Protein Family IF06232

Metagenome Metatranscriptome Isolate
595 Members
163 Samples
515 Scaffolds
179.37 Avg Length

🧬 Representative Sequence

ID
3300042603|Ga0466714_155853|Ga0466714_155853_2083_2679
Length
198 aa
Sequence
MWAAKFWRLSGKKGGQKTMSRIGRKPIVIPAGVEVKLEGNHVTVKGPKGTLDSTIHPLMKLEMKDGEVVVSRPNDEKEARSLHGLSRTLVANMVQGVSEGFKKELEIQGIGYRAQKQGTNLVLNLGFSHPVTVAEKDGITIDVPEPTKIIVNGIDKQRVGQFAAEIREKRPPEPYKGKGIRYVGEFVIRKEGKAGKTG

πŸ“Š Sample Types

Isolate 13.4%
Metagenome 85.9%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 43.9%
Termitidae 24.2%
Kalotermitidae 8.9%
Culicidae 3.2%
Passalidae 2.5%
Tenebrionidae 2.5%
Formicidae 2.5%
Rhinotermitidae 1.9%
Termopsidae 1.9%
Scarabaeidae 1.3%
Cambaridae 1.3%
Armadillidiidae 1.3%
Curculionidae 1.3%
Blaberidae 0.6%
Pyrrhocoridae 0.6%
Bombycidae 0.6%
Elmidae 0.6%
Hodotermitidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 570
Eukaryota 0
Viruses 0
Unclassified 25

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
2 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
3 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
4 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
5 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
6 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
7 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
8 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
9 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
10 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
11 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
12 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
13 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
14 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
15 637000338 Wigglesworthia glossinidia Isolate Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
24 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
25 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
26 2772190975 Treponema sp. RmG30 Isolate Blaberidae
27 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
28 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
29 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
30 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
31 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
32 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
33 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
34 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
35 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
36 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
39 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
40 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
41 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
42 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
43 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
44 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
45 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
46 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
47 2820438595 Unclassified Firmicutes Lab288P3bin208 Isolate Unclassified
48 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
49 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
56 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
57 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
58 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
59 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
60 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
61 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
62 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
63 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
64 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
65 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
66 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
67 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
68 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
69 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
70 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
71 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
72 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
73 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
