Protein Family IF07047
Metagenome
Isolate
270
Members
104
Samples
226
Scaffolds
573.05
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_024691|Ga0466705_024691_899_2761
- Length
- 613 aa
- Sequence
- MNHPVLEFKHFSFQYRSQTEPTLKDISLKVEKGEKILILGPSGSGKSTLIHCVNGLVPHAYKGTIRGEYSIMGRDGLSLDIFELSKLAGTVLQDSDGQFMGLSAAEDIAFAAENDCVPTPELQRRAAETAALVGMERYLSRSPQDLSGGQKQRVSMAGVLMDDVELLLFDEPLANLDPAAGMDAIELIDALHKNTGKTILIVEHRLEDVLHRAVDRVVLFDGGRIAADLSPAEMLASGLLPEAGIREPLYISALRYAGLPVTSRPESLETLSFEKSALVAWCDAAKAPRPETPPPLLEIRDLSFRYENADYGGFAGEIREGHENHEGRGHDCPETDSRRSAGGIERVSFFVGRGECMSLVGENGAGKSTLAKLICGFCRPDSGTICFNGEDLAPLTIMERAERIGYVMQNPNQMISFPMIYDEVAFGLRNRDVGEDEIRDRVYRALKVCGLYPFRNWPVSALSYGQKKRLTIAAILVLNPAFIIMDEPTAGQDYRHYTEFMEFLKKLNGEQGLSLLLITHDMHLMLEYTPRAAVFAGGKCLAVKETVEVLTDRGLIERARLKQTSLYDLALKTGVADPHLFIRRFIAHENRLRAANAASHDDGFAAPAAGDTV
Sample Types
Isolate
16.3%
Metagenome
83.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
22.0%
Kalotermitidae
14.0%
Pyralidae
5.0%
Tenebrionidae
4.0%
Rhinotermitidae
4.0%
Scarabaeidae
4.0%
Termopsidae
3.0%
Passalidae
2.0%
Apidae
2.0%
Bombycidae
2.0%
Drosophilidae
2.0%
Formicidae
2.0%
Hodotermitidae
1.0%
Blaberidae
1.0%
Hydrophilidae
1.0%
Noctuidae
1.0%
Eresidae
1.0%
Culicidae
1.0%
Curculionidae
1.0%
Elmidae
1.0%
Ocypodidae
1.0%
Taxonomy
Archaea
1
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 17 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 18 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 19 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 20 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 21 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 22 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 23 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 24 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 25 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 26 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 27 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 28 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 29 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 38 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 39 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 49 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 50 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 51 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 52 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 60 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 61 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 62 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 63 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 69 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 72 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 73 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 76 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 77 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 78 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 79 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 80 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 81 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 82 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 83 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 84 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 85 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 86 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 87 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 