Protein Family IF04598

Metagenome Metatranscriptome Isolate
580 Members
192 Samples
461 Scaffolds
264.55 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_004578|Ga0466692_004578_16_981
Length
321 aa
Sequence
MQNEQAVISPSWSIHSGVGTAAYTFIWAMAGENQTFDDMDTITTTDLRYRGQRSNYMANVNFSLNGKVAWVTGASYGIGFAIAEALHGAGAAIVFNDLNRELVDKGLAAYKAAGIAAHGYVCDVTSEDAVNATVAKIEKDAGPVDILVNNAGIIKRIPMLEMSAAEFRQVIDIDLNAPFIVSKAVIPGMIKKGGGKIINICSMMSELGRETVSAYASAKGGLKMLTRNIASEYGKYNIQCNGIGPGYIETPQTAPLRERQADGSRHPFDQFIIAKTPAERWGTTDDLKGPAVFLASPASDFVNGHVLYVDGGILAYIGKQP

📊 Sample Types

Isolate 20.5%
Metagenome 79.1%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 28.6%
Unclassified 23.3%
Termitidae 17.5%
Blattidae 9.5%
Kalotermitidae 7.9%
Tenebrionidae 3.2%
Rhinotermitidae 2.6%
Termopsidae 2.1%
Drosophilidae 1.1%
Passalidae 1.1%
Formicidae 1.1%
Culicidae 0.5%
Hodotermitidae 0.5%
Scarabaeidae 0.5%
Daphniidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 551
Eukaryota 0
Viruses 0
Unclassified 29

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
2 2840795165 Gilliamella apicola N-22 Isolate Apidae
3 2854144746 Gilliamella apicola NO6 Isolate Apidae
4 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
5 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
6 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
7 2923982719 Parabacteroides sp. 52 Isolate Blattidae
8 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
9 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
10 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
11 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
12 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
13 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
14 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
15 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
16 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
17 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
18 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
19 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
20 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
24 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
25 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
32 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
41 2846475167 Gilliamella apicola N-G5 Isolate Apidae
42 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
43 2870910722 Gilliamella apicola wkB112 Isolate Apidae
44 2873648542 Gilliamella apicola NO10 Isolate Apidae
45 2922326829 Bacteroides sp. 224 Isolate Blattidae
46 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
47 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
48 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
49 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
50 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
51 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
52 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
58 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
59 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
60 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
61 2876016455 Gilliamella apicola N6 Isolate Apidae
62 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
63 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
64 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
65 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
66 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
67 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
68 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
69 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
70 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
71 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
72 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
73 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
74 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
75 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
76 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
77 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
78 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
79 8088486376 Gilliamella apis ESL0172 Isolate Apidae
80 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
81 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
82 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
83 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
84 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
85 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
86 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
87 2841195917 Gilliamella apicola wkB7 Isolate Apidae
