Protein Family IF08219
Metagenome
Isolate
342
Members
245
Samples
172
Scaffolds
255.71
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_090533|Ga0466726_090533_1287_2189
- Length
- 300 aa
- Sequence
- MKPTSKRPYDYSHIKNERKVRKNQKDDTAAGFGASPMTFLWRCEKMSVIDLNSDLGESFGAWTMGLDEDVMNHISSANIACGWHAGDAEIMVKTVRAAKAKGVAVGAHPGYPDLLGFGRRNMTCTPDELYAYTLYQAGALKTICESEGIELQHVKPHGAMYNQAAKDPKLAEAIVRAVKNTGKGIILMGLANSAFETAAKELGVPFVSEAFADRGYMPDGSLVPRSQPGAFVHDPDEAAARMVKLVKEGTVTTPDGRTLKLNARSICMHGDNPAAVKMAEVVRAAMEKNGIAVRPLKPGA
Sample Types
Isolate
49.7%
Metagenome
50.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
41.7%
Unclassified
10.1%
Kalotermitidae
6.1%
Termitidae
5.7%
Elmidae
4.8%
Curculionidae
4.4%
Culicidae
3.9%
Drosophilidae
3.5%
Tenebrionidae
3.1%
Formicidae
2.2%
Armadillidiidae
1.8%
Termopsidae
1.8%
Cambaridae
1.3%
Scarabaeidae
1.3%
Hydrophilidae
1.3%
Rhinotermitidae
1.3%
Calliphoridae
0.9%
Passalidae
0.4%
Crambidae
0.4%
Pteromalidae
0.4%
Plutellidae
0.4%
Tephritidae
0.4%
Daphniidae
0.4%
Nephropidae
0.4%
Ceratophyllidae
0.4%
Trigoniulidae
0.4%
Carabidae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
0
Bacteria
320
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 3 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 4 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 5 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 6 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 7 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 8 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 9 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 10 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 11 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 12 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 13 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 14 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 15 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 16 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 17 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 18 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 19 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 20 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 21 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 22 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 23 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 24 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 25 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 26 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 27 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 28 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 29 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 30 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 31 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 32 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 33 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 34 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 35 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 36 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 37 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 38 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 39 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 40 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 41 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 42 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 43 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 44 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 45 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 46 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 47 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 52 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 53 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 54 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 55 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 56 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 57 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 58 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 59 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 60 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 61 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 62 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 63 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 64 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 65 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 66 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 67 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 68 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 69 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 70 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 71 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 72 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 73 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 74 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 75 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 76 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 77 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 78 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 79 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 80 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 81 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 82 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 83 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 84 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 85 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 86 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 87 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 88 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 89 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 90 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 91 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 92 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 93 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 94 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 95 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 96 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 