Protein Family IF05876
Metagenome
Isolate
278
Members
75
Samples
252
Scaffolds
255.11
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_183671|Ga0466707_183671_156_1001
- Length
- 281 aa
- Sequence
- LRPRIGASLFVVQGIGLFLYFYVNEYVMASNTIKILVSQPKPTTEKSPYYDIAEKYGVQIDFRPFIKVEPVNAKDFRTQRVNILEHTAIIFTAKTAIDHFFRLAEELRIQIPEAMKYFCVTEAIAVYLQKYIVYRKRKIFYPASGKLEDIMIPIMKHSKESYLIPVSDVHKDDLFHLLDSKKVHYTVATMYRTVSNDFEPGEKFDYNVLLFFSPAGIASLSKNFPNFEQNGIAIGTFGPTTAKAVRDAGLRLDIEAPNPEAPSMAAALENYLKSLPKPGKK
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
28.8%
Termitidae
26.0%
Kalotermitidae
19.2%
Unclassified
9.6%
Rhinotermitidae
6.8%
Termopsidae
4.1%
Passalidae
2.7%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
267
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 2 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 3 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 15 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 16 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 23 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 24 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 43 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 46 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 47 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 51 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 57 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 58 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 59 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 60 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 61 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 62 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 63 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 64 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 65 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 66 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 67 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 73 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_297173 | 3300042612 | Bacteria | 2689 |
| 2 | Ga0466701_057459 | 3300042598 | Bacteria | 1015 |
| 3 | Ga0466707_138833 | 3300042601 | Bacteria | 17828 |
| 4 | Ga0466714_152207 | 3300042603 | Bacteria | 9889 |
| 5 | Ga0466722_044045 | 3300042609 | Bacteria | 8319 |
| 6 | Ga0466711_255161 | 3300042615 | Bacteria | 3314 |
| 7 | Ga0466715_044248 | 3300042616 | Bacteria | 6568 |
| 8 | Ga0466715_414350 | 3300042616 | Bacteria | 2631 |
| 9 | Ga0466723_277530 | 3300042618 | Bacteria | 7073 |
| 10 | Ga0466728_131061 | 3300042620 | Bacteria | 7370 |
| 11 | Ga0466729_176658 | 3300042621 | Bacteria | 1240 |
| 12 | Ga0123355_10846898 | 3300009826 | Bacteria | 1007 |
| 13 | Ga0123354_10190001 | 3300010882 | Bacteria | 2304 |
| 14 | Ga0466735_016303 | 3300042624 | Bacteria | 4636 |
