Protein Family IF07047

Metagenome Isolate
270 Members
104 Samples
226 Scaffolds
573.05 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_024691|Ga0466705_024691_899_2761
Length
613 aa
Sequence
MNHPVLEFKHFSFQYRSQTEPTLKDISLKVEKGEKILILGPSGSGKSTLIHCVNGLVPHAYKGTIRGEYSIMGRDGLSLDIFELSKLAGTVLQDSDGQFMGLSAAEDIAFAAENDCVPTPELQRRAAETAALVGMERYLSRSPQDLSGGQKQRVSMAGVLMDDVELLLFDEPLANLDPAAGMDAIELIDALHKNTGKTILIVEHRLEDVLHRAVDRVVLFDGGRIAADLSPAEMLASGLLPEAGIREPLYISALRYAGLPVTSRPESLETLSFEKSALVAWCDAAKAPRPETPPPLLEIRDLSFRYENADYGGFAGEIREGHENHEGRGHDCPETDSRRSAGGIERVSFFVGRGECMSLVGENGAGKSTLAKLICGFCRPDSGTICFNGEDLAPLTIMERAERIGYVMQNPNQMISFPMIYDEVAFGLRNRDVGEDEIRDRVYRALKVCGLYPFRNWPVSALSYGQKKRLTIAAILVLNPAFIIMDEPTAGQDYRHYTEFMEFLKKLNGEQGLSLLLITHDMHLMLEYTPRAAVFAGGKCLAVKETVEVLTDRGLIERARLKQTSLYDLALKTGVADPHLFIRRFIAHENRLRAANAASHDDGFAAPAAGDTV

πŸ“Š Sample Types

Isolate 16.3%
Metagenome 83.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.0%
Unclassified 22.0%
Kalotermitidae 14.0%
Pyralidae 5.0%
Tenebrionidae 4.0%
Rhinotermitidae 4.0%
Scarabaeidae 4.0%
Termopsidae 3.0%
Passalidae 2.0%
Apidae 2.0%
Bombycidae 2.0%
Drosophilidae 2.0%
Formicidae 2.0%
Hodotermitidae 1.0%
Blaberidae 1.0%
Hydrophilidae 1.0%
Noctuidae 1.0%
Eresidae 1.0%
Culicidae 1.0%
Curculionidae 1.0%
Elmidae 1.0%
Ocypodidae 1.0%

