Protein Family IF08068
Metagenome
Isolate
202
Members
110
Samples
148
Scaffolds
272.38
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_116918|Ga0466723_116918_114_1070
- Length
- 318 aa
- Sequence
- MWYTELSGAAPEFDRGRHDRKSYGITAPKTGRGGDGEVNMSILSGKKIGFIGAGRMAEAIFNGLLKSGKVSPKDLTVADIAGERLDELAAKYSVSVIKNAADGNAPLRGLLSCRVIVLAVKPQGANALLTEIGGWFTGDHLVVSIMGGITLGFLQNRIPGAAVIRVMPNLPILVGEGAAGVALGERASEDDGEVALAMFRAAGIAYLCPEHLLDPLTGVSGCGPAYAFLFIEAMADCGVEMGLPRDLAYRLAAQTLVGAGRMVLETGRHPGQLKDDVCSPGGSTIAGVHSLEQNGFRGIVMDAVEAAKLRMEEIGRDA
Sample Types
Isolate
26.7%
Metagenome
73.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.6%
Termitidae
21.3%
Kalotermitidae
12.0%
Drosophilidae
5.6%
Blattidae
5.6%
Curculionidae
4.6%
Sarcophagidae
2.8%
Termopsidae
2.8%
Apidae
1.9%
Aphididae
1.9%
Tenebrionidae
1.9%
Passalidae
1.9%
Tephritidae
1.9%
Culicidae
1.9%
Anthocoridae
0.9%
Formicidae
0.9%
Thripidae
0.9%
Rhinotermitidae
0.9%
Hodotermitidae
0.9%
Taxonomy
Archaea
1
Bacteria
183
Eukaryota
1
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 2 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 3 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 4 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 5 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 6 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 7 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 8 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 9 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 10 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 11 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 14 | 3300005320 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut | Metagenome | Drosophilidae |
| 15 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 16 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 19 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 20 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 21 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 22 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 23 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 24 | 3300007226 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 4 gut | Metagenome | Drosophilidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 27 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 28 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 29 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 30 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 34 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 35 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 36 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 37 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 38 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 39 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 43 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 44 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 49 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 50 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 51 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 52 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 53 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 60 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 61 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 62 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 63 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 64 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 67 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 68 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 69 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 