 | 3300009826 | Bacteria | 1410 |
| 27 | Ga0123356_10609185 | 3300010049 | Bacteria | 1257 |
| 28 | Ga0123353_10106989 | 3300010167 | Bacteria | 4506 |
| 29 | Ga0102734_1000313 | 3300007129 | Bacteria | 18145 |
| 30 | Ga0103268_1001778 | 3300007192 | Bacteria | 5100 |
| 31 | Ga0466704_439670 | 3300042643 | Bacteria | 1682 |
| 32 | Ga0466708_052570 | 3300042652 | Unclassified | 4931 |
| 33 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 34 | Ga0562376_0365 | 3300056857 | Bacteria | 86307 |
| 35 | Ga0466715_002787 | 3300042616 | Bacteria | 5220 |
| 36 | Ga0160459_100029 | 3300012831 | Bacteria | 309183 |
| 37 | Ga0160435_1003590 | 3300012857 | Bacteria | 3651 |
| 38 | Ga0415639_164522 | 3300038395 | Bacteria | 2451 |
| 39 | Ga0123357_10027332 | 3300009784 | Unclassified | 7710 |
| 40 | Ga0123355_10135714 | 3300009826 | Bacteria | 3779 |
| 41 | Ga0123354_10265575 | 3300010882 | Bacteria | 1702 |
| 42 | gam1t_NODE_552852_length=1917_GC=34_7_Contigs=1 | 2189573031 | Bacteria | 1917 |
| 43 | HBC_ctgsDRAFT_1011546 | 3300000333 | Bacteria | 2111 |
| 44 | Ga0102740_1001543 | 3300007140 | Unclassified | 5792 |
| 45 | Ga0466701_083731 | 3300042598 | Bacteria | 1484 |
| 46 | Ga0466706_075226 | 3300042599 | Bacteria | 98836 |
| 47 | Ga0466713_047654 | 3300042602 | Bacteria | 20156 |
| 48 | Ga0466714_118747 | 3300042603 | Archaea | 1214 |
| 49 | Ga0466717_018238 | 3300042604 | Bacteria | 1026 |
| 50 | Ga0466719_294708 | 3300042606 | Bacteria | 2845 |
| 51 | Ga0466719_475299 | 3300042606 | Bacteria | 1348 |
| 52 | Ga0466703_012372 | 3300042636 | Bacteria | 6701 |
| 53 | Ga0466704_276708 | 3300042643 | Bacteria | 3015 |
| 54 | Ga0466724_14581 | 3300042649 | Bacteria | 33833 |
| 55 | Ga0466725_216335 | 3300042654 | Bacteria | 1769 |
| 56 | Ga0466727_283509 | 3300042655 | Unclassified | 3004 |
| 57 | Ga0466705_301234 | 3300042612 | Bacteria | 32924 |
| 58 | Ga0466715_349455 | 3300042616 | Bacteria | 10260 |
| 59 | Ga0466728_391434 | 3300042620 | Bacteria | 4930 |
| 60 | Ga0160443_100175 | 3300012848 | Bacteria | 87877 |
| 61 | Ga0264413_158524 | 3300024493 | Bacteria | 2913 |
| 62 | Ga0123353_10292614 | 3300010167 | Bacteria | 2492 |
| 63 | Ga0123353_10332731 | 3300010167 | Bacteria | 2298 |
| 64 | Ga0103260_1000391 | 3300007139 | Bacteria | 8548 |
| 65 | Ga0466701_101179 | 3300042598 | Bacteria | 45066 |
| 66 | Ga0466713_011933 | 3300042602 | Bacteria | 4364 |
| 67 | Ga0466716_194958 | 3300042605 | Bacteria | 3334 |
| 68 | Ga0466704_052209 | 3300042643 | Bacteria | 5050 |
| 69 | Ga0466708_157019 | 3300042652 | Unclassified | 3475 |
| 70 | Ga0466727_091289 | 3300042655 | Bacteria | 1030 |
| 71 | Ga0466697_089074 | 3300042611 | Bacteria | 7824 |
| 72 | Ga0466733_109499 | 3300042659 | Bacteria | 2393 |
| 73 | Ga0562378_0459 | 3300056814 | Bacteria | 69701 |
| 74 | Ga0562374_0255 | 3300057007 | Bacteria | 105455 |
| 75 | Ga0466711_060046 | 3300042615 | Bacteria | 1723 |
| 76 | Ga0466729_189839 | 3300042621 | Bacteria | 5313 |
| 77 | Ga0160448_102162 | 3300012854 | Bacteria | 6157 |
| 78 | Ga0247289_2953 | 3300035363 | Bacteria | 1013 |
| 79 | Ga0466696_392717 | 3300042596 | Bacteria | 1817 |
| 80 | Ga0123357_10109227 | 3300009784 | Bacteria | 3534 |
