Protein Family IF07505

Metagenome Metatranscriptome Isolate
311 Members
91 Samples
277 Scaffolds
202.32 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_152238|Ga0466711_152238_690_1421
Length
243 aa
Sequence
LLNKRRRAIIGITLKSPHNTDQSDANQSAADKLRRRRVAVLVSGGGTNLQAIIDAKNGGKLPHVDIALVLSSDKNAFALERARKAGIENLALDVSDYTRNGVFDGERYDGDLLDALKKRGIEAVALAGFLVFLGEKTLSAYRSRIINVHPSLIPSFCGEGFHGLRVHEAALKRGVKITGATVHLVNEIIDGGRILSQKAVEVKSGDTPQTLQRRVMEKAEWIILPEALELLCAKAPPMPPLVQ

πŸ“Š Sample Types

Isolate 10.9%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 38.2%
Termitidae 31.5%
Kalotermitidae 14.6%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 2.2%
Cambaridae 2.2%
Blattidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 305
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
2 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
3 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
4 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
5 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
13 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
14 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
15 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
16 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
19 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
20 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
21 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
22 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
37 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
38 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
39 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
40 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
41 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
44 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
45 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
53 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
54 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
55 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
56 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
57 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
58 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
59 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
60 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
61 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
62 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
63 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
64 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
65 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
66 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
67 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
68 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
69 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
71 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
72 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
73 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
74 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
75 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
76 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
77 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
78 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
79 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
80 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
81 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