🌳 Taxonomy

Archaea 1
Bacteria 255
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 2772190975 Treponema sp. RmG30 Isolate Blaberidae
17 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
18 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
19 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
20 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
21 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
22 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
23 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
24 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
25 650716102 Treponema primitia ZAS-2 Isolate Unclassified
26 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
27 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
28 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
29 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
36 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
37 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
38 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
39 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
46 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
48 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
49 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
50 8022725327 Bacillus sp. SN10 Isolate Eresidae
51 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
52 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
57 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
58 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
59 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
60 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
61 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
62 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
63 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
64 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
65 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
66 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
69 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
71 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
72 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
73 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
74 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
75 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
76 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
77 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
78 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
79 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
80 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
81 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
82 2978778678 Bacillus cereus 25 Isolate Ocypodidae
83 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
84 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
85 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
86 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
87 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
88 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
89 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
90 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
91 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
92 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
93 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
94 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
95 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
96 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
97 2537562000 Bacillus cereus HD73 Isolate Pyralidae
98 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
99 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
100 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
101 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
102 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
103 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
104 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10089234 3300010167 Bacteria 4964
2 Ga0123353_10268879 3300010167 Bacteria 2628
3 Ga0123353_10402005 3300010167 Bacteria 2038
4 Ga0466705_137155 3300042612 Unclassified 4037
5 Ga0562379_0069 3300056790 Bacteria 430601
6 HBC_ctgsDRAFT_1000446 3300000333 Unclassified 9341
7 JGI24695J34938_10000009 3300002450 Bacteria 135235
8 Ga0072940_1044681 3300005200 Bacteria 2848
9 Ga0072941_1119663 3300005201 Bacteria 2772
10 Ga0264413_100006 3300024493 Bacteria 5714
11 Ga0264413_116464 3300024493 Bacteria 10590
12 Ga0466690_050938 3300042590 Bacteria 10510
13 Ga0466691_089239 3300042593 Bacteria 12278
14 Ga0466696_160826 3300042596 Bacteria 4854
15 Ga0466699_323612 3300042597 Bacteria 4988
16 Ga0466715_419971 3300042616 Bacteria 5973
17 Ga0466718_092740 3300042617 Bacteria 26065
18 Ga0466723_110051 3300042618 Bacteria 8882
19 Ga0466726_227057 3300042619 Bacteria 2983
20 Ga0466716_176224 3300042605 Bacteria 4662