88 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
89 2849452216 Gilliamella apicola AW11 Isolate Apidae
90 2849455045 Gilliamella apicola NO8 Isolate Apidae
91 2876033458 Gilliamella apicola AM6 Isolate Apidae
92 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
93 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
94 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
95 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
96 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
97 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
98 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
99 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
100 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
101 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
102 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
103 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
104 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
105 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
106 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
107 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
108 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
109 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
110 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
111 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
112 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
113 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
114 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
115 2846490831 Gilliamella apis ESL0172 Isolate Apidae
116 2849468476 Gilliamella apicola N-28 Isolate Apidae
117 2854137290 Gilliamella apicola Imp1-6 Isolate Apidae
118 2857883421 Gilliamella apicola N2 Isolate Apidae
119 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
120 2920168565 Paludibacter sp. 221 Isolate Blattidae
121 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
122 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
123 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
124 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
125 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
126 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
127 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
128 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
129 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
130 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
131 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
132 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
133 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
134 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
135 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
136 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
137 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
138 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
139 3004672520 Bacteroides sp. 51 Isolate Blattidae
140 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
141 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
142 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
143 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
144 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
145 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
146 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
147 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
148 2846485327 Gilliamella apicola AM4 Isolate Apidae
149 2849471304 Gilliamella apicola NO5 Isolate Apidae
150 2876022486 Gilliamella apicola A8 Isolate Apidae
151 2876027665 Gilliamella apicola P54G Isolate Apidae
152 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
153 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
154 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
155 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
156 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
157 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
158 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
159 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
160 3004667792 Bacteroides sp. 519 Isolate Blattidae
161 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
162 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
163 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
164 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
165 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
166 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
167 2854147632 Gilliamella apicola wkB195 Isolate Apidae