74 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
77 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
78 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
79 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
80 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
81 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
82 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
83 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
84 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
85 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
86 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
87 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
88 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
89 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
90 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
91 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
92 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
93 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
96 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
97 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
98 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
99 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
100 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
101 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
102 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
103 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
104 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
105 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
106 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
107 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
108 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
109 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
110 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
111 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
112 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
113 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
114 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
115 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
116 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
117 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
118 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
119 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
120 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
121 2870004507 Campylobacter coli 14983A Isolate Unclassified
122 2505679068 Isoptericola variabilis 225 Isolate Unclassified
123 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
124 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
125 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
126 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
127 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
128 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
129 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
130 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
131 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
132 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
133 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
134 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
135 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
136 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
137 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
138 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
139 2504756063 Isoptericola variabilis J5 Isolate Unclassified
140 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
141 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
142 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
143 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
144 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
145 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
146 2627854132 Campylobacter peloridis LMG 23910 Isolate Unclassified
147 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
148 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
149 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
150 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
151 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
152 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
153 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
154 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
155 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
156 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
157 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
158 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
159 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
160 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
161 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
162 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
163 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_109754 3300042659 Bacteria 1588
2 Ga0466733_115357 3300042659 Unclassified 1112
3 Ga0562379_0467 3300056790 Bacteria 83349
4 Ga0466735_031147 3300042624 Bacteria 3947
5 Ga0466735_190889 3300042624 Bacteria 3333
6 Ga0466730_095014 3300042625 Bacteria 15821
7 Ga0466704_346468 3300042643 Bacteria 13169
8 Ga0466727_012250 3300042655 Bacteria 1153
9 Ga0466705_457924 3300042612 Bacteria 1298
10 Ga0466715_155843 3300042616 Bacteria 19455
11 Ga0466723_039429 3300042618 Bacteria 22952
12 Ga0466723_109525 3300042618 Bacteria 5276
13 Ga0160443_100129 3300012848 Bacteria 114665
14 Ga0415639_027249 3300038395 Bacteria 5198
15 Ga0415639_063320 3300038395 Bacteria 4134
16 Ga0466656_153477 3300042550 Bacteria 2161
17 Ga0466693_065027 3300042592 Bacteria 1816
18 Ga0466693_272362 3300042592 Bacteria 2658
19 Ga0466693_360700 3300042592 Bacteria 1298
20 Ga0466691_012570 3300042593 Bacteria 32910
21 Ga0466691_119000 3300042593 Bacteria 13204
22 Ga0466699_091220 3300042597 Bacteria 2120
23 Ga0466706_084654 3300042599 Bacteria 1969
24 Ga0466706_092349 3300042599 Bacteria 42995
25 Ga0466706_149623 3300042599 Bacteria 1232
26 Ga0466706_169463 3300042599 Bacteria 1237
27 Ga0466706_235111 3300042599 Bacteria 2746
28 Ga0466706_289574 3300042599 Bacteria 68094
29 Ga0466700_316608 3300042600 Bacteria 72668
30 Ga0466707_105801 3300042601 Bacteria 10427
31 Ga0466707_166123 3300042601 Bacteria 25982
32 Ga0466717_061301 3300042604 Unclassified 1434
33 Ga0466719_122065 3300042606 Bacteria 2063
34 Ga0466719_232882 3300042606 Bacteria 2580
35 Ga0123355_10058379 3300009826 Bacteria 6241
36 Ga0123355_10070039 3300009826 Bacteria 5635
37 Ga0123355_10099263 3300009826 Bacteria 4589
38 Ga0123355_10102118 3300009826 Bacteria 4511
39 Ga0123355_10227787 3300009826 Bacteria 2668
40 Ga0123355_10334653 3300009826 Bacteria 2024
41 Ga0123355_10508621 3300009826 Bacteria 1481
42 Ga0123355_10560404 3300009826 Bacteria 1377
43 Ga0123355_10635116 3300009826 Bacteria 1253
44 Ga0123355_10902584 3300009826 Bacteria 960
45 Ga0123355_11626515 3300009826 Bacteria 620
46 Ga0123356_10002442 3300010049 Bacteria 19870
47 Ga0123356_10025696 3300010049 Bacteria 5535
48 Ga0123356_10072003 3300010049 Bacteria 3246
49 Ga0123356_10237775 3300010049 Bacteria 1890
50 Ga0123356_10247212 3300010049 Bacteria 1859
51 Ga0123356_10620139 3300010049 Bacteria 1247
52 Ga0123356_10886781 3300010049 Bacteria 1063
53 Ga0123356_12761547 3300010049 Bacteria 615
54 Ga0123353_10000953 3300010167 Bacteria 35371
55 Ga0123353_10002541 3300010167 Bacteria 22666
56 Ga0123353_10016767 3300010167 Bacteria 10724
57 Ga0123353_10082925 3300010167 Bacteria 5158
58 Ga0123353_10287559 3300010167 Bacteria 2519
59 Ga0123353_10321817 3300010167 Bacteria 2347
60 Ga0123353_10373849 3300010167 Bacteria 2135
61 Ga0123353_10570555 3300010167 Bacteria 1626
62 Ga0123353_10778948 3300010167 Bacteria 1325
63 Ga0123353_11032535 3300010167 Bacteria 1100
64 Ga0160466_103506 3300012809 Bacteria 2548
65 2227567972 2225789004 Bacteria 2647
66 IMNBGM34_c001285 3300000036 Bacteria 4534
67 IMNBL1DRAFT_c0006063 3300000062 Bacteria 6721
68 IMNBL1DRAFT_c0036520 3300000062 Bacteria 1715
69 JGI24703J35330_11504723 3300002501 Bacteria 1125
70 JGI24703J35330_11748856 3300002501 Bacteria 55836
71 JGI24696J40584_12959935 3300002834 Bacteria 5928
72 Ga0063521_1000130 3300003973 Bacteria 58438
73 Ga0068305_10001103 3300005083 Bacteria 12271
74 Ga0068305_10005402 3300005083 Bacteria 29409