70 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 71 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 72 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 76 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 77 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 78 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 81 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 82 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 83 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 84 | 3300005322 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 1 gut | Metagenome | Drosophilidae |
| 85 | 3300007506 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut | Metagenome | Drosophilidae |
| 86 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 87 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 88 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 89 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 90 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 91 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 92 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 93 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 94 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 95 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 96 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 97 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 98 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 99 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 100 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 101 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 102 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 103 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 104 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 105 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 106 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 107 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 108 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 109 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 110 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_279036 | 3300042599 | Bacteria | 2987 |
| 2 | Ga0466719_046990 | 3300042606 | Bacteria | 6447 |
| 3 | Ga0456237_0016659 | 3300041968 | Bacteria | 1035 |
| 4 | Ga0466696_465846 | 3300042596 | Bacteria | 6135 |
| 5 | Ga0466699_156379 | 3300042597 | Unclassified | 1536 |
| 6 | 2227253017 | 2225789004 | Bacteria | 7106 |
| 7 | IMNBL1DRAFT_c0000372 | 3300000062 | Bacteria | 38285 |
| 8 | JGI24698J34947_10010590 | 3300002449 | Bacteria | 5061 |
| 9 | JGI24698J34947_10026609 | 3300002449 | Bacteria | 3073 |
| 10 | JGI24698J34947_10036992 | 3300002449 | Bacteria | 2538 |
| 11 | JGI24695J34938_10000742 | 3300002450 | Bacteria | 30626 |
| 12 | JGI24695J34938_10018892 | 3300002450 | Archaea | 3431 |
| 13 | JGI24695J34938_10024106 | 3300002450 | Unclassified | 2925 |
| 14 | Ga0063521_1000166 | 3300003973 | Bacteria | 49372 |
| 15 | Ga0072941_1028944 | 3300005201 | Bacteria | 7323 |
| 16 | Ga0105008_1097388 | 3300007507 | Unclassified | 4000 |
| 17 | Ga0105008_1103156 | 3300007507 | Unclassified | 2753 |
| 18 | Ga0127657_185103 | 3300009457 | Bacteria | 1705 |
| 19 | Ga0466735_137926 | 3300042624 | Bacteria | 1094 |
| 20 | Ga0466703_071041 | 3300042636 | Bacteria | 5019 |
| 21 | Ga0466703_130543 | 3300042636 | Bacteria | 2477 |
| 22 | Ga0466703_327607 | 3300042636 | Bacteria | 21356 |
| 23 | Ga0466709_370938 | 3300042648 | Bacteria | 5921 |
| 24 | Ga0466715_132867 | 3300042616 | Bacteria | 3916 |
| 25 | Ga0466726_437260 | 3300042619 | Bacteria | 4489 |
| 26 | Ga0466726_469675 | 3300042619 | Bacteria | 5104 |