88 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 89 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 90 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 91 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 92 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 93 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 96 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 97 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 98 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 99 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 100 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10089234 | 3300010167 | Bacteria | 4964 |
| 2 | Ga0123353_10268879 | 3300010167 | Bacteria | 2628 |
| 3 | Ga0123353_10402005 | 3300010167 | Bacteria | 2038 |
| 4 | Ga0466705_137155 | 3300042612 | Unclassified | 4037 |
| 5 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 6 | HBC_ctgsDRAFT_1000446 | 3300000333 | Unclassified | 9341 |
| 7 | JGI24695J34938_10000009 | 3300002450 | Bacteria | 135235 |
| 8 | Ga0072940_1044681 | 3300005200 | Bacteria | 2848 |
| 9 | Ga0072941_1119663 | 3300005201 | Bacteria | 2772 |
| 10 | Ga0264413_100006 | 3300024493 | Bacteria | 5714 |
| 11 | Ga0264413_116464 | 3300024493 | Bacteria | 10590 |
| 12 | Ga0466690_050938 | 3300042590 | Bacteria | 10510 |
| 13 | Ga0466691_089239 | 3300042593 | Bacteria | 12278 |
| 14 | Ga0466696_160826 | 3300042596 | Bacteria | 4854 |
| 15 | Ga0466699_323612 | 3300042597 | Bacteria | 4988 |
| 16 | Ga0466715_419971 | 3300042616 | Bacteria | 5973 |
| 17 | Ga0466718_092740 | 3300042617 | Bacteria | 26065 |
| 18 | Ga0466723_110051 | 3300042618 | Bacteria | 8882 |
| 19 | Ga0466726_227057 | 3300042619 | Bacteria | 2983 |
| 20 | Ga0466716_176224 | 3300042605 | Bacteria | 4662 |
| 21 | Ga0466720_124760 | 3300042607 | Bacteria | 31233 |
| 22 | Ga0466731_264621 | 3300042622 | Bacteria | 3508 |
| 23 | Ga0466708_169301 | 3300042652 | Bacteria | 2414 |
| 24 | Ga0123353_10102117 | 3300010167 | Bacteria | 4622 |
| 25 | Ga0466697_161787 | 3300042611 | Bacteria | 2971 |
| 26 | Ga0466705_024691 | 3300042612 | Bacteria | 3419 |
| 27 | Ga0466733_021704 | 3300042659 | Bacteria | 11735 |
| 28 | AustNasuHG_c1000153 | 3300000089 | Bacteria | 21862 |
| 29 | JGI24698J34947_10011818 | 3300002449 | Bacteria | 4794 |
| 30 | Ga0072940_1005931 | 3300005200 | Bacteria | 28232 |
| 31 | Ga0072941_1008587 | 3300005201 | Bacteria | 6222 |
| 32 | Ga0264413_104982 | 3300024493 | Unclassified | 6520 |
| 33 | Ga0264413_106559 | 3300024493 | Bacteria | 4395 |
| 34 | Ga0264413_115727 | 3300024493 | Bacteria | 42788 |
| 35 | Ga0264413_118314 | 3300024493 | Bacteria | 3387 |
| 36 | Ga0264413_137270 | 3300024493 | Bacteria | 7971 |
| 37 | Ga0466693_276385 | 3300042592 | Bacteria | 14859 |
| 38 | Ga0466691_118764 | 3300042593 | Bacteria | 8104 |
| 39 | Ga0466712_031105 | 3300042614 | Bacteria | 6966 |
| 40 | Ga0466715_210659 | 3300042616 | Bacteria | 15065 |
| 41 | Ga0466718_022803 | 3300042617 | Bacteria | 4483 |
| 42 | Ga0466718_086242 | 3300042617 | Bacteria | 67871 |
| 43 | Ga0466718_140360 | 3300042617 | Bacteria | 11801 |
| 44 | Ga0466723_199080 | 3300042618 | Bacteria | 8348 |
| 45 | Ga0466723_247480 | 3300042618 | Bacteria | 81364 |
| 46 | Ga0466723_356060 | 3300042618 | Unclassified | 4392 |
| 47 | Ga0466716_203114 | 3300042605 | Bacteria | 6671 |
| 48 | Ga0466716_341416 | 3300042605 | Bacteria | 27694 |
| 49 | Ga0466719_524781 | 3300042606 | Bacteria | 29036 |