97 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 98 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 99 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 100 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 101 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 102 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 103 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 104 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 105 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 106 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 107 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 108 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 109 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 110 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 111 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 112 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 113 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 114 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 115 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 116 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 117 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 118 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 119 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 120 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 121 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 122 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 123 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 124 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 125 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 126 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 127 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 128 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 129 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 130 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 131 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 132 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 133 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 134 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 135 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 136 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 137 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 138 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 139 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 140 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 141 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 142 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 143 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 144 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 145 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 146 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 147 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 148 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 149 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 150 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 151 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 152 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 153 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 154 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 155 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 156 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 157 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 158 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 159 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 160 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 161 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 162 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 163 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 164 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 165 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 166 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 167 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 168 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 169 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 170 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 171 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 172 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 173 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 174 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 175 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 176 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 177 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 178 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 179 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 180 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 181 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 182 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 183 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 184 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 185 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 186 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 187 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 188 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 189 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 190 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 191 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 192 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 193 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 194 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 195 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 196 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 197 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 198 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 199 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 200 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 201 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 202 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 203 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 204 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 205 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 206 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 207 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 208 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 209 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 210 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 211 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 212 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 213 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 214 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 215 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 216 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 217 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 218 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 219 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 220 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 221 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 222 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 223 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 224 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 225 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 226 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 227 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 228 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 229 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 230 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 231 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 232 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 233 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 234 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 235 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 236 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 237 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 238 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 239 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 240 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 241 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 242 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 243 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 244 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 245 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562374_0085 | 3300057007 | Bacteria | 277368 |
| 2 | Ga0466705_521644 | 3300042612 | Bacteria | 6371 |
| 3 | Ga0466711_053645 | 3300042615 | Bacteria | 10496 |
| 4 | Ga0466711_482235 | 3300042615 | Bacteria | 3244 |
| 5 | Ga0466715_519925 | 3300042616 | Bacteria | 16340 |
| 6 | Ga0466723_354202 | 3300042618 | Bacteria | 9902 |
| 7 | DPO_contig08735 | 2032320009 | Bacteria | 73498 |
| 8 | 2227419696 | 2225789004 | Bacteria | 5648 |
| 9 | SCG598B02_11547 | 3300000472 | Unclassified | 22004 |
| 10 | JGI24703J35330_11470516 | 3300002501 | Bacteria | 1064 |
| 11 | Ga0160453_103500 | 3300012814 | Unclassified | 3218 |
| 12 | Ga0160467_100572 | 3300012829 | Bacteria | 32299 |
| 13 | Ga0466691_069662 | 3300042593 | Bacteria | 3249 |
| 14 | Ga0466696_203174 | 3300042596 | Bacteria | 1575 |
| 15 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 16 | Ga0466722_169620 | 3300042609 | Bacteria | 6039 |
| 17 | Ga0466730_059996 | 3300042625 | Bacteria | 2743 |
| 18 | Ga0466703_010074 | 3300042636 | Bacteria | 2565 |
| 19 | Ga0466704_539526 | 3300042643 | Unclassified | 1318 |
| 20 | Ga0466724_26946 | 3300042649 | Bacteria | 17337 |
| 21 | Ga0466725_105419 | 3300042654 | Bacteria | 2585 |
| 22 | Ga0562378_0175 | 3300056814 | Bacteria | 161937 |
| 23 | Ga0466726_090533 | 3300042619 | Bacteria | 2248 |
| 24 | FGTW_contig31395 | 2065487013 | Bacteria | 4649 |
| 25 | Ga0074278_115844 | 3300005721 | Unclassified | 14000 |
| 26 | Ga0074278_120410 | 3300005721 | Bacteria | 177707 |
| 27 | Ga0074278_149683 | 3300005721 | Unclassified | 1733 |
| 28 | Ga0102737_1000745 | 3300007142 | Bacteria | 10186 |
| 29 | Ga0105005_1021586 | 3300007505 | Bacteria | 6691 |
| 30 | Ga0123355_10038815 | 3300009826 | Bacteria | 7743 |
| 31 | Ga0123355_10207615 | 3300009826 | Bacteria | 2846 |
| 32 | Ga0160440_106318 | 3300012815 | Unclassified | 1080 |
| 33 | Ga0160456_101883 | 3300012820 | Bacteria | 4461 |
| 34 | Ga0160459_104812 | 3300012831 | Bacteria | 1806 |
| 35 | Ga0160447_105983 | 3300012849 | Unclassified | 3276 |
| 36 | Ga0247290_00586 | 3300035364 | Bacteria | 6074 |
| 37 | Ga0466704_288120 | 3300042643 | Bacteria | 1721 |
| 38 | Ga0562378_0833 | 3300056814 | Bacteria | 41305 |
| 39 | Ga0466728_056073 | 3300042620 | Bacteria | 32405 |
| 40 | Ga0466728_354254 | 3300042620 | Bacteria | 2881 |
| 41 | FGTW_contig11692 | 2065487013 | Bacteria | 1048 |
| 42 | CVPL010L_1000330 | 3300002932 | Bacteria | 30598 |
| 43 | Ga0123354_10307149 | 3300010882 | Bacteria | 1489 |
| 44 | Ga0160466_103226 | 3300012809 | Bacteria | 2772 |
| 45 | Ga0160466_105373 | 3300012809 | Bacteria | 1711 |
| 46 | Ga0160470_100032 | 3300012813 | Bacteria | 210853 |
| 47 | Ga0160468_108463 | 3300012819 | Bacteria | 1042 |
| 48 | Ga0160460_101259 | 3300012845 | Bacteria | 9273 |
| 49 | Ga0160435_1000858 | 3300012857 | Unclassified | 8380 |
| 50 | Ga0264413_140285 | 3300024493 | Unclassified | 1474 |
| 51 | Ga0466657_057473 | 3300042582 | Bacteria | 2358 |
| 52 | Ga0466690_134162 | 3300042590 | Bacteria | 2758 |
| 53 | Ga0466692_074855 | 3300042591 | Bacteria | 11805 |
| 54 | Ga0466692_125299 | 3300042591 | Bacteria | 7161 |
| 55 | Ga0466701_086020 | 3300042598 | Unclassified | 3684 |
| 56 | Ga0466707_306265 | 3300042601 | Bacteria | 3205 |
| 57 | Ga0466713_136649 | 3300042602 | Bacteria | 28419 |
| 58 | Ga0466735_195126 | 3300042624 | Bacteria | 4507 |
| 59 | Ga0466703_315903 | 3300042636 | Bacteria | 4511 |
| 60 | Ga0466724_01280 | 3300042649 | Unclassified | 27485 |
| 61 | Ga0466725_115797 | 3300042654 | Bacteria | 2479 |
| 62 | Ga0466727_253392 | 3300042655 | Bacteria | 1800 |
| 63 | Ga0466705_093523 | 3300042612 | Bacteria | 2720 |
| 64 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 65 | Ga0466705_392632 | 3300042612 | Unclassified | 8320 |
| 66 | Ga0466726_096227 | 3300042619 | Bacteria | 5455 |
| 67 | Ga0466729_106594 | 3300042621 | Bacteria | 2805 |
| 68 | SPBB_contig11532 | 2044078006 | Bacteria | 58819 |