| 27 | Ga0466728_341464 | 3300042620 | Bacteria | 3612 |
| 28 | Ga0466732_391959 | 3300042656 | Bacteria | 1324 |
| 29 | Ga0123356_10000626 | 3300010049 | Bacteria | 39002 |
| 30 | Ga0123353_11213107 | 3300010167 | Bacteria | 989 |
| 31 | Ga0466700_310786 | 3300042600 | Bacteria | 1476 |
| 32 | Ga0466719_420593 | 3300042606 | Bacteria | 1687 |
| 33 | Ga0160472_100022 | 3300012839 | Bacteria | 329165 |
| 34 | Ga0466693_137411 | 3300042592 | Bacteria | 2461 |
| 35 | Ga0466694_152628 | 3300042594 | Bacteria | 2439 |
| 36 | JGI24695J34938_10000023 | 3300002450 | Bacteria | 110103 |
| 37 | JGI24695J34938_10003904 | 3300002450 | Bacteria | 10083 |
| 38 | JGI24695J34938_10012141 | 3300002450 | Bacteria | 4586 |
| 39 | JGI24700J35501_10930911 | 3300002508 | Bacteria | 40904 |
| 40 | Ga0063521_1000020 | 3300003973 | Bacteria | 138309 |
| 41 | Ga0104148_1018516 | 3300007226 | Unclassified | 2019 |
| 42 | Ga0105553_1001637 | 3300007767 | Unclassified | 3187 |
| 43 | Ga0466735_236145 | 3300042624 | Bacteria | 1448 |
| 44 | Ga0466704_608546 | 3300042643 | Bacteria | 1713 |
| 45 | Ga0466718_007069 | 3300042617 | Bacteria | 1047 |
| 46 | Ga0466718_011452 | 3300042617 | Bacteria | 22863 |
| 47 | Ga0466723_195871 | 3300042618 | Bacteria | 20538 |
| 48 | Ga0466726_393740 | 3300042619 | Bacteria | 1380 |
| 49 | Ga0466705_368221 | 3300042612 | Bacteria | 1287 |
| 50 | Ga0466732_039367 | 3300042656 | Bacteria | 13816 |
| 51 | Ga0123353_10040180 | 3300010167 | Bacteria | 7378 |
| 52 | Ga0123353_10503474 | 3300010167 | Bacteria | 1764 |
| 53 | Ga0466719_102351 | 3300042606 | Bacteria | 13783 |
| 54 | Ga0316159_11863 | 3300030930 | Bacteria | 2489 |
| 55 | Ga0415639_072995 | 3300038395 | Bacteria | 3768 |
| 56 | Ga0466694_070037 | 3300042594 | Bacteria | 5075 |
| 57 | Ga0466695_047016 | 3300042595 | Bacteria | 3012 |
| 58 | Ga0466699_231483 | 3300042597 | Bacteria | 1695 |
| 59 | IMNBL1DRAFT_c0000697 | 3300000062 | Bacteria | 26957 |
| 60 | JGI24698J34947_10016363 | 3300002449 | Bacteria | 4025 |
| 61 | JGI24695J34938_10002765 | 3300002450 | Bacteria | 12886 |
| 62 | JGI24695J34938_10002914 | 3300002450 | Bacteria | 12428 |
| 63 | JGI24695J34938_10003413 | 3300002450 | Bacteria | 11123 |
| 64 | JGI24702J35022_10006107 | 3300002462 | Bacteria | 6992 |
| 65 | Ga0104148_1085436 | 3300007226 | Unclassified | 1916 |
| 66 | Ga0466731_303959 | 3300042622 | Bacteria | 1047 |
| 67 | Ga0466718_056323 | 3300042617 | Bacteria | 3134 |
| 68 | Ga0466723_182672 | 3300042618 | Eukaryota | 2214 |
| 69 | Ga0466705_322993 | 3300042612 | Bacteria | 4933 |
| 70 | Ga0466706_039361 | 3300042599 | Bacteria | 37370 |
| 71 | Ga0466707_202459 | 3300042601 | Bacteria | 205011 |
| 72 | Ga0415639_044392 | 3300038395 | Bacteria | 1833 |
| 73 | Ga0415639_084401 | 3300038395 | Bacteria | 1886 |
| 74 | Ga0466699_249699 | 3300042597 | Bacteria | 1284 |
| 75 | JGI24695J34938_10010628 | 3300002450 | Bacteria | 5023 |
| 76 | JGI24695J34938_10013114 | 3300002450 | Bacteria | 4364 |
| 77 | JGI24695J34938_10030010 | 3300002450 | Bacteria | 2537 |
| 78 | Ga0074314_1146080 | 3300005322 | Unclassified | 2743 |
| 79 | Ga0105008_1106204 | 3300007507 | Unclassified | 2286 |
| 80 | Ga0466715_578803 | 3300042616 | Bacteria | 3829 |
| 81 | Ga0123353_10657526 | 3300010167 | Bacteria | 1482 |
| 82 | Ga0466706_067257 | 3300042599 | Bacteria | 1586 |
| 83 | Ga0466716_037911 | 3300042605 | Bacteria | 6025 |
| 84 | Ga0316159_10002 | 3300030930 | Bacteria | 247683 |
| 85 | Ga0415639_072178 | 3300038395 | Bacteria | 1784 |
| 86 | Ga0466693_106800 | 3300042592 | Bacteria | 1069 |
| 87 | Ga0466694_288433 | 3300042594 | Bacteria | 37936 |
| 88 | Ga0466699_121434 | 3300042597 | Bacteria | 8802 |