75 Ga0068305_10170174 3300005083 Bacteria 1631
76 Ga0068305_10419915 3300005083 Bacteria 1088
77 Ga0466705_261073 3300042612 Bacteria 35670
78 Ga0466732_127839 3300042656 Bacteria 4125
79 Ga0466733_000594 3300042659 Bacteria 1091
80 Ga0466703_087274 3300042636 Bacteria 28228
81 Ga0466703_201498 3300042636 Bacteria 15773
82 Ga0466703_242967 3300042636 Bacteria 1345
83 Ga0466703_329120 3300042636 Bacteria 3231
84 Ga0466709_073711 3300042648 Bacteria 17631
85 Ga0466705_488645 3300042612 Bacteria 3156
86 Ga0466711_327783 3300042615 Bacteria 14489
87 Ga0415639_001377 3300038395 Bacteria 23349
88 Ga0415639_006405 3300038395 Bacteria 33378
89 Ga0415639_007670 3300038395 Bacteria 6074
90 Ga0415639_019174 3300038395 Bacteria 27021
91 Ga0415639_087124 3300038395 Bacteria 1506
92 Ga0415639_157168 3300038395 Bacteria 2150
93 Ga0415639_169179 3300038395 Bacteria 2149
94 Ga0466690_217090 3300042590 Bacteria 43815
95 Ga0466693_451080 3300042592 Unclassified 1102
96 Ga0466691_022586 3300042593 Bacteria 3689
97 Ga0466706_155040 3300042599 Bacteria 1350
98 Ga0466706_162915 3300042599 Bacteria 17654
99 Ga0466706_224831 3300042599 Bacteria 1320
100 Ga0466714_132243 3300042603 Bacteria 1436
101 Ga0466717_173494 3300042604 Bacteria 1253
102 Ga0466716_073340 3300042605 Bacteria 35717
103 Ga0466719_419354 3300042606 Bacteria 1454
104 Ga0466721_214094 3300042608 Bacteria 7290
105 Ga0466721_215054 3300042608 Bacteria 1553
106 Ga0466698_410208 3300042610 Bacteria 7587
107 Ga0123357_10051227 3300009784 Bacteria 5582
108 Ga0123357_10270487 3300009784 Bacteria 1777
109 Ga0123357_10528436 3300009784 Bacteria 958
110 Ga0123355_10005165 3300009826 Bacteria 19051
111 Ga0123355_10021397 3300009826 Bacteria 10348
112 Ga0123355_10033096 3300009826 Bacteria 8393
113 Ga0123355_10213218 3300009826 Bacteria 2794
114 Ga0123355_10429326 3300009826 Bacteria 1682
115 Ga0123355_10574793 3300009826 Bacteria 1350
116 Ga0123355_11132218 3300009826 Bacteria 809
117 Ga0123355_11304236 3300009826 Bacteria 728
118 Ga0123355_11550357 3300009826 Unclassified 642
119 Ga0123356_10008505 3300010049 Bacteria 10199
120 Ga0123356_10017936 3300010049 Bacteria 6724
121 Ga0123356_10033329 3300010049 Bacteria 4816
122 Ga0123356_10212962 3300010049 Bacteria 1983
123 Ga0123356_10684656 3300010049 Bacteria 1194
124 Ga0123356_10905798 3300010049 Bacteria 1053
125 Ga0123356_11079359 3300010049 Bacteria 972
126 Ga0123356_11259651 3300010049 Bacteria 904
127 Ga0123353_10182946 3300010167 Bacteria 3316
128 Ga0123353_10280075 3300010167 Bacteria 2562
129 Ga0123353_10282878 3300010167 Bacteria 2546
130 Ga0123353_10390562 3300010167 Bacteria 2076
131 Ga0123353_10575884 3300010167 Bacteria 1617
132 Ga0123353_10735856 3300010167 Bacteria 1376
133 Ga0123353_11586969 3300010167 Bacteria 827
134 Ga0123353_12106717 3300010167 Unclassified 686
135 Ga0160442_103635 3300012806 Unclassified 1604
136 2227673786 2225789004 Bacteria 1883
137 IMNBL1DRAFT_c0003704 3300000062 Bacteria 9614
138 AustNasuHG_c1020243 3300000089 Bacteria 2170
139 JGI24702J35022_10811768 3300002462 Bacteria 583
140 JGI24703J35330_11363676 3300002501 Bacteria 916
141 Ga0102739_1003195 3300007095 Bacteria 4757
142 Ga0466705_177763 3300042612 Bacteria 16760
143 Ga0466705_206656 3300042612 Bacteria 3350
144 Ga0466705_245289 3300042612 Bacteria 1421
145 Ga0562375_0569 3300056856 Bacteria 72979
146 Ga0466703_119167 3300042636 Bacteria 6121
147 Ga0466703_168474 3300042636 Bacteria 32420
148 Ga0466704_228596 3300042643 Bacteria 8799
149 Ga0466704_379737 3300042643 Bacteria 1453
150 Ga0466708_266283 3300042652 Bacteria 3970
151 Ga0466715_054330 3300042616 Bacteria 75121
152 Ga0466718_066412 3300042617 Unclassified 1568
153 Ga0466723_109597 3300042618 Bacteria 5291
154 Ga0466726_048826 3300042619 Bacteria 24055
155 Ga0466726_253058 3300042619 Bacteria 2160
156 Ga0466728_355242 3300042620 Bacteria 6745
157 Ga0160452_100013 3300012834 Bacteria 343612
158 Ga0160446_100137 3300012835 Bacteria 61486
159 Ga0160436_1000191 3300012861 Bacteria 30420
160 Ga0415639_007671 3300038395 Bacteria 5926
161 Ga0415639_193428 3300038395 Bacteria 1124
162 Ga0466657_172156 3300042582 Bacteria 1252
163 Ga0466692_026254 3300042591 Bacteria 97091
164 Ga0466694_309496 3300042594 Unclassified 1247