168 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
169 2868489326 Gilliamella apicola N10 Isolate Apidae
170 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
171 2870920129 Gilliamella apicola wkB108 Isolate Apidae
172 2873633977 Gilliamella apicola wkB178 Isolate Apidae
173 2873638493 Gilliamella apicola wkB72 Isolate Apidae
174 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
175 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
176 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
177 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
178 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
179 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
180 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
181 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
182 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
183 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
184 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
185 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
186 8088493931 Gilliamella apis K-MP18 Isolate Apidae
187 3004677695 Bacteroides sp. 214 Isolate Blattidae
188 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
189 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
190 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
191 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
192 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_010394 3300038395 Bacteria 11605
2 Ga0466690_073249 3300042590 Bacteria 19756
3 Ga0466690_304878 3300042590 Bacteria 8088
4 Ga0466691_104012 3300042593 Bacteria 1328
5 Ga0466696_035748 3300042596 Bacteria 10479
6 Ga0466696_179297 3300042596 Bacteria 26500
7 Ga0466696_280385 3300042596 Bacteria 9267
8 Ga0466699_289528 3300042597 Bacteria 3315
9 Ga0466706_093362 3300042599 Bacteria 11051
10 Ga0466707_058023 3300042601 Bacteria 1215
11 Ga0466707_071585 3300042601 Unclassified 2397
12 Ga0466707_351494 3300042601 Bacteria 1456
13 Ga0466713_069552 3300042602 Bacteria 12569
14 Ga0466714_049048 3300042603 Bacteria 5044
15 Ga0466714_061101 3300042603 Bacteria 2698
16 Ga0466717_163257 3300042604 Bacteria 1565
17 Ga0466717_239743 3300042604 Unclassified 1906
18 Ga0466716_308756 3300042605 Bacteria 5345
19 Ga0466719_142661 3300042606 Bacteria 9799
20 Ga0466720_065521 3300042607 Bacteria 16476
21 Ga0466722_004422 3300042609 Bacteria 2578
22 Ga0466722_200394 3300042609 Bacteria 8382
23 Ga0466722_211346 3300042609 Bacteria 1074
24 gam1t_NODE_270194_length=187524_GC=34_6_Contigs=2 2189573031 Bacteria 187534
25 2227239116 2225789004 Bacteria 7264
26 2227557949 2225789004 Bacteria 14722
27 JGI24698J34947_10030044 3300002449 Unclassified 2868
28 JGI24695J34938_10009771 3300002450 Bacteria 5310
29 JGI24695J34938_10078014 3300002450 Bacteria 1372
30 JGI24702J35022_10000651 3300002462 Bacteria 21098
31 JGI24702J35022_10034861 3300002462 Bacteria 2692
32 JGI24700J35501_10930911 3300002508 Bacteria 40904
33 Ga0104147_1022423 3300007224 Bacteria 16014
34 Ga0466732_333582 3300042656 Bacteria 3487
35 Ga0466733_132320 3300042659 Bacteria 5961
36 Ga0562379_0155 3300056790 Bacteria 206141
37 Ga0562379_0171 3300056790 Bacteria 192504
38 Ga0562375_0005 3300056856 Bacteria 2472444
39 Ga0466705_016747 3300042612 Bacteria 3640
40 Ga0466705_058170 3300042612 Bacteria 12035
41 Ga0466710_212659 3300042613 Bacteria 1222
42 Ga0466711_048565 3300042615 Bacteria 3372
43 Ga0466711_053403 3300042615 Bacteria 5360
44 Ga0466718_008176 3300042617 Bacteria 6966
45 Ga0466723_097907 3300042618 Bacteria 21508
46 Ga0466723_100945 3300042618 Bacteria 6451
47 Ga0466728_361248 3300042620 Unclassified 3678
48 Ga0123355_10001046 3300009826 Bacteria 38323
49 Ga0123355_10002765 3300009826 Bacteria 24893
50 Ga0123355_10194789 3300009826 Bacteria 2975
51 Ga0123356_10121785 3300010049 Bacteria 2539
52 Ga0123356_10163823 3300010049 Bacteria 2225
53 Ga0123356_11051699 3300010049 Unclassified 983
54 Ga0123353_10062176 3300010167 Bacteria 5989
55 Ga0123353_10512444 3300010167 Bacteria 1743
56 Ga0466735_043493 3300042624 Bacteria 12514
57 Ga0466735_201857 3300042624 Bacteria 2708
58 Ga0466735_204052 3300042624 Bacteria 1652
59 Ga0466704_359371 3300042643 Bacteria 3292
60 Ga0466709_077791 3300042648 Bacteria 37827
61 Ga0466709_397754 3300042648 Bacteria 9093
62 Ga0466708_367530 3300042652 Bacteria 33206
63 Ga0466725_442799 3300042654 Bacteria 1608
64 Ga0466727_085397 3300042655 Bacteria 3053
65 Ga0415639_016564 3300038395 Unclassified 1799
66 Ga0415639_035160 3300038395 Bacteria 2126
67 Ga0415639_041759 3300038395 Bacteria 4730
68 Ga0456237_0011802 3300041968 Bacteria 1272
69 Ga0466692_028123 3300042591 Unclassified 1488