| 15 | Ga0466735_072470 | 3300042624 | Bacteria | 2297 |
| 16 | Ga0466735_111587 | 3300042624 | Bacteria | 4321 |
| 17 | Ga0466703_259966 | 3300042636 | Bacteria | 4384 |
| 18 | Ga0466704_119741 | 3300042643 | Bacteria | 23128 |
| 19 | Ga0466704_119946 | 3300042643 | Bacteria | 27786 |
| 20 | Ga0466704_205014 | 3300042643 | Bacteria | 47651 |
| 21 | Ga0466704_298510 | 3300042643 | Bacteria | 23069 |
| 22 | Ga0466708_223269 | 3300042652 | Bacteria | 26840 |
| 23 | Ga0265387_1004099 | 3300024582 | Bacteria | 1993 |
| 24 | Ga0466692_202144 | 3300042591 | Bacteria | 41419 |
| 25 | Ga0466691_180393 | 3300042593 | Bacteria | 2279 |
| 26 | Ga0466696_009215 | 3300042596 | Bacteria | 2290 |
| 27 | Ga0466696_082914 | 3300042596 | Bacteria | 4205 |
| 28 | Ga0466696_112038 | 3300042596 | Bacteria | 14110 |
| 29 | Ga0466696_364826 | 3300042596 | Bacteria | 5810 |
| 30 | IMNBL1DRAFT_c0000182 | 3300000062 | Bacteria | 55861 |
| 31 | JGI24702J35022_10244569 | 3300002462 | Bacteria | 1042 |
| 32 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 33 | Ga0123357_10000554 | 3300009784 | Bacteria | 36811 |
| 34 | Ga0466706_171585 | 3300042599 | Bacteria | 6790 |
| 35 | Ga0466700_221856 | 3300042600 | Bacteria | 29613 |
| 36 | Ga0466707_041511 | 3300042601 | Bacteria | 16200 |
| 37 | Ga0466713_036673 | 3300042602 | Bacteria | 4121 |
| 38 | Ga0466713_082209 | 3300042602 | Bacteria | 3229 |
| 39 | Ga0466717_258573 | 3300042604 | Bacteria | 2009 |
| 40 | Ga0466719_254571 | 3300042606 | Bacteria | 8091 |
| 41 | Ga0466722_022649 | 3300042609 | Bacteria | 4195 |
| 42 | Ga0466711_049718 | 3300042615 | Bacteria | 3632 |
| 43 | Ga0466715_149795 | 3300042616 | Bacteria | 34010 |
| 44 | Ga0466715_197418 | 3300042616 | Unclassified | 2191 |
| 45 | Ga0466723_031451 | 3300042618 | Bacteria | 2942 |
| 46 | Ga0466726_090534 | 3300042619 | Bacteria | 4531 |
| 47 | Ga0466728_140662 | 3300042620 | Bacteria | 1632 |
| 48 | Ga0466729_031103 | 3300042621 | Bacteria | 19143 |
| 49 | Ga0466729_104992 | 3300042621 | Bacteria | 2868 |
| 50 | Ga0123354_10063345 | 3300010882 | Bacteria | 5435 |
| 51 | Ga0466735_134697 | 3300042624 | Bacteria | 1858 |
| 52 | Ga0466735_161439 | 3300042624 | Bacteria | 2677 |
| 53 | Ga0466703_231116 | 3300042636 | Bacteria | 1818 |
| 54 | Ga0466704_099652 | 3300042643 | Unclassified | 3961 |
| 55 | Ga0466704_219800 | 3300042643 | Bacteria | 10108 |
| 56 | Ga0466704_407394 | 3300042643 | Bacteria | 14777 |
| 57 | Ga0466704_477179 | 3300042643 | Bacteria | 3817 |
| 58 | Ga0466709_173632 | 3300042648 | Bacteria | 10860 |
| 59 | Ga0466708_033765 | 3300042652 | Bacteria | 16704 |
| 60 | Ga0466708_121014 | 3300042652 | Bacteria | 4877 |
| 61 | Ga0466708_227789 | 3300042652 | Bacteria | 7941 |
| 62 | Ga0466727_259735 | 3300042655 | Bacteria | 15797 |
| 63 | Ga0466691_140130 | 3300042593 | Bacteria | 13322 |