82 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
83 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
84 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
85 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
86 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
87 2820323050 Unclassified Firmicutes Nt197P3bin84 Isolate Unclassified
88 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
89 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
90 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
91 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_203867 3300042611 Bacteria 1055
2 Ga0466705_385933 3300042612 Bacteria 1949
3 Ga0466733_061900 3300042659 Bacteria 2094
4 Ga0456237_0010849 3300041968 Bacteria 1339
5 Ga0466690_145503 3300042590 Bacteria 7345
6 Ga0466690_149737 3300042590 Bacteria 9356
7 Ga0466699_014912 3300042597 Bacteria 1184
8 Ga0466699_182129 3300042597 Bacteria 1022
9 Ga0123355_10018894 3300009826 Bacteria 10959
10 Ga0123355_10260646 3300009826 Bacteria 2425
11 Ga0123356_10000496 3300010049 Bacteria 43882
12 Ga0123356_10067577 3300010049 Bacteria 3347
13 Ga0123356_10498839 3300010049 Bacteria 1373
14 Ga0123356_10615502 3300010049 Bacteria 1251
15 Ga0123353_10194178 3300010167 Unclassified 3201
16 Ga0123353_10447265 3300010167 Bacteria 1904
17 Ga0123353_10449822 3300010167 Bacteria 1897
18 Ga0123353_10717083 3300010167 Bacteria 1400
19 Ga0123353_11736985 3300010167 Bacteria 779
20 Ga0466702_428685 3300042635 Bacteria 1443
21 Ga0466703_022924 3300042636 Bacteria 31053
22 Ga0466708_210315 3300042652 Bacteria 30080
23 AustNasuHG_c1000003 3300000089 Bacteria 67820
24 AustNasuHG_c1027663 3300000089 Bacteria 1721
25 JGI24698J34947_10025121 3300002449 Bacteria 3173
26 JGI24698J34947_10026716 3300002449 Bacteria 3066
27 JGI24698J34947_10035279 3300002449 Bacteria 2612
28 JGI24698J34947_10073457 3300002449 Bacteria 1632
29 JGI24695J34938_10000184 3300002450 Bacteria 58384
30 Ga0072940_1231841 3300005200 Bacteria 2734
31 Ga0072940_1350228 3300005200 Bacteria 3369
32 Ga0072941_1000053 3300005201 Bacteria 29032
33 Ga0072941_1001065 3300005201 Bacteria 17219
34 Ga0072941_1001353 3300005201 Bacteria 2803
35 Ga0072941_1014623 3300005201 Bacteria 8117
36 Ga0072941_1019661 3300005201 Bacteria 2560
37 Ga0074263_107438 3300005485 Unclassified 1705
38 Ga0074263_113139 3300005485 Bacteria 2162
39 Ga0466706_089283 3300042599 Bacteria 21669
40 Ga0466713_110078 3300042602 Bacteria 49332
41 Ga0466714_121040 3300042603 Bacteria 1479
42 Ga0466720_048697 3300042607 Bacteria 12458
43 Ga0466733_030262 3300042659 Bacteria 1723
44 Ga0466695_402320 3300042595 Bacteria 61418
45 Ga0466696_412651 3300042596 Bacteria 1047
46 Ga0466712_037672 3300042614 Bacteria 53460
47 Ga0466715_353878 3300042616 Bacteria 24649
48 Ga0466729_194729 3300042621 Bacteria 19933
49 Ga0123355_10000663 3300009826 Bacteria 46614
50 Ga0123356_10000141 3300010049 Bacteria 81679
51 Ga0123356_11432008 3300010049 Bacteria 850
52 Ga0123353_10106135 3300010167 Bacteria 4526
53 Ga0466702_037243 3300042635 Bacteria 1547
54 Ga0466702_375469 3300042635 Bacteria 5267
55 Ga0466702_401638 3300042635 Bacteria 21442
56 Ga0466703_240951 3300042636 Bacteria 5347
57 Ga0466709_368918 3300042648 Bacteria 82197
58 Ga0466727_309638 3300042655 Bacteria 2569
59 IMNBL1DRAFT_c0000002 3300000062 Bacteria 288751
60 AustNasuHG_c1010753 3300000089 Bacteria 3182
61 JGI24695J34938_10000571 3300002450 Bacteria 35414
62 JGI24695J34938_10045137 3300002450 Bacteria 1956