| 50 | Ga0466704_433507 | 3300042643 | Bacteria | 27110 |
| 51 | Ga0466708_168232 | 3300042652 | Bacteria | 3219 |
| 52 | Ga0123353_10386227 | 3300010167 | Bacteria | 2091 |
| 53 | IMNBL1DRAFT_c0023391 | 3300000062 | Bacteria | 2421 |
| 54 | CVPL010L_1000475 | 3300002932 | Unclassified | 17522 |
| 55 | Ga0072941_1014433 | 3300005201 | Bacteria | 6692 |
| 56 | Ga0074263_102130 | 3300005485 | Bacteria | 1995 |
| 57 | Ga0466690_005527 | 3300042590 | Bacteria | 5812 |
| 58 | Ga0466690_058430 | 3300042590 | Bacteria | 6675 |
| 59 | Ga0466690_082694 | 3300042590 | Bacteria | 3166 |
| 60 | Ga0466690_187650 | 3300042590 | Bacteria | 9765 |
| 61 | Ga0466690_383723 | 3300042590 | Bacteria | 2922 |
| 62 | Ga0466692_013191 | 3300042591 | Bacteria | 6343 |
| 63 | Ga0466691_058612 | 3300042593 | Bacteria | 167737 |
| 64 | Ga0466691_132344 | 3300042593 | Bacteria | 5885 |
| 65 | Ga0466691_203397 | 3300042593 | Bacteria | 4516 |
| 66 | Ga0466699_048858 | 3300042597 | Bacteria | 31462 |
| 67 | Ga0466712_002425 | 3300042614 | Unclassified | 2479 |
| 68 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 69 | Ga0466712_298328 | 3300042614 | Bacteria | 2092 |
| 70 | Ga0466711_294243 | 3300042615 | Bacteria | 4910 |
| 71 | Ga0466715_058779 | 3300042616 | Bacteria | 37907 |
| 72 | Ga0466723_225852 | 3300042618 | Bacteria | 63792 |
| 73 | Ga0466726_076007 | 3300042619 | Bacteria | 7700 |
| 74 | Ga0466726_427845 | 3300042619 | Bacteria | 2769 |
| 75 | Ga0466728_117830 | 3300042620 | Bacteria | 9706 |
| 76 | Ga0466720_155108 | 3300042607 | Unclassified | 5760 |
| 77 | Ga0466722_233946 | 3300042609 | Bacteria | 21659 |
| 78 | Ga0466722_235284 | 3300042609 | Bacteria | 7999 |
| 79 | Ga0466729_197384 | 3300042621 | Bacteria | 2863 |
| 80 | Ga0466703_125329 | 3300042636 | Bacteria | 29013 |
| 81 | Ga0466709_016367 | 3300042648 | Bacteria | 7361 |
| 82 | Ga0466709_149889 | 3300042648 | Bacteria | 8713 |
| 83 | Ga0466708_420759 | 3300042652 | Bacteria | 58319 |
| 84 | Ga0466705_011217 | 3300042612 | Bacteria | 4665 |
| 85 | Ga0466705_100638 | 3300042612 | Bacteria | 19365 |
| 86 | Ga0466733_021955 | 3300042659 | Bacteria | 13737 |
| 87 | Ga0466733_149910 | 3300042659 | Bacteria | 4587 |
| 88 | Ga0562374_0635 | 3300057007 | Unclassified | 53802 |
| 89 | 2227080776 | 2225789004 | Unclassified | 183011 |
| 90 | JGI24698J34947_10007026 | 3300002449 | Bacteria | 6188 |
| 91 | JGI24695J34938_10000212 | 3300002450 | Bacteria | 55353 |
| 92 | JGI24695J34938_10001404 | 3300002450 | Bacteria | 20578 |
| 93 | JGI24703J35330_11748067 | 3300002501 | Bacteria | 10352 |
| 94 | CVPL010L_1001473 | 3300002932 | Unclassified | 3429 |
| 95 | Ga0072941_1002917 | 3300005201 | Bacteria | 19243 |
| 96 | Ga0072941_1007444 | 3300005201 | Bacteria | 6851 |
| 97 | Ga0264413_104632 | 3300024493 | Bacteria | 2796 |
| 98 | Ga0264413_107812 | 3300024493 | Bacteria | 17404 |
| 99 | Ga0466691_067093 | 3300042593 | Bacteria | 27867 |
| 100 | Ga0466699_301769 | 3300042597 | Bacteria | 9667 |
| 101 | Ga0466715_296841 | 3300042616 | Bacteria | 2803 |
| 102 | Ga0466718_030577 | 3300042617 | Bacteria | 14715 |
| 103 | Ga0466718_090959 | 3300042617 | Bacteria | 6236 |
| 104 | Ga0466723_202451 | 3300042618 | Bacteria | 12166 |
| 105 | Ga0466726_139110 | 3300042619 | Bacteria | 9745 |
| 106 | Ga0466728_022111 | 3300042620 | Bacteria | 7109 |
| 107 | Ga0466707_093019 | 3300042601 | Bacteria | 2589 |
| 108 | Ga0466713_155845 | 3300042602 | Unclassified | 168359 |
| 109 | Ga0466716_343928 | 3300042605 | Bacteria | 4147 |