| 64 | 2227491301 | 2225789004 | Bacteria | 20480 |
| 65 | 2227608538 | 2225789004 | Bacteria | 2278 |
| 66 | IMNBL1DRAFT_c0024155 | 3300000062 | Bacteria | 2363 |
| 67 | JGI24702J35022_10119151 | 3300002462 | Bacteria | 1457 |
| 68 | Ga0068305_10138257 | 3300005083 | Bacteria | 4785 |
| 69 | Ga0068305_10166569 | 3300005083 | Unclassified | 3556 |
| 70 | Ga0466705_059575 | 3300042612 | Bacteria | 12605 |
| 71 | Ga0466705_105641 | 3300042612 | Bacteria | 10247 |
| 72 | Ga0466700_494393 | 3300042600 | Bacteria | 7228 |
| 73 | Ga0466707_046720 | 3300042601 | Bacteria | 7083 |
| 74 | Ga0466722_197078 | 3300042609 | Bacteria | 10013 |
| 75 | Ga0466711_145802 | 3300042615 | Bacteria | 19674 |
| 76 | Ga0466711_214095 | 3300042615 | Bacteria | 12354 |
| 77 | Ga0466711_442449 | 3300042615 | Bacteria | 3688 |
| 78 | Ga0466715_139672 | 3300042616 | Bacteria | 8201 |
| 79 | Ga0466715_514383 | 3300042616 | Bacteria | 8478 |
| 80 | Ga0466723_074859 | 3300042618 | Bacteria | 49235 |
| 81 | Ga0466735_157428 | 3300042624 | Unclassified | 1032 |
| 82 | Ga0466703_078906 | 3300042636 | Bacteria | 15811 |
| 83 | Ga0466703_106189 | 3300042636 | Bacteria | 5580 |
| 84 | Ga0466703_373777 | 3300042636 | Bacteria | 1483 |
| 85 | Ga0466704_298670 | 3300042643 | Unclassified | 5765 |
| 86 | Ga0466704_529313 | 3300042643 | Bacteria | 4252 |
| 87 | Ga0466704_530476 | 3300042643 | Bacteria | 5635 |
| 88 | Ga0466725_120083 | 3300042654 | Bacteria | 15942 |
| 89 | Ga0466727_156731 | 3300042655 | Bacteria | 3908 |
| 90 | Ga0466656_258963 | 3300042550 | Bacteria | 11916 |
| 91 | Ga0466656_315520 | 3300042550 | Bacteria | 3162 |
| 92 | Ga0466690_010726 | 3300042590 | Bacteria | 14810 |
| 93 | Ga0466690_242016 | 3300042590 | Bacteria | 6738 |
| 94 | Ga0466691_014102 | 3300042593 | Unclassified | 3961 |
| 95 | Ga0466691_149507 | 3300042593 | Bacteria | 14341 |
| 96 | JGI24702J35022_10038918 | 3300002462 | Bacteria | 2538 |
| 97 | JGI24702J35022_10060158 | 3300002462 | Bacteria | 2030 |
| 98 | Ga0466705_067864 | 3300042612 | Bacteria | 9496 |
| 99 | Ga0466706_055989 | 3300042599 | Bacteria | 8594 |
| 100 | Ga0466713_026512 | 3300042602 | Bacteria | 8351 |
| 101 | Ga0466713_049042 | 3300042602 | Bacteria | 18614 |
| 102 | Ga0466713_112236 | 3300042602 | Bacteria | 47338 |
| 103 | Ga0466716_038510 | 3300042605 | Bacteria | 24976 |
| 104 | Ga0466716_339746 | 3300042605 | Bacteria | 5291 |
| 105 | Ga0466705_496961 | 3300042612 | Bacteria | 5234 |
| 106 | Ga0466711_278244 | 3300042615 | Bacteria | 5526 |
| 107 | Ga0466711_302376 | 3300042615 | Bacteria | 10330 |
| 108 | Ga0466715_290449 | 3300042616 | Bacteria | 7168 |
| 109 | Ga0466723_230208 | 3300042618 | Bacteria | 14199 |
| 110 | Ga0466728_268835 | 3300042620 | Bacteria | 15369 |
| 111 | Ga0123357_10066720 | 3300009784 | Bacteria | 4797 |