63 JGI24705J35276_12238445 3300002504 Bacteria 22433
64 Ga0072941_1030585 3300005201 Bacteria 7774
65 Ga0466706_052593 3300042599 Bacteria 32390
66 Ga0466706_263246 3300042599 Bacteria 7967
67 Ga0466707_021941 3300042601 Bacteria 3202
68 Ga0466707_109337 3300042601 Bacteria 1123
69 Ga0466707_120341 3300042601 Bacteria 52839
70 Ga0466713_069375 3300042602 Bacteria 56682
71 Ga0466716_057405 3300042605 Bacteria 4782
72 Ga0466698_029720 3300042610 Bacteria 4799
73 Ga0466733_034617 3300042659 Bacteria 1486
74 Ga0415639_013481 3300038395 Bacteria 3567
75 Ga0415639_027319 3300038395 Bacteria 6894
76 Ga0466692_170380 3300042591 Bacteria 33735
77 Ga0466693_047917 3300042592 Bacteria 41531
78 Ga0466691_154777 3300042593 Bacteria 3311
79 Ga0466699_025262 3300042597 Bacteria 91867
80 Ga0466699_037849 3300042597 Bacteria 7193
81 Ga0466699_250696 3300042597 Bacteria 8006
82 Ga0466699_318473 3300042597 Bacteria 1468
83 Ga0466712_018554 3300042614 Bacteria 1594
84 Ga0466712_090132 3300042614 Bacteria 2436
85 Ga0466718_031474 3300042617 Bacteria 13802
86 Ga0466726_218885 3300042619 Bacteria 9934
87 Ga0123357_10464989 3300009784 Bacteria 1083
88 Ga0123355_10375223 3300009826 Bacteria 1859
89 Ga0123356_10000086 3300010049 Bacteria 97047
90 Ga0123356_10000124 3300010049 Bacteria 85126
91 Ga0123356_10000198 3300010049 Bacteria 69577
92 Ga0123356_10000550 3300010049 Bacteria 41544
93 Ga0123356_10005761 3300010049 Bacteria 12572
94 Ga0123356_10022546 3300010049 Bacteria 5943
95 Ga0123356_10099673 3300010049 Bacteria 2785
96 Ga0123353_10199128 3300010167 Bacteria 3153
97 Ga0466729_283405 3300042621 Bacteria 59369
98 Ga0466702_125266 3300042635 Bacteria 1357
99 Ga0466704_089357 3300042643 Bacteria 7851
100 JGI24698J34947_10001283 3300002449 Bacteria 13145
101 JGI24698J34947_10010235 3300002449 Bacteria 5142
102 JGI24698J34947_10051270 3300002449 Bacteria 2076
103 JGI24705J35276_12131181 3300002504 Bacteria 1105
104 Ga0072941_1020449 3300005201 Bacteria 1964
105 Ga0466706_084867 3300042599 Bacteria 1320
106 Ga0466706_263820 3300042599 Bacteria 45787
107 Ga0466707_345759 3300042601 Bacteria 6137
108 Ga0466713_137118 3300042602 Bacteria 1773
109 Ga0466716_016179 3300042605 Unclassified 1631
110 Ga0466719_545440 3300042606 Bacteria 2333
111 Ga0466699_032435 3300042597 Bacteria 1493
112 Ga0466712_007834 3300042614 Bacteria 1290
113 Ga0466712_007944 3300042614 Bacteria 1006
114 Ga0466712_075059 3300042614 Bacteria 3715
115 Ga0466711_153149 3300042615 Bacteria 4567
116 Ga0466715_593419 3300042616 Bacteria 37491
117 Ga0466726_229879 3300042619 Bacteria 4148
118 Ga0123355_11054832 3300009826 Bacteria 853
119 Ga0123353_11000217 3300010167 Bacteria 1124
120 Ga0466703_073400 3300042636 Bacteria 3596
121 Ga0466727_343570 3300042655 Bacteria 1317
122 IMNBL1DRAFT_c0064539 3300000062 Bacteria 1083
123 AustNasuHG_c1038661 3300000089 Unclassified 1197
124 AustNasuHG_c1042571 3300000089 Bacteria 1079
125 AustNasuHG_c1047288 3300000089 Bacteria 961
126 JGI24698J34947_10027799 3300002449 Bacteria 3000
127 JGI24698J34947_10058761 3300002449 Bacteria 1903
128 JGI24695J34938_10000712 3300002450 Bacteria 31375
129 JGI24695J34938_10001776 3300002450 Bacteria 17795
130 JGI24695J34938_10005846 3300002450 Bacteria 7566
131 JGI24695J34938_10080398 3300002450 Bacteria 1347
132 Ga0068305_10002306 3300005083 Bacteria 48693
133 Ga0072941_1033313 3300005201 Bacteria 15549
134 Ga0466706_021872 3300042599 Bacteria 1150
135 Ga0466706_054768 3300042599 Bacteria 1265