| 110 | Ga0466719_092221 | 3300042606 | Bacteria | 8565 |
| 111 | Ga0466720_012994 | 3300042607 | Bacteria | 8401 |
| 112 | Ga0466703_096549 | 3300042636 | Bacteria | 16006 |
| 113 | Ga0466703_213847 | 3300042636 | Bacteria | 8539 |
| 114 | Ga0466708_129078 | 3300042652 | Bacteria | 3910 |
| 115 | Ga0123355_10000351 | 3300009826 | Bacteria | 59711 |
| 116 | Ga0123353_10034326 | 3300010167 | Bacteria | 7916 |
| 117 | Ga0466732_208042 | 3300042656 | Bacteria | 8600 |
| 118 | 2227646880 | 2225789004 | Bacteria | 2025 |
| 119 | AustNasuHG_c1005483 | 3300000089 | Bacteria | 4533 |
| 120 | JGI24695J34938_10009471 | 3300002450 | Bacteria | 5414 |
| 121 | Ga0068305_10006722 | 3300005083 | Bacteria | 6217 |
| 122 | Ga0072940_1003463 | 3300005200 | Bacteria | 5093 |
| 123 | Ga0072941_1038753 | 3300005201 | Bacteria | 4603 |
| 124 | Ga0264413_104630 | 3300024493 | Bacteria | 21539 |
| 125 | Ga0456237_0002987 | 3300041968 | Archaea | 2750 |
| 126 | Ga0466694_026496 | 3300042594 | Bacteria | 10215 |
| 127 | Ga0466711_045896 | 3300042615 | Bacteria | 4963 |
| 128 | Ga0466715_004131 | 3300042616 | Bacteria | 27905 |
| 129 | Ga0466723_010297 | 3300042618 | Bacteria | 2681 |
| 130 | Ga0466723_367174 | 3300042618 | Bacteria | 4508 |
| 131 | Ga0466726_094004 | 3300042619 | Bacteria | 3020 |
| 132 | Ga0466700_015904 | 3300042600 | Bacteria | 2770 |
| 133 | Ga0466716_232442 | 3300042605 | Bacteria | 27481 |
| 134 | Ga0466719_115914 | 3300042606 | Bacteria | 4422 |
| 135 | Ga0466719_534421 | 3300042606 | Bacteria | 9712 |
| 136 | Ga0466720_060753 | 3300042607 | Bacteria | 13317 |
| 137 | Ga0466720_095557 | 3300042607 | Bacteria | 9381 |
| 138 | Ga0466722_182069 | 3300042609 | Bacteria | 5336 |
| 139 | Ga0466698_059652 | 3300042610 | Unclassified | 7958 |
| 140 | Ga0466729_218477 | 3300042621 | Bacteria | 1872 |
| 141 | Ga0466729_302913 | 3300042621 | Bacteria | 2672 |
| 142 | Ga0466735_042842 | 3300042624 | Bacteria | 4407 |
| 143 | Ga0466735_220687 | 3300042624 | Bacteria | 8810 |
| 144 | Ga0466702_354071 | 3300042635 | Bacteria | 21255 |
| 145 | Ga0466704_325031 | 3300042643 | Bacteria | 2580 |
| 146 | Ga0466709_077102 | 3300042648 | Bacteria | 85274 |
| 147 | Ga0466708_021027 | 3300042652 | Bacteria | 3060 |
| 148 | Ga0466708_130268 | 3300042652 | Bacteria | 12791 |
| 149 | Ga0123355_10000441 | 3300009826 | Bacteria | 54815 |
| 150 | Ga0123353_10239772 | 3300010167 | Unclassified | 2818 |
| 151 | Ga0466732_008750 | 3300042656 | Bacteria | 4117 |
| 152 | JGI24698J34947_10022868 | 3300002449 | Bacteria | 3348 |
| 153 | JGI24695J34938_10000042 | 3300002450 | Bacteria | 95222 |
| 154 | JGI24695J34938_10010792 | 3300002450 | Bacteria | 4968 |
| 155 | JGI24702J35022_10004713 | 3300002462 | Bacteria | 8076 |
| 156 | JGI24699J35502_11131491 | 3300002509 | Bacteria | 5749 |
| 157 | Ga0072941_1003453 | 3300005201 | Bacteria | 10168 |
| 158 | Ga0072941_1025985 | 3300005201 | Bacteria | 17479 |
| 159 | Ga0466691_201570 | 3300042593 | Bacteria | 4016 |
| 160 | Ga0466699_325566 | 3300042597 | Bacteria | 17873 |
| 161 | Ga0466705_449620 | 3300042612 | Bacteria | 3769 |
| 162 | Ga0466712_195148 | 3300042614 | Bacteria | 34102 |
| 163 | Ga0466715_510456 | 3300042616 | Bacteria | 4048 |
| 164 | Ga0466715_534731 | 3300042616 | Bacteria | 6629 |
| 165 | Ga0466718_042663 | 3300042617 | Bacteria | 1965 |
| 166 | Ga0466728_274274 | 3300042620 | Bacteria | 22423 |
| 167 | Ga0466729_140423 | 3300042621 | Bacteria | 5806 |
| 168 | Ga0466716_009745 | 3300042605 | Bacteria | 2327 |