| 112 | Ga0123354_10045984 | 3300010882 | Bacteria | 6674 |
| 113 | Ga0123354_10260530 | 3300010882 | Bacteria | 1733 |
| 114 | Ga0466734_056913 | 3300042623 | Bacteria | 1805 |
| 115 | Ga0466703_281590 | 3300042636 | Unclassified | 5964 |
| 116 | Ga0466703_298468 | 3300042636 | Bacteria | 7799 |
| 117 | Ga0466704_029806 | 3300042643 | Unclassified | 4385 |
| 118 | Ga0466704_248895 | 3300042643 | Bacteria | 8694 |
| 119 | Ga0466709_115133 | 3300042648 | Bacteria | 48629 |
| 120 | Ga0466727_059815 | 3300042655 | Bacteria | 1011 |
| 121 | Ga0466727_308522 | 3300042655 | Bacteria | 3621 |
| 122 | Ga0456237_0000007 | 3300041968 | Bacteria | 61435 |
| 123 | Ga0466690_107941 | 3300042590 | Bacteria | 9527 |
| 124 | Ga0466692_145824 | 3300042591 | Bacteria | 2837 |
| 125 | Ga0466693_013074 | 3300042592 | Bacteria | 1681 |
| 126 | Ga0466696_209598 | 3300042596 | Bacteria | 2620 |
| 127 | 2227439692 | 2225789004 | Bacteria | 1026 |
| 128 | 2227671828 | 2225789004 | Bacteria | 10163 |
| 129 | JGI24702J35022_10002928 | 3300002462 | Bacteria | 10331 |
| 130 | JGI24702J35022_10020828 | 3300002462 | Bacteria | 3557 |
| 131 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 132 | Ga0466705_195315 | 3300042612 | Bacteria | 7555 |
| 133 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 134 | Ga0466701_092879 | 3300042598 | Bacteria | 8782 |
| 135 | Ga0466707_116168 | 3300042601 | Bacteria | 14479 |
| 136 | Ga0466716_095541 | 3300042605 | Bacteria | 62772 |
| 137 | Ga0466716_366835 | 3300042605 | Bacteria | 7247 |
| 138 | Ga0466710_068270 | 3300042613 | Bacteria | 1196 |
| 139 | Ga0466711_355606 | 3300042615 | Bacteria | 7060 |
| 140 | Ga0466715_264145 | 3300042616 | Bacteria | 7349 |
| 141 | Ga0466723_286703 | 3300042618 | Bacteria | 3017 |
| 142 | Ga0123357_10054731 | 3300009784 | Bacteria | 5377 |
| 143 | Ga0123353_10083451 | 3300010167 | Bacteria | 5141 |
| 144 | Ga0123353_10104593 | 3300010167 | Bacteria | 4562 |
| 145 | Ga0123354_10032330 | 3300010882 | Bacteria | 8201 |
| 146 | Ga0123354_10178892 | 3300010882 | Unclassified | 2431 |
| 147 | Ga0466734_161756 | 3300042623 | Bacteria | 1228 |
| 148 | Ga0466735_104710 | 3300042624 | Bacteria | 1089 |
| 149 | Ga0466703_190989 | 3300042636 | Bacteria | 9074 |
| 150 | Ga0466703_246726 | 3300042636 | Bacteria | 23563 |
| 151 | Ga0466704_070099 | 3300042643 | Bacteria | 12192 |
| 152 | Ga0466704_093332 | 3300042643 | Bacteria | 14211 |
| 153 | Ga0466704_188158 | 3300042643 | Bacteria | 12672 |
| 154 | Ga0466704_253673 | 3300042643 | Bacteria | 27128 |
| 155 | Ga0466708_240562 | 3300042652 | Bacteria | 5635 |
| 156 | Ga0466727_190172 | 3300042655 | Bacteria | 2684 |
| 157 | Ga0466692_025411 | 3300042591 | Bacteria | 8755 |
| 158 | Ga0466696_028078 | 3300042596 | Bacteria | 1417 |
| 159 | Ga0466696_191055 | 3300042596 | Bacteria | 25014 |