70 Ga0466693_258058 3300042592 Bacteria 1625
71 Ga0466691_097851 3300042593 Bacteria 2505
72 Ga0466696_406475 3300042596 Bacteria 14044
73 Ga0466706_059970 3300042599 Bacteria 23340
74 Ga0466706_104549 3300042599 Bacteria 39465
75 Ga0466706_276704 3300042599 Bacteria 2699
76 Ga0466700_429223 3300042600 Bacteria 1505
77 Ga0466707_396068 3300042601 Unclassified 1253
78 Ga0466716_080590 3300042605 Bacteria 12076
79 Ga0466716_106997 3300042605 Bacteria 2261
80 Ga0466720_161623 3300042607 Bacteria 1067
81 JGI24695J34938_10055889 3300002450 Bacteria 1704
82 JGI24695J34938_10060683 3300002450 Bacteria 1612
83 Ga0466733_222911 3300042659 Unclassified 2418
84 Ga0466705_268046 3300042612 Bacteria 5031
85 Ga0466705_345996 3300042612 Bacteria 1913
86 Ga0466705_408517 3300042612 Bacteria 1116
87 Ga0466712_058255 3300042614 Bacteria 5813
88 Ga0466711_055562 3300042615 Bacteria 1361
89 Ga0466711_231985 3300042615 Bacteria 7682
90 Ga0466715_051157 3300042616 Bacteria 50381
91 Ga0466715_070716 3300042616 Bacteria 51142
92 Ga0466723_178591 3300042618 Bacteria 34430
93 Ga0466726_312451 3300042619 Bacteria 1290
94 Ga0466728_070833 3300042620 Bacteria 41238
95 Ga0123355_10000276 3300009826 Bacteria 66090
96 Ga0123355_10616840 3300009826 Bacteria 1280
97 Ga0123355_10674591 3300009826 Bacteria 1197
98 Ga0123353_10267098 3300010167 Bacteria 2638
99 Ga0123353_10927319 3300010167 Bacteria 1181
100 Ga0466734_114006 3300042623 Bacteria 1281
101 Ga0466703_021854 3300042636 Bacteria 27270
102 Ga0466703_116384 3300042636 Bacteria 2104
103 Ga0466703_122833 3300042636 Bacteria 5687
104 Ga0466704_023096 3300042643 Bacteria 3774
105 Ga0466704_115477 3300042643 Bacteria 5925
106 Ga0466708_101648 3300042652 Bacteria 32818
107 Ga0466690_037737 3300042590 Bacteria 4427
108 Ga0466690_406300 3300042590 Bacteria 5103
109 Ga0466692_004578 3300042591 Bacteria 1016
110 Ga0466693_164323 3300042592 Bacteria 14525
111 Ga0466691_103043 3300042593 Bacteria 22160
112 Ga0466696_087173 3300042596 Bacteria 8323
113 Ga0466696_132321 3300042596 Bacteria 10991
114 Ga0466696_452761 3300042596 Bacteria 2094
115 Ga0466699_102285 3300042597 Bacteria 14369
116 Ga0466701_029814 3300042598 Bacteria 1410
117 Ga0466706_100655 3300042599 Bacteria 11090
118 Ga0466706_162687 3300042599 Bacteria 2216
119 Ga0466706_245338 3300042599 Bacteria 3927
120 Ga0466707_363558 3300042601 Unclassified 2921
121 Ga0466713_071103 3300042602 Bacteria 5130
122 Ga0466714_000993 3300042603 Bacteria 1358
123 Ga0466719_210155 3300042606 Bacteria 9481
124 Ga0466697_027951 3300042611 Bacteria 74281
125 JGI24698J34947_10005496 3300002449 Unclassified 6953
126 JGI24698J34947_10008806 3300002449 Bacteria 5535
127 JGI24698J34947_10022153 3300002449 Bacteria 3410
128 JGI24695J34938_10008960 3300002450 Bacteria 5632
129 JGI24695J34938_10103077 3300002450 Bacteria 1165
130 JGI24702J35022_10010735 3300002462 Bacteria 5113
131 Ga0072941_1242333 3300005201 Bacteria 3550
132 Ga0466733_056006 3300042659 Bacteria 19323
133 Ga0562376_1079 3300056857 Bacteria 40827
134 Ga0466705_402325 3300042612 Bacteria 3092
135 Ga0466710_251347 3300042613 Bacteria 3479
136 Ga0466712_058277 3300042614 Bacteria 14833
137 Ga0466711_106068 3300042615 Bacteria 16483
138 Ga0466711_324425 3300042615 Bacteria 4384
139 Ga0466715_034225 3300042616 Bacteria 16942
140 Ga0466715_202750 3300042616 Bacteria 8026
141 Ga0466715_580374 3300042616 Bacteria 5200
142 Ga0466718_060494 3300042617 Bacteria 1478
143 Ga0466718_097298 3300042617 Bacteria 24857
144 Ga0466726_153404 3300042619 Bacteria 17099
145 Ga0466726_368666 3300042619 Bacteria 3433
146 Ga0123355_10000180 3300009826 Bacteria 77979
147 Ga0123355_10033972 3300009826 Bacteria 8284
148 Ga0123355_10513930 3300009826 Bacteria 1470
149 Ga0123356_10037835 3300010049 Bacteria 4499
150 Ga0123356_11166570 3300010049 Bacteria 937
151 Ga0123353_10044235 3300010167 Bacteria 7057
152 Ga0123353_10442708 3300010167 Unclassified 1916
153 Ga0123354_10231141 3300010882 Bacteria 1933
154 Ga0466729_261672 3300042621 Bacteria 11519
155 Ga0466734_126251 3300042623 Bacteria 1410
156 Ga0466703_019183 3300042636 Bacteria 1897
157 Ga0466703_058133 3300042636 Bacteria 5133
158 Ga0466703_133169 3300042636 Bacteria 1626
159 Ga0466703_317966 3300042636 Bacteria 1588
160 Ga0466704_143483 3300042643 Bacteria 8895
161 Ga0466709_372748 3300042648 Bacteria 71914
162 Ga0466708_125451 3300042652 Bacteria 3493
163 Ga0466727_260519 3300042655 Bacteria 1757
164 Ga0160472_100280 3300012839 Bacteria 54999
165 Ga0466657_353495 3300042582 Bacteria 10811
166 Ga0466690_092512 3300042590 Bacteria 12938
167 Ga0466692_122280 3300042591 Bacteria 16551