136 Ga0466706_121873 3300042599 Bacteria 9273
137 Ga0466706_248288 3300042599 Bacteria 1113
138 Ga0466706_281818 3300042599 Bacteria 10894
139 Ga0466720_198278 3300042607 Bacteria 7843
140 Ga0415639_031985 3300038395 Bacteria 4716
141 Ga0466694_155272 3300042594 Bacteria 2090
142 Ga0466694_319254 3300042594 Bacteria 1380
143 Ga0466694_396477 3300042594 Bacteria 4324
144 Ga0466705_488230 3300042612 Bacteria 1978
145 Ga0466705_527466 3300042612 Bacteria 2652
146 Ga0466712_082610 3300042614 Bacteria 1355
147 Ga0466711_152238 3300042615 Bacteria 1805
148 Ga0466711_465454 3300042615 Bacteria 1655
149 Ga0466723_012210 3300042618 Bacteria 23081
150 Ga0466726_334779 3300042619 Bacteria 20203
151 Ga0123357_10144980 3300009784 Bacteria 2904
152 Ga0123356_10275567 3300010049 Bacteria 1774
153 Ga0123353_10240536 3300010167 Bacteria 2813
154 Ga0466702_057328 3300042635 Bacteria 17553
155 Ga0466702_144479 3300042635 Bacteria 15823
156 Ga0466702_245015 3300042635 Bacteria 38015
157 Ga0466702_405566 3300042635 Bacteria 1513
158 Ga0466704_164591 3300042643 Bacteria 88701
159 AustNasuHG_c1001055 3300000089 Bacteria 9904
160 AustNasuHG_c1042455 3300000089 Bacteria 1082
161 JGI24698J34947_10013872 3300002449 Bacteria 4394
162 Ga0072940_1020639 3300005200 Bacteria 1766
163 Ga0072941_1000593 3300005201 Bacteria 20958
164 Ga0072941_1004198 3300005201 Bacteria 11537
165 Ga0466706_028773 3300042599 Bacteria 5884
166 Ga0466706_122717 3300042599 Bacteria 10539
167 Ga0466706_127660 3300042599 Bacteria 10216
168 Ga0466706_183331 3300042599 Bacteria 69025
169 Ga0466706_193580 3300042599 Unclassified 1573
170 Ga0466706_206273 3300042599 Bacteria 43079
171 Ga0466714_086369 3300042603 Bacteria 40105
172 Ga0466720_045669 3300042607 Bacteria 12086
173 Ga0466722_074482 3300042609 Bacteria 2470
174 Ga0466722_126274 3300042609 Bacteria 25494
175 Ga0466733_068463 3300042659 Bacteria 3386
176 Ga0466733_220381 3300042659 Bacteria 2389
177 Ga0264413_100638 3300024493 Bacteria 13446
178 Ga0264413_113625 3300024493 Bacteria 11677
179 Ga0415639_135059 3300038395 Bacteria 3082
180 Ga0466693_351063 3300042592 Bacteria 21220
181 Ga0466694_108083 3300042594 Bacteria 54973
182 Ga0466712_054472 3300042614 Bacteria 1504
183 Ga0466712_061400 3300042614 Bacteria 21098
184 Ga0123355_10055162 3300009826 Bacteria 6434
185 Ga0123355_10118327 3300009826 Bacteria 4117
186 Ga0123353_10061495 3300010167 Bacteria 6022
187 Ga0123353_10113379 3300010167 Bacteria 4364
188 Ga0123353_11137697 3300010167 Bacteria 1032
189 Ga0466735_235169 3300042624 Bacteria 3530
190 Ga0466702_146668 3300042635 Bacteria 1970
191 Ga0466702_182349 3300042635 Bacteria 34499
192 Ga0466702_403336 3300042635 Bacteria 1900
193 2227538517 2225789004 Bacteria 15888
194 JGI24695J34938_10001208 3300002450 Bacteria 22898
195 JGI24695J34938_10001953 3300002450 Bacteria 16543
196 Ga0072940_1008593 3300005200 Bacteria 2492
197 Ga0072941_1000754 3300005201 Bacteria 19604
198 Ga0466706_037893 3300042599 Bacteria 13008
199 Ga0466706_039169 3300042599 Bacteria 86401
200 Ga0466706_108689 3300042599 Bacteria 11416
201 Ga0466706_124534 3300042599 Bacteria 3575
202 Ga0466707_177929 3300042601 Bacteria 1059
203 Ga0466707_191602 3300042601 Bacteria 7400
204 Ga0466719_129749 3300042606 Bacteria 1318
205 Ga0466720_072526 3300042607 Bacteria 11119
206 Ga0466720_169414 3300042607 Bacteria 1406
207 Ga0466705_370031 3300042612 Bacteria 16318
208 Ga0255786_1035827 3300022815 Bacteria 2114
209 Ga0466691_087872 3300042593 Bacteria 2878