| 69 | Ga0074278_118601 | 3300005721 | Bacteria | 10999 |
| 70 | Ga0160454_100690 | 3300012798 | Unclassified | 7544 |
| 71 | Ga0160471_101661 | 3300012812 | Bacteria | 4174 |
| 72 | Ga0160441_101630 | 3300012825 | Unclassified | 6186 |
| 73 | Ga0160441_101830 | 3300012825 | Bacteria | 5317 |
| 74 | Ga0160458_103915 | 3300012832 | Bacteria | 1836 |
| 75 | Ga0466701_021554 | 3300042598 | Bacteria | 13380 |
| 76 | Ga0466701_025144 | 3300042598 | Bacteria | 3883 |
| 77 | Ga0466701_046895 | 3300042598 | Bacteria | 1014 |
| 78 | Ga0466713_089703 | 3300042602 | Bacteria | 37167 |
| 79 | Ga0466716_349688 | 3300042605 | Bacteria | 2885 |
| 80 | Ga0466722_022956 | 3300042609 | Bacteria | 31245 |
| 81 | Ga0466722_109045 | 3300042609 | Bacteria | 29135 |
| 82 | Ga0466730_014428 | 3300042625 | Unclassified | 3142 |
| 83 | Ga0466704_131659 | 3300042643 | Bacteria | 4107 |
| 84 | Ga0466704_480341 | 3300042643 | Bacteria | 8246 |
| 85 | Ga0466724_27340 | 3300042649 | Unclassified | 6601 |
| 86 | Ga0466708_258494 | 3300042652 | Bacteria | 68567 |
| 87 | Ga0466708_324244 | 3300042652 | Bacteria | 2045 |
| 88 | Ga0466697_102584 | 3300042611 | Bacteria | 4559 |
| 89 | Ga0562375_0101 | 3300056856 | Bacteria | 264748 |
| 90 | FGTW_contig04902 | 2065487013 | Bacteria | 1160 |
| 91 | SCG598P17_11838 | 3300000461 | Bacteria | 26469 |
| 92 | Ga0068302_10001711 | 3300005071 | Bacteria | 2264 |
| 93 | Ga0103260_1000676 | 3300007139 | Bacteria | 6453 |
| 94 | Ga0123355_10094716 | 3300009826 | Bacteria | 4723 |
| 95 | Ga0160465_100592 | 3300012803 | Bacteria | 15444 |
| 96 | Ga0160453_101639 | 3300012814 | Bacteria | 7102 |
| 97 | Ga0160447_104190 | 3300012849 | Bacteria | 4348 |
| 98 | Ga0466701_039366 | 3300042598 | Bacteria | 1852 |
| 99 | Ga0466707_127658 | 3300042601 | Bacteria | 2786 |
| 100 | Ga0466716_145812 | 3300042605 | Bacteria | 11893 |
| 101 | Ga0466719_521162 | 3300042606 | Bacteria | 1605 |
| 102 | Ga0466734_014204 | 3300042623 | Bacteria | 5849 |
| 103 | Ga0466709_313319 | 3300042648 | Bacteria | 6112 |
| 104 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 105 | Ga0466708_269716 | 3300042652 | Bacteria | 44728 |
| 106 | Ga0466708_300671 | 3300042652 | Bacteria | 4663 |
| 107 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 108 | Ga0466711_143598 | 3300042615 | Bacteria | 59710 |
| 109 | Ga0466715_437573 | 3300042616 | Bacteria | 2298 |
| 110 | Ga0466715_512633 | 3300042616 | Bacteria | 15112 |
| 111 | Ga0466723_372586 | 3300042618 | Bacteria | 1577 |
| 112 | Ga0466726_154436 | 3300042619 | Bacteria | 30482 |
| 113 | Ga0466726_393533 | 3300042619 | Bacteria | 4700 |
| 114 | gam1t_NODE_82287_length=13980_GC=32_2_Contigs=3 | 2189573031 | Bacteria | 14000 |
| 115 | Ga0068305_10738950 | 3300005083 | Bacteria | 2194 |
| 116 | Ga0160440_105973 | 3300012815 | Bacteria | 1116 |
| 117 | Ga0160441_100135 | 3300012825 | Bacteria | 82290 |
| 118 | Ga0160433_102278 | 3300012846 | Bacteria | 4254 |
| 119 | Ga0160435_1001310 | 3300012857 | Bacteria | 6429 |
| 120 | Ga0466696_034402 | 3300042596 | Bacteria | 11934 |
| 121 | Ga0466696_213008 | 3300042596 | Bacteria | 1413 |
| 122 | Ga0466720_194427 | 3300042607 | Bacteria | 5744 |
| 123 | Ga0466722_101643 | 3300042609 | Bacteria | 4183 |
| 124 | Ga0466729_245064 | 3300042621 | Bacteria | 3274 |
| 125 | Ga0466730_020092 | 3300042625 | Bacteria | 6206 |
| 126 | Ga0466730_025884 | 3300042625 | Unclassified | 3480 |
| 127 | Ga0466703_129726 | 3300042636 | Bacteria | 1904 |
| 128 | Ga0466704_398603 | 3300042643 | Bacteria | 34713 |
| 129 | Ga0466727_037806 | 3300042655 | Bacteria | 1817 |
| 130 | SCG598L16_135179 | 3300000490 | Unclassified | 10911 |
| 131 | Ga0072941_1433090 | 3300005201 | Bacteria | 947 |
| 132 | Ga0160441_104311 | 3300012825 | Bacteria | 2268 |
| 133 | Ga0160431_100276 | 3300012828 | Bacteria | 30711 |
| 134 | Ga0160467_103275 | 3300012829 | Unclassified | 2848 |
| 135 | Ga0160452_102613 | 3300012834 | Unclassified | 3669 |
| 136 | Ga0160430_100874 | 3300012852 | Bacteria | 13536 |
| 137 | Ga0316159_12356 | 3300030930 | Bacteria | 2826 |
| 138 | Ga0466696_036441 | 3300042596 | Bacteria | 13981 |
| 139 | Ga0466696_083972 | 3300042596 | Bacteria | 3696 |
| 140 | Ga0466701_103029 | 3300042598 | Bacteria | 17870 |
| 141 | Ga0466722_123081 | 3300042609 | Bacteria | 33267 |
| 142 | Ga0466697_055956 | 3300042611 | Bacteria | 3175 |
| 143 | Ga0466724_35085 | 3300042649 | Bacteria | 16789 |
| 144 | Ga0466724_41787 | 3300042649 | Bacteria | 42491 |
| 145 | Ga0466724_51641 | 3300042649 | Bacteria | 75820 |
| 146 | Ga0466708_287708 | 3300042652 | Bacteria | 8871 |
| 147 | Ga0466725_338581 | 3300042654 | Bacteria | 1742 |
| 148 | Ga0466727_052233 | 3300042655 | Bacteria | 5767 |
| 149 | Ga0466710_068284 | 3300042613 | Bacteria | 1545 |
| 150 | Ga0466711_367273 | 3300042615 | Bacteria | 9243 |
| 151 | Ga0466723_312170 | 3300042618 | Bacteria | 7227 |
| 152 | Ga0466726_127303 | 3300042619 | Bacteria | 7941 |
| 153 | Ga0466728_362172 | 3300042620 | Bacteria | 3917 |
| 154 | Ga0466728_455147 | 3300042620 | Bacteria | 1781 |
| 155 | DPOL_contig19474 | 2035918003 | Bacteria | 37073 |
| 156 | SPBB_contig00117 | 2044078006 | Bacteria | 69125 |
| 157 | gam1t_NODE_104069_length=177687_GC=33_4_Contigs=3 | 2189573031 | Bacteria | 177707 |
| 158 | gam1t_NODE_212926_length=10999_GC=42_6_Contigs=1 | 2189573031 | Unclassified | 10999 |
| 159 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 160 | Ga0123353_10039652 | 3300010167 | Bacteria | 7418 |
| 161 | Ga0160470_100901 | 3300012813 | Bacteria | 8735 |
| 162 | Ga0160453_100287 | 3300012814 | Bacteria | 46585 |
| 163 | Ga0160432_100800 | 3300012818 | Bacteria | 14914 |
| 164 | Ga0160446_100189 | 3300012835 | Unclassified | 43640 |
| 165 | Ga0160447_101369 | 3300012849 | Bacteria | 9560 |
| 166 | Ga0466692_124535 | 3300042591 | Bacteria | 1218 |
| 167 | Ga0466722_128889 | 3300042609 | Bacteria | 2782 |
| 168 | Ga0466730_087877 | 3300042625 | Bacteria | 1204 |
| 169 | Ga0466704_432256 | 3300042643 | Bacteria | 1382 |
| 170 | Ga0466709_393602 | 3300042648 | Bacteria | 7146 |
| 171 | Ga0466724_17605 | 3300042649 | Bacteria | 124775 |
| 172 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03746 | LamB_YcsF | LamB/YcsF family | 49 | 286 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.