| 89 | JGI24695J34938_10012165 | 3300002450 | Bacteria | 4582 |
| 90 | JGI24695J34938_10056608 | 3300002450 | Unclassified | 1689 |
| 91 | JGI24702J35022_10001953 | 3300002462 | Unclassified | 12709 |
| 92 | JGI24703J35330_11748866 | 3300002501 | Bacteria | 64618 |
| 93 | Ga0104147_1003191 | 3300007224 | Unclassified | 2573 |
| 94 | Ga0466704_341128 | 3300042643 | Bacteria | 5855 |
| 95 | Ga0466709_336219 | 3300042648 | Bacteria | 9389 |
| 96 | Ga0466727_051312 | 3300042655 | Bacteria | 5273 |
| 97 | Ga0466711_297715 | 3300042615 | Bacteria | 7484 |
| 98 | Ga0466723_345586 | 3300042618 | Bacteria | 28546 |
| 99 | Ga0466732_193136 | 3300042656 | Bacteria | 6223 |
| 100 | Ga0562378_0469 | 3300056814 | Bacteria | 68128 |
| 101 | Ga0123355_10455546 | 3300009826 | Bacteria | 1609 |
| 102 | Ga0123354_10063095 | 3300010882 | Unclassified | 5448 |
| 103 | Ga0466706_043928 | 3300042599 | Bacteria | 34859 |
| 104 | Ga0466706_180766 | 3300042599 | Bacteria | 47789 |
| 105 | Ga0466719_207405 | 3300042606 | Bacteria | 10265 |
| 106 | Ga0466720_179107 | 3300042607 | Bacteria | 3441 |
| 107 | JGI24698J34947_10004110 | 3300002449 | Bacteria | 7895 |
| 108 | Ga0466709_204823 | 3300042648 | Bacteria | 202980 |
| 109 | Ga0466727_019591 | 3300042655 | Bacteria | 1564 |
| 110 | Ga0466712_128693 | 3300042614 | Bacteria | 6619 |
| 111 | Ga0466712_268511 | 3300042614 | Bacteria | 2073 |
| 112 | Ga0466718_032487 | 3300042617 | Bacteria | 2935 |
| 113 | Ga0466705_168798 | 3300042612 | Bacteria | 16173 |
| 114 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 115 | Ga0123356_10000688 | 3300010049 | Bacteria | 37446 |
| 116 | Ga0123356_10020691 | 3300010049 | Bacteria | 6222 |
| 117 | Ga0466706_115677 | 3300042599 | Bacteria | 48235 |
| 118 | Ga0466706_127056 | 3300042599 | Bacteria | 3061 |
| 119 | Ga0466706_212091 | 3300042599 | Bacteria | 5136 |
| 120 | Ga0415639_044390 | 3300038395 | Bacteria | 2918 |
| 121 | Ga0466696_265844 | 3300042596 | Bacteria | 7991 |
| 122 | Ga0466699_317814 | 3300042597 | Bacteria | 1106 |
| 123 | Ga0466699_349160 | 3300042597 | Bacteria | 3124 |
| 124 | JGI24695J34938_10026168 | 3300002450 | Bacteria | 2776 |
| 125 | Ga0074317_1119355 | 3300005320 | Unclassified | 2273 |
| 126 | Ga0105006_1175260 | 3300007506 | Unclassified | 1144 |
| 127 | Ga0105553_1083297 | 3300007767 | Unclassified | 2881 |
| 128 | Ga0123357_10003299 | 3300009784 | Bacteria | 18425 |
| 129 | Ga0466735_184070 | 3300042624 | Bacteria | 1167 |
| 130 | Ga0466712_028872 | 3300042614 | Bacteria | 1462 |
| 131 | Ga0466712_142554 | 3300042614 | Bacteria | 1046 |
| 132 | Ga0466712_274684 | 3300042614 | Bacteria | 1584 |
| 133 | Ga0466711_322087 | 3300042615 | Bacteria | 11104 |
| 134 | Ga0466715_060772 | 3300042616 | Bacteria | 11366 |
| 135 | Ga0466723_116918 | 3300042618 | Bacteria | 5135 |
| 136 | Ga0466705_380760 | 3300042612 | Bacteria | 5160 |
| 137 | Ga0123356_10035686 | 3300010049 | Bacteria | 4644 |
| 138 | Ga0466706_139159 | 3300042599 | Bacteria | 3092 |
| 139 | Ga0466713_096260 | 3300042602 | Bacteria | 4749 |
| 140 | Ga0466691_184999 | 3300042593 | Bacteria | 2427 |
| 141 | JGI24698J34947_10023881 | 3300002449 | Bacteria | 3268 |
| 142 | JGI24695J34938_10000140 | 3300002450 | Bacteria | 65738 |
| 143 | JGI24695J34938_10003663 | 3300002450 | Bacteria | 10530 |
| 144 | Ga0105008_1098799 | 3300007507 | Unclassified | 3791 |
| 145 | Ga0466735_070253 | 3300042624 | Bacteria | 3831 |
| 146 | Ga0466709_381462 | 3300042648 | Bacteria | 14014 |
| 147 | Ga0466708_258264 | 3300042652 | Bacteria | 68689 |
| 148 | Ga0466726_193270 | 3300042619 | Bacteria | 5508 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.