210 Ga0466691_128030 3300042593 Bacteria 5001
211 Ga0466696_208836 3300042596 Bacteria 44609
212 Ga0466699_228036 3300042597 Bacteria 1424
213 Ga0466699_261947 3300042597 Bacteria 1224
214 Ga0466712_048555 3300042614 Bacteria 1606
215 Ga0466711_383912 3300042615 Bacteria 5370
216 Ga0466715_140184 3300042616 Bacteria 25565
217 Ga0466715_607828 3300042616 Bacteria 77672
218 Ga0466718_022445 3300042617 Bacteria 1339
219 Ga0466723_149738 3300042618 Bacteria 1873
220 Ga0123355_10069496 3300009826 Bacteria 5660
221 Ga0123356_10486433 3300010049 Bacteria 1388
222 Ga0123353_10433446 3300010167 Bacteria 1942
223 Ga0123353_10877070 3300010167 Bacteria 1225
224 Ga0466703_140310 3300042636 Bacteria 83054
225 Ga0466708_321485 3300042652 Bacteria 5135
226 IMNBL1DRAFT_c0013597 3300000062 Bacteria 3640
227 JGI24698J34947_10008789 3300002449 Bacteria 5540
228 JGI24698J34947_10030621 3300002449 Bacteria 2837
229 JGI24695J34938_10000012 3300002450 Bacteria 126955
230 JGI24695J34938_10000322 3300002450 Bacteria 47194
231 Ga0068302_10063393 3300005071 Bacteria 2352
232 Ga0072940_1150488 3300005200 Bacteria 2250
233 Ga0072940_1171008 3300005200 Bacteria 2262
234 Ga0466706_193757 3300042599 Bacteria 1714
235 Ga0466706_203963 3300042599 Bacteria 2163
236 Ga0466706_264718 3300042599 Bacteria 2432
237 Ga0466707_109565 3300042601 Bacteria 3383
238 Ga0466707_194582 3300042601 Bacteria 13051
239 Ga0466707_260296 3300042601 Bacteria 3194
240 Ga0466719_308569 3300042606 Bacteria 54924
241 Ga0466721_174989 3300042608 Bacteria 226195
242 Ga0466733_193662 3300042659 Bacteria 14670
243 Ga0466690_153730 3300042590 Bacteria 3897
244 Ga0466692_025052 3300042591 Bacteria 1380
245 Ga0466694_408106 3300042594 Bacteria 16751
246 Ga0466712_071912 3300042614 Unclassified 1284
247 Ga0466712_233563 3300042614 Bacteria 7156
248 Ga0466718_015161 3300042617 Bacteria 9161
249 Ga0123357_10111179 3300009784 Bacteria 3492
250 Ga0123356_10029430 3300010049 Bacteria 5144
251 Ga0123356_10465727 3300010049 Bacteria 1414
252 Ga0123353_10108104 3300010167 Bacteria 4483
253 Ga0123353_10143523 3300010167 Bacteria 3822
254 Ga0123353_10538657 3300010167 Bacteria 1688
255 Ga0123354_10158136 3300010882 Bacteria 2707
256 Ga0466727_122928 3300042655 Bacteria 1198
257 2227272181 2225789004 Bacteria 1276
258 AustNasuHG_c1010347 3300000089 Bacteria 3252
259 JGI24698J34947_10070590 3300002449 Bacteria 1680
260 JGI24695J34938_10000015 3300002450 Bacteria 118711
261 JGI24695J34938_10001907 3300002450 Bacteria 16849
262 JGI24695J34938_10028857 3300002450 Bacteria 2601
263 Ga0072940_1016326 3300005200 Bacteria 7022
264 Ga0072940_1020637 3300005200 Bacteria 1151
265 Ga0072940_1282284 3300005200 Bacteria 2153
266 Ga0072941_1019088 3300005201 Bacteria 1692
267 Ga0074263_104523 3300005485 Bacteria 2047
268 Ga0466706_010096 3300042599 Bacteria 13391
269 Ga0466706_011257 3300042599 Bacteria 44160
270 Ga0466706_073310 3300042599 Bacteria 32772
271 Ga0466706_079547 3300042599 Bacteria 19358
272 Ga0466706_092349 3300042599 Bacteria 42995
273 Ga0466706_267431 3300042599 Bacteria 2055
274 Ga0466700_240199 3300042600 Bacteria 1168
275 Ga0466707_218240 3300042601 Bacteria 4301
276 Ga0466717_254114 3300042604 Bacteria 3148
277 Ga0466719_540595 3300042606 Bacteria 20921

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00551 Formyl_trans_N Formyl transferase 37 227 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00551 GO:0009058 biosynthetic process BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.