165 Ga0466696_332397 3300042596 Bacteria 2489
166 Ga0466706_022513 3300042599 Bacteria 1179
167 Ga0466706_044711 3300042599 Unclassified 1184
168 Ga0466706_061118 3300042599 Bacteria 1926
169 Ga0466706_118553 3300042599 Bacteria 1124
170 Ga0466706_127591 3300042599 Bacteria 41152
171 Ga0466706_180108 3300042599 Bacteria 3649
172 Ga0466700_020706 3300042600 Bacteria 4241
173 Ga0466700_298647 3300042600 Bacteria 1909
174 Ga0466713_069636 3300042602 Bacteria 98037
175 Ga0466714_087938 3300042603 Bacteria 5091
176 Ga0466714_150400 3300042603 Bacteria 1966
177 Ga0466714_155853 3300042603 Bacteria 2762
178 Ga0123355_10120306 3300009826 Bacteria 4076
179 Ga0123355_10172040 3300009826 Bacteria 3234
180 Ga0123355_10487432 3300009826 Bacteria 1529
181 Ga0123356_10003243 3300010049 Bacteria 17093
182 Ga0123356_10016700 3300010049 Bacteria 7000
183 Ga0123356_10380681 3300010049 Bacteria 1544
184 Ga0123356_10639242 3300010049 Bacteria 1231
185 Ga0123356_10776958 3300010049 Bacteria 1128
186 Ga0123356_10990450 3300010049 Bacteria 1011
187 Ga0123356_11303327 3300010049 Bacteria 889
188 Ga0123356_12207630 3300010049 Unclassified 688
189 Ga0123356_12844344 3300010049 Bacteria 605
190 Ga0123353_10000033 3300010167 Bacteria 150421
191 Ga0123353_10572032 3300010167 Bacteria 1624
192 Ga0123353_10732387 3300010167 Bacteria 1380
193 Ga0123353_10811464 3300010167 Unclassified 1290
194 2226997028 2225789003 Bacteria 6627
195 2227036242 2225789003 Bacteria 884
196 2227108032 2225789004 Unclassified 1758
197 2227472027 2225789004 Bacteria 916
198 IMNBL1DRAFT_c0000426 3300000062 Bacteria 35421
199 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
200 JGI24695J34938_10010594 3300002450 Bacteria 5034
201 JGI24703J35330_11694795 3300002501 Bacteria 1949
202 JGI24703J35330_11727925 3300002501 Bacteria 2604
203 JGI24703J35330_11744081 3300002501 Bacteria 4077
204 JGI24697J35500_11270675 3300002507 Bacteria 4279
205 JGI24700J35501_10930786 3300002508 Bacteria 23988
206 Ga0072941_1096920 3300005201 Bacteria 13635
207 Ga0072941_1213253 3300005201 Bacteria 5781
208 Ga0072941_1256115 3300005201 Bacteria 4681
209 Ga0466705_061533 3300042612 Bacteria 25186
210 Ga0466733_005750 3300042659 Bacteria 6291
211 Ga0466733_199333 3300042659 Bacteria 3804
212 Ga0562375_0695 3300056856 Bacteria 60611
213 Ga0466735_017980 3300042624 Bacteria 22301
214 Ga0466730_051131 3300042625 Bacteria 3250
215 Ga0466724_08551 3300042649 Bacteria 1195
216 Ga0466705_399902 3300042612 Bacteria 1414
217 Ga0466711_438122 3300042615 Bacteria 22096
218 Ga0466715_584084 3300042616 Bacteria 48896
219 Ga0466726_065605 3300042619 Bacteria 46464
220 Ga0466728_127136 3300042620 Bacteria 23734
221 Ga0160441_108129 3300012825 Bacteria 1376
222 Ga0160444_105485 3300012841 Bacteria 1683
223 Ga0160435_1007622 3300012857 Bacteria 2355
224 Ga0255808_1015762 3300023282 Bacteria 3377
225 Ga0415639_021883 3300038395 Bacteria 1354
226 Ga0415639_065900 3300038395 Bacteria 3879
227 Ga0415639_228562 3300038395 Bacteria 1283
228 Ga0466693_228579 3300042592 Bacteria 1590
229 Ga0466691_069681 3300042593 Bacteria 15515
230 Ga0466696_034315 3300042596 Bacteria 6224
231 Ga0466696_296201 3300042596 Bacteria 26567
232 Ga0466706_000167 3300042599 Bacteria 1624
233 Ga0466706_050672 3300042599 Bacteria 1533
234 Ga0466706_113164 3300042599 Bacteria 25442
235 Ga0466706_114505 3300042599 Bacteria 5975
236 Ga0466706_122671 3300042599 Bacteria 5198
237 Ga0466706_162982 3300042599 Bacteria 6957
238 Ga0466707_101126 3300042601 Bacteria 3782
239 Ga0466707_282184 3300042601 Bacteria 7703
240 Ga0466714_047124 3300042603 Bacteria 1322
241 Ga0466719_114464 3300042606 Bacteria 2183
242 Ga0466721_378896 3300042608 Bacteria 2494
243 Ga0123355_10043402 3300009826 Bacteria 7314
244 Ga0123355_10220453 3300009826 Bacteria 2729
245 Ga0123355_10405647 3300009826 Bacteria 1754
246 Ga0123355_10469421 3300009826 Bacteria 1573
247 Ga0123355_10537644 3300009826 Bacteria 1420
248 Ga0123355_11211943 3300009826 Unclassified 769
249 Ga0123356_10042931 3300010049 Bacteria 4211
250 Ga0123356_10088610 3300010049 Bacteria 2943
251 Ga0123356_10250557 3300010049 Bacteria 1848
252 Ga0123356_10258184 3300010049 Unclassified 1825
253 Ga0123356_10293234 3300010049 Bacteria 1728