21 Ga0466720_124760 3300042607 Bacteria 31233
22 Ga0466731_264621 3300042622 Bacteria 3508
23 Ga0466708_169301 3300042652 Bacteria 2414
24 Ga0123353_10102117 3300010167 Bacteria 4622
25 Ga0466697_161787 3300042611 Bacteria 2971
26 Ga0466705_024691 3300042612 Bacteria 3419
27 Ga0466733_021704 3300042659 Bacteria 11735
28 AustNasuHG_c1000153 3300000089 Bacteria 21862
29 JGI24698J34947_10011818 3300002449 Bacteria 4794
30 Ga0072940_1005931 3300005200 Bacteria 28232
31 Ga0072941_1008587 3300005201 Bacteria 6222
32 Ga0264413_104982 3300024493 Unclassified 6520
33 Ga0264413_106559 3300024493 Bacteria 4395
34 Ga0264413_115727 3300024493 Bacteria 42788
35 Ga0264413_118314 3300024493 Bacteria 3387
36 Ga0264413_137270 3300024493 Bacteria 7971
37 Ga0466693_276385 3300042592 Bacteria 14859
38 Ga0466691_118764 3300042593 Bacteria 8104
39 Ga0466712_031105 3300042614 Bacteria 6966
40 Ga0466715_210659 3300042616 Bacteria 15065
41 Ga0466718_022803 3300042617 Bacteria 4483
42 Ga0466718_086242 3300042617 Bacteria 67871
43 Ga0466718_140360 3300042617 Bacteria 11801
44 Ga0466723_199080 3300042618 Bacteria 8348
45 Ga0466723_247480 3300042618 Bacteria 81364
46 Ga0466723_356060 3300042618 Unclassified 4392
47 Ga0466716_203114 3300042605 Bacteria 6671
48 Ga0466716_341416 3300042605 Bacteria 27694
49 Ga0466719_524781 3300042606 Bacteria 29036
50 Ga0466704_433507 3300042643 Bacteria 27110
51 Ga0466708_168232 3300042652 Bacteria 3219
52 Ga0123353_10386227 3300010167 Bacteria 2091
53 IMNBL1DRAFT_c0023391 3300000062 Bacteria 2421
54 CVPL010L_1000475 3300002932 Unclassified 17522
55 Ga0072941_1014433 3300005201 Bacteria 6692
56 Ga0074263_102130 3300005485 Bacteria 1995
57 Ga0466690_005527 3300042590 Bacteria 5812
58 Ga0466690_058430 3300042590 Bacteria 6675
59 Ga0466690_082694 3300042590 Bacteria 3166
60 Ga0466690_187650 3300042590 Bacteria 9765
61 Ga0466690_383723 3300042590 Bacteria 2922
62 Ga0466692_013191 3300042591 Bacteria 6343
63 Ga0466691_058612 3300042593 Bacteria 167737
64 Ga0466691_132344 3300042593 Bacteria 5885
65 Ga0466691_203397 3300042593 Bacteria 4516
66 Ga0466699_048858 3300042597 Bacteria 31462
67 Ga0466712_002425 3300042614 Unclassified 2479
68 Ga0466712_192768 3300042614 Bacteria 48341
69 Ga0466712_298328 3300042614 Bacteria 2092
70 Ga0466711_294243 3300042615 Bacteria 4910
71 Ga0466715_058779 3300042616 Bacteria 37907
72 Ga0466723_225852 3300042618 Bacteria 63792
73 Ga0466726_076007 3300042619 Bacteria 7700
74 Ga0466726_427845 3300042619 Bacteria 2769
75 Ga0466728_117830 3300042620 Bacteria 9706
76 Ga0466720_155108 3300042607 Unclassified 5760
77 Ga0466722_233946 3300042609 Bacteria 21659
78 Ga0466722_235284 3300042609 Bacteria 7999
79 Ga0466729_197384 3300042621 Bacteria 2863
80 Ga0466703_125329 3300042636 Bacteria 29013
81 Ga0466709_016367 3300042648 Bacteria 7361
82 Ga0466709_149889 3300042648 Bacteria 8713
83 Ga0466708_420759 3300042652 Bacteria 58319
84 Ga0466705_011217 3300042612 Bacteria 4665
85 Ga0466705_100638 3300042612 Bacteria 19365
86 Ga0466733_021955 3300042659 Bacteria 13737
87 Ga0466733_149910 3300042659 Bacteria 4587
88 Ga0562374_0635 3300057007 Unclassified 53802
89 2227080776 2225789004 Unclassified 183011
90 JGI24698J34947_10007026 3300002449 Bacteria 6188
91 JGI24695J34938_10000212 3300002450 Bacteria 55353
92 JGI24695J34938_10001404 3300002450 Bacteria 20578
93 JGI24703J35330_11748067 3300002501 Bacteria 10352
94 CVPL010L_1001473 3300002932 Unclassified 3429
95 Ga0072941_1002917 3300005201 Bacteria 19243
96 Ga0072941_1007444 3300005201 Bacteria 6851
97 Ga0264413_104632 3300024493 Bacteria 2796
98 Ga0264413_107812 3300024493 Bacteria 17404
99 Ga0466691_067093 3300042593 Bacteria 27867
100 Ga0466699_301769 3300042597 Bacteria 9667
101 Ga0466715_296841 3300042616 Bacteria 2803
102 Ga0466718_030577 3300042617 Bacteria 14715
103 Ga0466718_090959 3300042617 Bacteria 6236
104 Ga0466723_202451 3300042618 Bacteria 12166
105 Ga0466726_139110 3300042619 Bacteria 9745
106 Ga0466728_022111 3300042620 Bacteria 7109
107 Ga0466707_093019 3300042601 Bacteria 2589
108 Ga0466713_155845 3300042602 Unclassified 168359
109 Ga0466716_343928 3300042605 Bacteria 4147
110 Ga0466719_092221 3300042606 Bacteria 8565
111 Ga0466720_012994 3300042607 Bacteria 8401
112 Ga0466703_096549 3300042636 Bacteria 16006
113 Ga0466703_213847 3300042636 Bacteria 8539
114 Ga0466708_129078 3300042652 Bacteria 3910
115 Ga0123355_10000351 3300009826 Bacteria 59711
116 Ga0123353_10034326 3300010167 Bacteria 7916
117 Ga0466732_208042 3300042656 Bacteria 8600
118 2227646880 2225789004 Bacteria 2025
119 AustNasuHG_c1005483 3300000089 Bacteria 4533
120 JGI24695J34938_10009471 3300002450 Bacteria 5414
121 Ga0068305_10006722 3300005083 Bacteria 6217
122 Ga0072940_1003463 3300005200 Bacteria 5093
123 Ga0072941_1038753 3300005201 Bacteria 4603
124 Ga0264413_104630 3300024493 Bacteria 21539
125 Ga0456237_0002987 3300041968 Archaea 2750
126 Ga0466694_026496 3300042594 Bacteria 10215