| 81 | Ga0123353_10375609 | 3300010167 | Bacteria | 2129 |
| 82 | JGI24702J35022_10027117 | 3300002462 | Bacteria | 3082 |
| 83 | Ga0063521_1000216 | 3300003973 | Bacteria | 41019 |
| 84 | Ga0103266_1003485 | 3300007067 | Bacteria | 2225 |
| 85 | Ga0104042_1001336 | 3300007130 | Bacteria | 4839 |
| 86 | Ga0102738_1000308 | 3300007141 | Bacteria | 8935 |
| 87 | Ga0102737_1000697 | 3300007142 | Bacteria | 10572 |
| 88 | Ga0466701_056220 | 3300042598 | Bacteria | 5402 |
| 89 | Ga0466703_071589 | 3300042636 | Bacteria | 34836 |
| 90 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 91 | Ga0562376_0033 | 3300056857 | Bacteria | 349823 |
| 92 | Ga0160448_119409 | 3300012854 | Bacteria | 1133 |
| 93 | Ga0466657_043428 | 3300042582 | Bacteria | 1348 |
| 94 | Ga0123353_10164752 | 3300010167 | Bacteria | 3525 |
| 95 | Ga0123353_11374583 | 3300010167 | Bacteria | 910 |
| 96 | Ga0104040_1041504 | 3300007149 | Unclassified | 6171 |
| 97 | Ga0103264_1003634 | 3300007188 | Bacteria | 11852 |
| 98 | Ga0466713_057371 | 3300042602 | Unclassified | 3795 |
| 99 | Ga0466713_064390 | 3300042602 | Bacteria | 79441 |
| 100 | Ga0466722_117432 | 3300042609 | Bacteria | 14788 |
| 101 | Ga0466704_089192 | 3300042643 | Bacteria | 7470 |
| 102 | Ga0466709_047354 | 3300042648 | Bacteria | 4556 |
| 103 | Ga0466733_008938 | 3300042659 | Bacteria | 5479 |
| 104 | Ga0466733_075399 | 3300042659 | Bacteria | 137402 |
| 105 | Ga0562379_0385 | 3300056790 | Bacteria | 100305 |
| 106 | Ga0466705_445827 | 3300042612 | Unclassified | 1778 |
| 107 | Ga0466711_064700 | 3300042615 | Bacteria | 12916 |
| 108 | Ga0160430_107270 | 3300012852 | Bacteria | 2244 |
| 109 | Ga0123355_10015739 | 3300009826 | Bacteria | 11894 |
| 110 | Ga0123356_10145351 | 3300010049 | Bacteria | 2345 |
| 111 | Ga0123356_10806706 | 3300010049 | Bacteria | 1110 |
| 112 | Ga0123353_10417363 | 3300010167 | Bacteria | 1990 |
| 113 | Ga0160442_102357 | 3300012806 | Bacteria | 2093 |
| 114 | Ga0102739_1007169 | 3300007095 | Bacteria | 1482 |
| 115 | Ga0466730_090983 | 3300042625 | Bacteria | 44660 |
| 116 | Ga0466711_231037 | 3300042615 | Bacteria | 52802 |
| 117 | Ga0160472_101004 | 3300012839 | Unclassified | 10196 |
| 118 | Ga0466657_321981 | 3300042582 | Bacteria | 6118 |
| 119 | Ga0466694_000244 | 3300042594 | Bacteria | 3240 |
| 120 | Ga0466696_065608 | 3300042596 | Bacteria | 5756 |
| 121 | Ga0123355_10235158 | 3300009826 | Bacteria | 2608 |
| 122 | Ga0123356_10032652 | 3300010049 | Bacteria | 4869 |
| 123 | Ga0123354_10228617 | 3300010882 | Bacteria | 1952 |
| 124 | 2227168879 | 2225789004 | Bacteria | 1530 |
| 125 | SCG598I20_12767 | 3300000473 | Bacteria | 34711 |
| 126 | Ga0063521_1000001 | 3300003973 | Bacteria | 444973 |
| 127 | Ga0063521_1000148 | 3300003973 | Bacteria | 53120 |
| 128 | Ga0127645_107065 | 3300009461 | Bacteria | 10461 |
| 129 | Ga0466707_108945 | 3300042601 | Bacteria | 26595 |
| 130 | Ga0466713_073337 | 3300042602 | Bacteria | 7380 |
| 131 | Ga0466724_55882 | 3300042649 | Bacteria | 21410 |
| 132 | Ga0466724_66024 | 3300042649 | Bacteria | 3739 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09370 | PEP_hydrolase | Phosphoenolpyruvate hydrolase-like | 65 | 330 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.