254 Ga0123356_10876798 3300010049 Bacteria 1069
255 Ga0123356_10983280 3300010049 Bacteria 1014
256 Ga0123353_10008423 3300010167 Bacteria 14077
257 Ga0123353_10013104 3300010167 Bacteria 11852
258 Ga0123353_10077752 3300010167 Bacteria 5332
259 Ga0123353_10107291 3300010167 Bacteria 4500
260 Ga0123353_10170331 3300010167 Bacteria 3457
261 Ga0123353_10172692 3300010167 Bacteria 3430
262 Ga0123353_10577017 3300010167 Bacteria 1615
263 Ga0123353_10597307 3300010167 Bacteria 1578
264 Ga0123353_10763739 3300010167 Bacteria 1343
265 Ga0123353_10783540 3300010167 Bacteria 1320
266 Ga0123353_10794338 3300010167 Bacteria 1308
267 Ga0123353_11014366 3300010167 Unclassified 1113
268 Ga0123353_11053078 3300010167 Bacteria 1086
269 Ga0123353_11118126 3300010167 Bacteria 1044
270 Ga0123353_11414460 3300010167 Bacteria 893
271 Ga0123353_11481863 3300010167 Bacteria 866
272 Ga0160442_100131 3300012806 Unclassified 75763
273 IMNBL1DRAFT_c0001208 3300000062 Bacteria 19538
274 IMNBL1DRAFT_c0001977 3300000062 Bacteria 14765
275 JGI24702J35022_10014808 3300002462 Bacteria 4298
276 JGI24703J35330_11727959 3300002501 Bacteria 2605
277 JGI24705J35276_11756801 3300002504 Bacteria 660
278 Ga0068305_10069777 3300005083 Bacteria 5154
279 Ga0103266_1033610 3300007067 Unclassified 651
280 Ga0466705_332532 3300042612 Bacteria 16839
281 Ga0466733_163369 3300042659 Bacteria 3150
282 Ga0466733_191383 3300042659 Bacteria 1512
283 Ga0562376_2795 3300056857 Bacteria 19515
284 Ga0466703_133753 3300042636 Bacteria 110740
285 Ga0466703_190061 3300042636 Bacteria 90552
286 Ga0466703_242629 3300042636 Bacteria 92300
287 Ga0466703_431757 3300042636 Bacteria 1584
288 Ga0466725_394541 3300042654 Bacteria 1292
289 Ga0466705_527281 3300042612 Bacteria 8721
290 Ga0466715_136901 3300042616 Bacteria 27299
291 Ga0466718_052301 3300042617 Bacteria 1292
292 Ga0466726_005210 3300042619 Bacteria 1044
293 Ga0466726_123696 3300042619 Bacteria 24670
294 Ga0415639_001326 3300038395 Bacteria 2665
295 Ga0415639_002004 3300038395 Bacteria 58965
296 Ga0415639_006876 3300038395 Bacteria 1654
297 Ga0415639_009883 3300038395 Bacteria 16360
298 Ga0415639_034615 3300038395 Bacteria 2694
299 Ga0415639_089737 3300038395 Bacteria 1174
300 Ga0466693_269558 3300042592 Bacteria 1891
301 Ga0466696_130344 3300042596 Bacteria 6870
302 Ga0466696_498562 3300042596 Bacteria 15998
303 Ga0466706_124512 3300042599 Bacteria 3616
304 Ga0466706_138418 3300042599 Bacteria 1302
305 Ga0466706_166070 3300042599 Bacteria 1184
306 Ga0466706_273779 3300042599 Bacteria 3344
307 Ga0466706_283731 3300042599 Bacteria 2286
308 Ga0466706_287781 3300042599 Bacteria 8076
309 Ga0466707_262676 3300042601 Bacteria 90434
310 Ga0466713_030677 3300042602 Bacteria 10350
311 Ga0466719_373723 3300042606 Bacteria 19766
312 Ga0123355_10001028 3300009826 Bacteria 38728
313 Ga0123355_10002506 3300009826 Bacteria 26020
314 Ga0123355_10012755 3300009826 Bacteria 13033
315 Ga0123355_10086165 3300009826 Bacteria 4996
316 Ga0123355_10290095 3300009826 Bacteria 2246
317 Ga0123355_10929750 3300009826 Bacteria 938
318 Ga0123355_11377200 3300009826 Bacteria 700
319 Ga0123355_11651222 3300009826 Bacteria 614
320 Ga0123356_10019796 3300010049 Bacteria 6377
321 Ga0123356_10036140 3300010049 Bacteria 4613
322 Ga0123356_10040801 3300010049 Bacteria 4324
323 Ga0123356_10045451 3300010049 Bacteria 4086
324 Ga0123356_10292471 3300010049 Bacteria 1730
325 Ga0123356_10350437 3300010049 Bacteria 1600
326 Ga0123356_10470351 3300010049 Bacteria 1408
327 Ga0123356_10521549 3300010049 Bacteria 1346
328 Ga0123356_10692809 3300010049 Bacteria 1187
329 Ga0123356_10723110 3300010049 Bacteria 1165
330 Ga0123356_10802182 3300010049 Bacteria 1112
331 Ga0123356_11122758 3300010049 Unclassified 954
332 Ga0123356_11162227 3300010049 Bacteria 939
333 Ga0123356_11863222 3300010049 Bacteria 748
334 Ga0123356_12306072 3300010049 Bacteria 673
335 Ga0123353_10000031 3300010167 Bacteria 160211
336 Ga0123353_10047420 3300010167 Bacteria 6833
337 Ga0123353_10191569 3300010167 Bacteria 3227
338 Ga0123353_10198186 3300010167 Bacteria 3162
339 Ga0123353_10366664 3300010167 Bacteria 2162
340 Ga0123353_10755246 3300010167 Bacteria 1353
341 Ga0123353_10984650 3300010167 Bacteria 1135