| 169 | Ga0466716_111671 | 3300042605 | Bacteria | 3249 |
| 170 | Ga0466719_033626 | 3300042606 | Bacteria | 45932 |
| 171 | Ga0466719_328193 | 3300042606 | Bacteria | 5469 |
| 172 | Ga0466703_150682 | 3300042636 | Bacteria | 44505 |
| 173 | Ga0466709_086341 | 3300042648 | Bacteria | 317133 |
| 174 | Ga0466727_136602 | 3300042655 | Bacteria | 7996 |
| 175 | Ga0466732_116734 | 3300042656 | Bacteria | 4751 |
| 176 | Ga0562375_0058 | 3300056856 | Bacteria | 444736 |
| 177 | 2227635718 | 2225789004 | Unclassified | 11247 |
| 178 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 179 | JGI24695J34938_10000317 | 3300002450 | Bacteria | 47269 |
| 180 | Ga0264413_101916 | 3300024493 | Bacteria | 12554 |
| 181 | Ga0466690_095247 | 3300042590 | Bacteria | 3290 |
| 182 | Ga0466692_157647 | 3300042591 | Bacteria | 35780 |
| 183 | Ga0466696_155253 | 3300042596 | Bacteria | 19714 |
| 184 | Ga0466696_205181 | 3300042596 | Bacteria | 5064 |
| 185 | Ga0466699_443634 | 3300042597 | Bacteria | 28955 |
| 186 | Ga0466712_028589 | 3300042614 | Bacteria | 2807 |
| 187 | Ga0466712_259879 | 3300042614 | Bacteria | 13634 |
| 188 | Ga0466711_440263 | 3300042615 | Bacteria | 4374 |
| 189 | Ga0466715_285090 | 3300042616 | Bacteria | 12088 |
| 190 | Ga0466718_059207 | 3300042617 | Bacteria | 5097 |
| 191 | Ga0466718_064942 | 3300042617 | Bacteria | 3894 |
| 192 | Ga0466723_072326 | 3300042618 | Bacteria | 29079 |
| 193 | Ga0466728_370765 | 3300042620 | Bacteria | 7459 |
| 194 | Ga0466716_224521 | 3300042605 | Bacteria | 3150 |
| 195 | Ga0466716_407272 | 3300042605 | Bacteria | 6127 |
| 196 | Ga0466719_035069 | 3300042606 | Bacteria | 14650 |
| 197 | Ga0466719_110192 | 3300042606 | Bacteria | 7789 |
| 198 | Ga0466719_379308 | 3300042606 | Bacteria | 31120 |
| 199 | Ga0466720_022378 | 3300042607 | Bacteria | 4741 |
| 200 | Ga0466720_160476 | 3300042607 | Bacteria | 12645 |
| 201 | Ga0466722_238036 | 3300042609 | Bacteria | 3136 |
| 202 | Ga0466732_350791 | 3300042656 | Bacteria | 2846 |
| 203 | Ga0466733_136445 | 3300042659 | Bacteria | 3837 |
| 204 | Ga0562377_0111 | 3300056842 | Bacteria | 260589 |
| 205 | 2230969617 | 2228664004 | Bacteria | 10160 |
| 206 | AustNasuHG_c1024297 | 3300000089 | Bacteria | 1922 |
| 207 | JGI24698J34947_10012304 | 3300002449 | Bacteria | 4690 |
| 208 | JGI24700J35501_10930145 | 3300002508 | Bacteria | 11699 |
| 209 | Ga0063521_1000504 | 3300003973 | Bacteria | 18162 |
| 210 | Ga0072941_1005800 | 3300005201 | Bacteria | 35925 |
| 211 | Ga0264413_110111 | 3300024493 | Bacteria | 5600 |
| 212 | Ga0466690_133639 | 3300042590 | Bacteria | 48450 |
| 213 | Ga0466691_010897 | 3300042593 | Bacteria | 19539 |
| 214 | Ga0466691_200520 | 3300042593 | Bacteria | 4822 |
| 215 | Ga0466699_258354 | 3300042597 | Bacteria | 5387 |
| 216 | Ga0466723_146995 | 3300042618 | Bacteria | 13213 |
| 217 | Ga0466706_217296 | 3300042599 | Bacteria | 30204 |
| 218 | Ga0466719_498156 | 3300042606 | Bacteria | 69594 |
| 219 | Ga0466720_044669 | 3300042607 | Bacteria | 23520 |
| 220 | Ga0466722_092688 | 3300042609 | Bacteria | 8912 |
| 221 | Ga0466735_147008 | 3300042624 | Bacteria | 3514 |
| 222 | Ga0466704_495073 | 3300042643 | Bacteria | 3501 |
| 223 | Ga0466709_104383 | 3300042648 | Bacteria | 21621 |
| 224 | Ga0466709_398741 | 3300042648 | Bacteria | 4675 |
| 225 | Ga0466708_098623 | 3300042652 | Bacteria | 3480 |
| 226 | Ga0466708_466292 | 3300042652 | Bacteria | 3381 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.