| 160 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 161 | IMNBL1DRAFT_c0003216 | 3300000062 | Bacteria | 10680 |
| 162 | IMNBL1DRAFT_c0003326 | 3300000062 | Bacteria | 10436 |
| 163 | IMNBL1DRAFT_c0013632 | 3300000062 | Bacteria | 3633 |
| 164 | IMNBL1DRAFT_c0015180 | 3300000062 | Bacteria | 3352 |
| 165 | JGI24702J35022_10000687 | 3300002462 | Bacteria | 20622 |
| 166 | Ga0466705_128984 | 3300042612 | Bacteria | 5733 |
| 167 | Ga0466707_167629 | 3300042601 | Bacteria | 52999 |
| 168 | Ga0466714_167661 | 3300042603 | Bacteria | 2279 |
| 169 | Ga0466716_139041 | 3300042605 | Bacteria | 9912 |
| 170 | Ga0466719_107762 | 3300042606 | Bacteria | 12760 |
| 171 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 172 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 173 | Ga0466711_065498 | 3300042615 | Bacteria | 3249 |
| 174 | Ga0466715_033819 | 3300042616 | Bacteria | 12286 |
| 175 | Ga0466723_075931 | 3300042618 | Bacteria | 72847 |
| 176 | Ga0466729_165153 | 3300042621 | Bacteria | 2434 |
| 177 | Ga0123357_10110096 | 3300009784 | Bacteria | 3515 |
| 178 | Ga0123354_10001417 | 3300010882 | Bacteria | 29086 |
| 179 | Ga0123354_10059757 | 3300010882 | Bacteria | 5650 |
| 180 | Ga0466735_153958 | 3300042624 | Unclassified | 1087 |
| 181 | Ga0466735_226128 | 3300042624 | Bacteria | 3850 |
| 182 | Ga0466703_176354 | 3300042636 | Bacteria | 44332 |
| 183 | Ga0466704_374697 | 3300042643 | Bacteria | 8138 |
| 184 | Ga0466709_418691 | 3300042648 | Bacteria | 6732 |
| 185 | Ga0466727_059169 | 3300042655 | Bacteria | 2454 |
| 186 | Ga0466693_220625 | 3300042592 | Bacteria | 3580 |
| 187 | Ga0466694_355069 | 3300042594 | Bacteria | 2507 |
| 188 | Ga0466696_151110 | 3300042596 | Bacteria | 63406 |
| 189 | Ga0466696_380941 | 3300042596 | Bacteria | 4333 |
| 190 | 2227577969 | 2225789004 | Bacteria | 2541 |
| 191 | JGI24696J40584_12945112 | 3300002834 | Bacteria | 1839 |
| 192 | Ga0068305_10018455 | 3300005083 | Bacteria | 21125 |
| 193 | Ga0072941_1184168 | 3300005201 | Bacteria | 1859 |
| 194 | Ga0466705_076110 | 3300042612 | Bacteria | 11231 |
| 195 | Ga0466706_031962 | 3300042599 | Bacteria | 11375 |
| 196 | Ga0466706_206505 | 3300042599 | Bacteria | 5015 |
| 197 | Ga0466706_228271 | 3300042599 | Bacteria | 21325 |
| 198 | Ga0466707_024783 | 3300042601 | Bacteria | 27160 |
| 199 | Ga0466707_183671 | 3300042601 | Bacteria | 3854 |
| 200 | Ga0466713_076948 | 3300042602 | Bacteria | 10343 |
| 201 | Ga0466716_409704 | 3300042605 | Bacteria | 2791 |
| 202 | Ga0466719_046019 | 3300042606 | Bacteria | 1861 |
| 203 | Ga0466722_018642 | 3300042609 | Bacteria | 5614 |
| 204 | Ga0466698_311761 | 3300042610 | Bacteria | 2337 |
| 205 | Ga0466711_040951 | 3300042615 | Bacteria | 13131 |
| 206 | Ga0466711_130139 | 3300042615 | Bacteria | 18313 |
| 207 | Ga0466711_189433 | 3300042615 | Bacteria | 38634 |