342 Ga0123353_11192840 3300010167 Bacteria 1000
343 Ga0123353_12044620 3300010167 Bacteria 700
344 2227505172 2225789004 Bacteria 19004
345 IMNBL1DRAFT_c0007107 3300000062 Bacteria 5957
346 AustNasuHG_c1053297 3300000089 Bacteria 842
347 JGI24700J35501_10930659 3300002508 Bacteria 17918
348 Ga0466733_060902 3300042659 Bacteria 1228
349 Ga0466729_287045 3300042621 Bacteria 99069
350 Ga0466702_309926 3300042635 Bacteria 1062
351 Ga0466703_045237 3300042636 Bacteria 14386
352 Ga0466703_367488 3300042636 Bacteria 27459
353 Ga0466727_028322 3300042655 Bacteria 2578
354 Ga0466715_607672 3300042616 Bacteria 1151
355 Ga0255786_1004183 3300022815 Bacteria 1230
356 Ga0255808_1000340 3300023282 Bacteria 3082
357 Ga0415639_023602 3300038395 Bacteria 2859
358 Ga0415639_032583 3300038395 Bacteria 11909
359 Ga0415639_124672 3300038395 Bacteria 1744
360 Ga0466696_101973 3300042596 Bacteria 12513
361 Ga0466696_234960 3300042596 Bacteria 1149
362 Ga0466706_025946 3300042599 Bacteria 1259
363 Ga0466706_067390 3300042599 Bacteria 55994
364 Ga0466706_243946 3300042599 Bacteria 3362
365 Ga0466706_269670 3300042599 Bacteria 79639
366 Ga0466707_243360 3300042601 Bacteria 29608
367 Ga0466713_025156 3300042602 Bacteria 41607
368 Ga0466714_031796 3300042603 Bacteria 18454
369 Ga0466717_097266 3300042604 Bacteria 1091
370 Ga0466716_461378 3300042605 Bacteria 25031
371 Ga0466719_022180 3300042606 Bacteria 1693
372 Ga0466721_100978 3300042608 Bacteria 228571
373 Ga0466722_118770 3300042609 Bacteria 1518
374 Ga0123357_10076529 3300009784 Bacteria 4418
375 Ga0123357_10555423 3300009784 Bacteria 912
376 Ga0123355_10004431 3300009826 Bacteria 20424
377 Ga0123355_10182636 3300009826 Bacteria 3110
378 Ga0123355_10197141 3300009826 Bacteria 2950
379 Ga0123355_10202595 3300009826 Bacteria 2895
380 Ga0123355_10345735 3300009826 Bacteria 1976
381 Ga0123355_10547456 3300009826 Bacteria 1401
382 Ga0123356_10000099 3300010049 Bacteria 91944
383 Ga0123356_10000134 3300010049 Bacteria 82554
384 Ga0123356_10001659 3300010049 Bacteria 24354
385 Ga0123356_10029856 3300010049 Bacteria 5103
386 Ga0123356_10253524 3300010049 Bacteria 1839
387 Ga0123356_10256484 3300010049 Bacteria 1830
388 Ga0123356_10257967 3300010049 Bacteria 1825
389 Ga0123356_11346638 3300010049 Bacteria 876
390 Ga0123356_11690185 3300010049 Bacteria 785
391 Ga0123353_10000294 3300010167 Bacteria 62045
392 Ga0123353_10023187 3300010167 Bacteria 9391
393 Ga0123353_10031998 3300010167 Bacteria 8162
394 Ga0123353_10379552 3300010167 Bacteria 2114
395 Ga0123353_10526670 3300010167 Bacteria 1713
396 Ga0123353_10858854 3300010167 Bacteria 1242
397 Ga0123353_11260640 3300010167 Bacteria 964
398 Ga0123353_12452188 3300010167 Bacteria 622
399 Ga0123354_10382344 3300010882 Bacteria 1214
400 IMNBL1DRAFT_c0029155 3300000062 Bacteria 2047
401 JGI24703J35330_11747241 3300002501 Bacteria 6393
402 Ga0466733_187962 3300042659 Bacteria 2740
403 Ga0466735_101638 3300042624 Bacteria 9016
404 Ga0466702_005882 3300042635 Bacteria 3137
405 Ga0466704_568506 3300042643 Bacteria 8658
406 Ga0466726_283461 3300042619 Bacteria 23794
407 Ga0415639_002310 3300038395 Bacteria 154573
408 Ga0466693_003440 3300042592 Unclassified 1582
409 Ga0466693_010874 3300042592 Bacteria 2739
410 Ga0466706_223170 3300042599 Bacteria 11130
411 Ga0466706_284824 3300042599 Bacteria 3250
412 Ga0466707_041118 3300042601 Bacteria 16787
413 Ga0466707_113611 3300042601 Bacteria 15317
414 Ga0466707_304242 3300042601 Bacteria 14355
415 Ga0466713_129245 3300042602 Bacteria 6492
416 Ga0466714_005312 3300042603 Bacteria 30939
417 Ga0466714_034189 3300042603 Bacteria 4534
418 Ga0466714_084117 3300042603 Bacteria 18481
419 Ga0466714_156164 3300042603 Bacteria 1894
420 Ga0466716_003820 3300042605 Bacteria 11944
421 Ga0123355_10024702 3300009826 Bacteria 9662
422 Ga0123355_10119448 3300009826 Bacteria 4093
423 Ga0123355_10231742 3300009826 Bacteria 2636
424 Ga0123355_10248718 3300009826 Bacteria 2507
425 Ga0123355_10407786 3300009826 Bacteria 1747
426 Ga0123355_10466966 3300009826 Bacteria 1580
427 Ga0123355_11060064 3300009826 Bacteria 850
428 Ga0123356_10000163 3300010049 Bacteria 75104
429 Ga0123356_10005526 3300010049 Bacteria 12858
430 Ga0123356_10029457 3300010049 Bacteria 5142