127 Ga0466711_045896 3300042615 Bacteria 4963
128 Ga0466715_004131 3300042616 Bacteria 27905
129 Ga0466723_010297 3300042618 Bacteria 2681
130 Ga0466723_367174 3300042618 Bacteria 4508
131 Ga0466726_094004 3300042619 Bacteria 3020
132 Ga0466700_015904 3300042600 Bacteria 2770
133 Ga0466716_232442 3300042605 Bacteria 27481
134 Ga0466719_115914 3300042606 Bacteria 4422
135 Ga0466719_534421 3300042606 Bacteria 9712
136 Ga0466720_060753 3300042607 Bacteria 13317
137 Ga0466720_095557 3300042607 Bacteria 9381
138 Ga0466722_182069 3300042609 Bacteria 5336
139 Ga0466698_059652 3300042610 Unclassified 7958
140 Ga0466729_218477 3300042621 Bacteria 1872
141 Ga0466729_302913 3300042621 Bacteria 2672
142 Ga0466735_042842 3300042624 Bacteria 4407
143 Ga0466735_220687 3300042624 Bacteria 8810
144 Ga0466702_354071 3300042635 Bacteria 21255
145 Ga0466704_325031 3300042643 Bacteria 2580
146 Ga0466709_077102 3300042648 Bacteria 85274
147 Ga0466708_021027 3300042652 Bacteria 3060
148 Ga0466708_130268 3300042652 Bacteria 12791
149 Ga0123355_10000441 3300009826 Bacteria 54815
150 Ga0123353_10239772 3300010167 Unclassified 2818
151 Ga0466732_008750 3300042656 Bacteria 4117
152 JGI24698J34947_10022868 3300002449 Bacteria 3348
153 JGI24695J34938_10000042 3300002450 Bacteria 95222
154 JGI24695J34938_10010792 3300002450 Bacteria 4968
155 JGI24702J35022_10004713 3300002462 Bacteria 8076
156 JGI24699J35502_11131491 3300002509 Bacteria 5749
157 Ga0072941_1003453 3300005201 Bacteria 10168
158 Ga0072941_1025985 3300005201 Bacteria 17479
159 Ga0466691_201570 3300042593 Bacteria 4016
160 Ga0466699_325566 3300042597 Bacteria 17873
161 Ga0466705_449620 3300042612 Bacteria 3769
162 Ga0466712_195148 3300042614 Bacteria 34102
163 Ga0466715_510456 3300042616 Bacteria 4048
164 Ga0466715_534731 3300042616 Bacteria 6629
165 Ga0466718_042663 3300042617 Bacteria 1965
166 Ga0466728_274274 3300042620 Bacteria 22423
167 Ga0466729_140423 3300042621 Bacteria 5806
168 Ga0466716_009745 3300042605 Bacteria 2327
169 Ga0466716_111671 3300042605 Bacteria 3249
170 Ga0466719_033626 3300042606 Bacteria 45932
171 Ga0466719_328193 3300042606 Bacteria 5469
172 Ga0466703_150682 3300042636 Bacteria 44505
173 Ga0466709_086341 3300042648 Bacteria 317133
174 Ga0466727_136602 3300042655 Bacteria 7996
175 Ga0466732_116734 3300042656 Bacteria 4751
176 Ga0562375_0058 3300056856 Bacteria 444736
177 2227635718 2225789004 Unclassified 11247
178 JGI24695J34938_10000043 3300002450 Bacteria 94696
179 JGI24695J34938_10000317 3300002450 Bacteria 47269
180 Ga0264413_101916 3300024493 Bacteria 12554
181 Ga0466690_095247 3300042590 Bacteria 3290
182 Ga0466692_157647 3300042591 Bacteria 35780
183 Ga0466696_155253 3300042596 Bacteria 19714
184 Ga0466696_205181 3300042596 Bacteria 5064
185 Ga0466699_443634 3300042597 Bacteria 28955
186 Ga0466712_028589 3300042614 Bacteria 2807
187 Ga0466712_259879 3300042614 Bacteria 13634
188 Ga0466711_440263 3300042615 Bacteria 4374
189 Ga0466715_285090 3300042616 Bacteria 12088
190 Ga0466718_059207 3300042617 Bacteria 5097
191 Ga0466718_064942 3300042617 Bacteria 3894
192 Ga0466723_072326 3300042618 Bacteria 29079
193 Ga0466728_370765 3300042620 Bacteria 7459
194 Ga0466716_224521 3300042605 Bacteria 3150
195 Ga0466716_407272 3300042605 Bacteria 6127
196 Ga0466719_035069 3300042606 Bacteria 14650
197 Ga0466719_110192 3300042606 Bacteria 7789
198 Ga0466719_379308 3300042606 Bacteria 31120
199 Ga0466720_022378 3300042607 Bacteria 4741
200 Ga0466720_160476 3300042607 Bacteria 12645
201 Ga0466722_238036 3300042609 Bacteria 3136
202 Ga0466732_350791 3300042656 Bacteria 2846
203 Ga0466733_136445 3300042659 Bacteria 3837
204 Ga0562377_0111 3300056842 Bacteria 260589
205 2230969617 2228664004 Bacteria 10160
206 AustNasuHG_c1024297 3300000089 Bacteria 1922
207 JGI24698J34947_10012304 3300002449 Bacteria 4690
208 JGI24700J35501_10930145 3300002508 Bacteria 11699
209 Ga0063521_1000504 3300003973 Bacteria 18162
210 Ga0072941_1005800 3300005201 Bacteria 35925
211 Ga0264413_110111 3300024493 Bacteria 5600
212 Ga0466690_133639 3300042590 Bacteria 48450
213 Ga0466691_010897 3300042593 Bacteria 19539
214 Ga0466691_200520 3300042593 Bacteria 4822
215 Ga0466699_258354 3300042597 Bacteria 5387
216 Ga0466723_146995 3300042618 Bacteria 13213
217 Ga0466706_217296 3300042599 Bacteria 30204
218 Ga0466719_498156 3300042606 Bacteria 69594
219 Ga0466720_044669 3300042607 Bacteria 23520
220 Ga0466722_092688 3300042609 Bacteria 8912
221 Ga0466735_147008 3300042624 Bacteria 3514
222 Ga0466704_495073 3300042643 Bacteria 3501
223 Ga0466709_104383 3300042648 Bacteria 21621
224 Ga0466709_398741 3300042648 Bacteria 4675
225 Ga0466708_098623 3300042652 Bacteria 3480
226 Ga0466708_466292 3300042652 Bacteria 3381

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 345 490 0.94
PF12558 DUF3744 ATP-binding cassette cobalt transporter 238 304 0.91

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.