| 208 | Ga0466715_116213 | 3300042616 | Bacteria | 4984 |
| 209 | Ga0466715_402287 | 3300042616 | Bacteria | 28899 |
| 210 | Ga0123357_10006574 | 3300009784 | Bacteria | 14221 |
| 211 | Ga0466702_246271 | 3300042635 | Bacteria | 1457 |
| 212 | Ga0466703_084851 | 3300042636 | Bacteria | 16965 |
| 213 | Ga0466703_356065 | 3300042636 | Bacteria | 3501 |
| 214 | Ga0466704_562003 | 3300042643 | Bacteria | 3787 |
| 215 | Ga0466727_143956 | 3300042655 | Bacteria | 8483 |
| 216 | Ga0466727_171398 | 3300042655 | Bacteria | 14235 |
| 217 | Ga0466690_244169 | 3300042590 | Bacteria | 44294 |
| 218 | Ga0466690_331838 | 3300042590 | Bacteria | 6664 |
| 219 | Ga0466692_067935 | 3300042591 | Bacteria | 92005 |
| 220 | Ga0466691_002293 | 3300042593 | Bacteria | 8553 |
| 221 | 2227428027 | 2225789004 | Unclassified | 5583 |
| 222 | JGI24702J35022_10001463 | 3300002462 | Bacteria | 14697 |
| 223 | JGI24696J40584_12960851 | 3300002834 | Bacteria | 8897 |
| 224 | Ga0466705_267995 | 3300042612 | Bacteria | 14205 |
| 225 | Ga0466706_052347 | 3300042599 | Bacteria | 5149 |
| 226 | Ga0466707_128200 | 3300042601 | Bacteria | 13031 |
| 227 | Ga0466707_411900 | 3300042601 | Bacteria | 6275 |
| 228 | Ga0466713_147028 | 3300042602 | Bacteria | 1797 |
| 229 | Ga0466716_179611 | 3300042605 | Bacteria | 11964 |
| 230 | Ga0466719_130019 | 3300042606 | Bacteria | 7448 |
| 231 | Ga0466722_166973 | 3300042609 | Bacteria | 14816 |
| 232 | Ga0466722_189885 | 3300042609 | Bacteria | 4244 |
| 233 | Ga0466715_047082 | 3300042616 | Bacteria | 54165 |
| 234 | Ga0466715_172001 | 3300042616 | Bacteria | 21115 |
| 235 | Ga0466715_221888 | 3300042616 | Bacteria | 8533 |
| 236 | Ga0466723_226997 | 3300042618 | Bacteria | 11529 |
| 237 | Ga0466728_152612 | 3300042620 | Bacteria | 5143 |
| 238 | Ga0123357_10393052 | 3300009784 | Bacteria | 1271 |
| 239 | Ga0123354_10000231 | 3300010882 | Bacteria | 49858 |
| 240 | Ga0123354_10225457 | 3300010882 | Bacteria | 1977 |
| 241 | Ga0466735_125860 | 3300042624 | Bacteria | 4947 |
| 242 | Ga0466703_048150 | 3300042636 | Bacteria | 18046 |
| 243 | Ga0466703_062110 | 3300042636 | Bacteria | 1344 |
| 244 | Ga0466703_286277 | 3300042636 | Bacteria | 12375 |
| 245 | Ga0466704_043311 | 3300042643 | Bacteria | 5673 |
| 246 | Ga0466708_093369 | 3300042652 | Bacteria | 3974 |
| 247 | Ga0466708_197385 | 3300042652 | Bacteria | 35986 |
| 248 | Ga0466690_080200 | 3300042590 | Bacteria | 12268 |
| 249 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 250 | Ga0466691_064752 | 3300042593 | Bacteria | 8701 |
| 251 | 2227538826 | 2225789004 | Bacteria | 3022 |
| 252 | JGI24702J35022_10383912 | 3300002462 | Bacteria | 845 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02602 | HEM4 | Uroporphyrinogen-III synthase HemD | 53 | 265 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.