431 Ga0123356_10049968 3300010049 Bacteria 3893
432 Ga0123356_10057710 3300010049 Bacteria 3619
433 Ga0123356_10110889 3300010049 Bacteria 2650
434 Ga0123356_10178608 3300010049 Bacteria 2142
435 Ga0123356_10367818 3300010049 Bacteria 1567
436 Ga0123356_10586286 3300010049 Bacteria 1279
437 Ga0123356_10754810 3300010049 Bacteria 1143
438 Ga0123356_10892131 3300010049 Bacteria 1060
439 Ga0123356_11026803 3300010049 Bacteria 994
440 Ga0123356_11039339 3300010049 Unclassified 989
441 Ga0123356_11432347 3300010049 Bacteria 850
442 Ga0123356_11555947 3300010049 Bacteria 817
443 Ga0123356_11742826 3300010049 Bacteria 773
444 Ga0123356_12188492 3300010049 Bacteria 691
445 Ga0123353_10436240 3300010167 Bacteria 1934
446 Ga0123353_10614586 3300010167 Bacteria 1549
447 Ga0123353_11724421 3300010167 Bacteria 783
448 Ga0160466_103006 3300012809 Unclassified 2983
449 2227191914 2225789004 Bacteria 33932
450 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
451 IMNBL1DRAFT_c0011912 3300000062 Bacteria 4020
452 JGI24703J35330_11744780 3300002501 Bacteria 4305
453 JGI24703J35330_11748852 3300002501 Bacteria 50255
454 Ga0103266_1006960 3300007067 Bacteria 1821
455 Ga0466705_146538 3300042612 Bacteria 158344
456 Ga0466733_203277 3300042659 Bacteria 1238
457 Ga0562377_0007 3300056842 Bacteria 3019242
458 Ga0466731_120251 3300042622 Bacteria 7300
459 Ga0466731_221564 3300042622 Bacteria 1137
460 Ga0466735_191417 3300042624 Bacteria 1188
461 Ga0466724_29714 3300042649 Bacteria 2760
462 Ga0466718_165631 3300042617 Bacteria 8067
463 Ga0466723_091380 3300042618 Bacteria 18639
464 Ga0466726_033233 3300042619 Bacteria 2617
465 Ga0466726_480207 3300042619 Bacteria 1149
466 Ga0160453_105651 3300012814 Bacteria 1983
467 Ga0160444_100021 3300012841 Bacteria 297202
468 Ga0160434_104451 3300012850 Bacteria 2336
469 Ga0223688_1044049 3300021227 Unclassified 1312
470 Ga0415639_007672 3300038395 Bacteria 13622
471 Ga0466696_462270 3300042596 Bacteria 6201
472 Ga0466706_011655 3300042599 Bacteria 14589
473 Ga0466706_018089 3300042599 Bacteria 6597
474 Ga0466706_097864 3300042599 Bacteria 1701
475 Ga0466706_100462 3300042599 Bacteria 36169
476 Ga0466706_167495 3300042599 Bacteria 3140
477 Ga0466706_233327 3300042599 Bacteria 1799
478 Ga0466707_254889 3300042601 Bacteria 95649
479 Ga0466714_065397 3300042603 Bacteria 1392
480 Ga0466719_460231 3300042606 Bacteria 12329
481 Ga0466721_015423 3300042608 Bacteria 14106
482 Ga0466722_033664 3300042609 Bacteria 51377
483 Ga0123355_10000406 3300009826 Bacteria 56165
484 Ga0123355_10000555 3300009826 Bacteria 50033
485 Ga0123355_10170170 3300009826 Bacteria 3258
486 Ga0123355_10197850 3300009826 Bacteria 2943
487 Ga0123355_10398601 3300009826 Bacteria 1777
488 Ga0123355_10486988 3300009826 Unclassified 1530
489 Ga0123355_10787913 3300009826 Bacteria 1064
490 Ga0123355_11074793 3300009826 Bacteria 841
491 Ga0123355_11560896 3300009826 Bacteria 639
492 Ga0123356_10007671 3300010049 Bacteria 10751
493 Ga0123356_10102607 3300010049 Bacteria 2746
494 Ga0123356_10202226 3300010049 Bacteria 2027
495 Ga0123356_10418605 3300010049 Bacteria 1481
496 Ga0123356_10435819 3300010049 Bacteria 1456
497 Ga0123356_10742440 3300010049 Bacteria 1151
498 Ga0123356_11042295 3300010049 Unclassified 987
499 Ga0123353_10003404 3300010167 Bacteria 20101
500 Ga0123353_10013340 3300010167 Bacteria 11766
501 Ga0123353_10255404 3300010167 Bacteria 2711
502 Ga0123353_10692382 3300010167 Bacteria 1433
503 Ga0123353_11204144 3300010167 Bacteria 994
504 Ga0123354_10370511 3300010882 Bacteria 1250
505 Ga0123354_10562040 3300010882 Unclassified 854
506 2227494078 2225789004 Bacteria 20130
507 IMNBL1DRAFT_c0034350 3300000062 Bacteria 1806
508 IMNBL1DRAFT_c0041732 3300000062 Bacteria 1537
509 JGI24695J34938_10046570 3300002450 Bacteria 1919
510 JGI24702J35022_10012949 3300002462 Bacteria 4627
511 JGI24703J35330_11722146 3300002501 Bacteria 2421
512 JGI24696J40584_12955393 3300002834 Bacteria 2825
513 Ga0072940_1181246 3300005200 Bacteria 1763
514 Ga0072940_1200226 3300005200 Bacteria 1186
515 Ga0103265_1001139 3300007068 Bacteria 4351

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00347 Ribosomal_L6 Ribosomal protein L6 109 182 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.