168 Ga0466691_209466 3300042593 Bacteria 8134
169 Ga0466694_186948 3300042594 Bacteria 1415
170 Ga0466699_099588 3300042597 Bacteria 1981
171 Ga0466699_239747 3300042597 Bacteria 10746
172 Ga0466706_084442 3300042599 Bacteria 7933
173 Ga0466706_116897 3300042599 Bacteria 5440
174 Ga0466706_242573 3300042599 Bacteria 1383
175 Ga0466707_119211 3300042601 Bacteria 2972
176 Ga0466707_406896 3300042601 Bacteria 1319
177 Ga0466713_126942 3300042602 Bacteria 11293
178 Ga0466714_018210 3300042603 Bacteria 10928
179 Ga0466714_063876 3300042603 Bacteria 1615
180 Ga0466714_085829 3300042603 Bacteria 36662
181 Ga0466714_114704 3300042603 Bacteria 2731
182 Ga0466717_204305 3300042604 Bacteria 1224
183 Ga0466719_451335 3300042606 Bacteria 1815
184 Ga0466719_475954 3300042606 Bacteria 3136
185 Ga0466719_486706 3300042606 Bacteria 1615
186 Ga0466722_224010 3300042609 Bacteria 3693
187 2227463524 2225789004 Bacteria 25428
188 JGI24698J34947_10064221 3300002449 Bacteria 1795
189 JGI24695J34938_10000187 3300002450 Bacteria 58138
190 JGI24695J34938_10002735 3300002450 Bacteria 12972
191 JGI24695J34938_10017316 3300002450 Bacteria 3635
192 JGI24695J34938_10053640 3300002450 Bacteria 1752
193 JGI24702J35022_10001125 3300002462 Bacteria 16621
194 Ga0068302_10054052 3300005071 Bacteria 1293
195 Ga0562377_0004 3300056842 Bacteria 3525959
196 Ga0562377_0298 3300056842 Bacteria 103311
197 Ga0562375_0019 3300056856 Bacteria 921384
198 Ga0562375_0355 3300056856 Bacteria 105445
199 Ga0466705_409216 3300042612 Bacteria 1779
200 Ga0466712_045507 3300042614 Bacteria 29349
201 Ga0466711_382674 3300042615 Bacteria 10110
202 Ga0466711_403972 3300042615 Bacteria 61875
203 Ga0466715_076767 3300042616 Bacteria 23423
204 Ga0466715_268476 3300042616 Bacteria 54264
205 Ga0466726_302243 3300042619 Bacteria 5090
206 Ga0466728_056616 3300042620 Bacteria 14424
207 Ga0466728_328400 3300042620 Bacteria 16987
208 Ga0466729_090939 3300042621 Bacteria 9735
209 Ga0123357_10231233 3300009784 Bacteria 2026
210 Ga0123355_10000890 3300009826 Bacteria 41379
211 Ga0123355_10011638 3300009826 Bacteria 13575
212 Ga0123355_10096097 3300009826 Bacteria 4680
213 Ga0123356_10056376 3300010049 Bacteria 3661
214 Ga0123356_10092762 3300010049 Bacteria 2880
215 Ga0123356_10147009 3300010049 Bacteria 2333
216 Ga0123356_10239798 3300010049 Bacteria 1883
217 Ga0123356_10268473 3300010049 Bacteria 1794
218 Ga0123356_10422080 3300010049 Bacteria 1476
219 Ga0123356_10514509 3300010049 Unclassified 1355
220 Ga0123353_10101848 3300010167 Bacteria 4629
221 Ga0123353_10259754 3300010167 Bacteria 2684
222 Ga0466730_086539 3300042625 Bacteria 1302
223 Ga0466703_008232 3300042636 Unclassified 3465
224 Ga0466704_140660 3300042643 Unclassified 1198
225 Ga0466704_188494 3300042643 Bacteria 28539
226 Ga0466704_443371 3300042643 Bacteria 18552
227 Ga0466704_539681 3300042643 Bacteria 11330
228 Ga0466709_249297 3300042648 Bacteria 2617
229 Ga0466708_016960 3300042652 Bacteria 21170
230 Ga0466708_246063 3300042652 Bacteria 25365
231 Ga0222431_1001788 3300021190 Bacteria 1783
232 Ga0264413_145688 3300024493 Bacteria 3532
233 Ga0415639_044369 3300038395 Bacteria 2972
234 Ga0466690_029777 3300042590 Bacteria 13352
235 Ga0466690_107941 3300042590 Bacteria 9527
236 Ga0466692_157866 3300042591 Bacteria 1303
237 Ga0466693_284910 3300042592 Bacteria 4019
238 Ga0466691_087993 3300042593 Bacteria 15497
239 Ga0466696_345388 3300042596 Bacteria 3760
240 Ga0466706_113831 3300042599 Bacteria 22541
241 Ga0466700_486029 3300042600 Bacteria 1891
242 Ga0466713_060276 3300042602 Bacteria 38182
243 Ga0466714_114674 3300042603 Bacteria 18871
244 Ga0466714_121237 3300042603 Bacteria 1465
245 Ga0466717_126922 3300042604 Bacteria 1897
246 Ga0466716_101303 3300042605 Bacteria 11840
247 Ga0466716_486782 3300042605 Bacteria 3093
248 gam1t_NODE_673557_length=7178_GC=31_9_Contigs=1 2189573031 Unclassified 7178
249 2227175255 2225789004 Bacteria 8139
250 IMNBL1DRAFT_c0000042 3300000062 Bacteria 116840
251 JGI24698J34947_10053763 3300002449 Bacteria 2014
252 JGI24695J34938_10000689 3300002450 Bacteria 31877
253 JGI24695J34938_10051535 3300002450 Bacteria 1801
254 JGI24702J35022_10016886 3300002462 Bacteria 3996
255 JGI24696J40584_12852606 3300002834 Bacteria 986
256 JGI24696J40584_12953393 3300002834 Unclassified 2476
257 JGI24696J40584_12961559 3300002834 Bacteria 20897
258 Ga0074278_120271 3300005721 Unclassified 3001
259 Ga0466733_052873 3300042659 Bacteria 1122
260 Ga0466733_158024 3300042659 Bacteria 4699
261 Ga0562374_0008 3300057007 Bacteria 1999653
262 Ga0466697_152988 3300042611 Bacteria 2586
263 Ga0466705_033887 3300042612 Bacteria 9594
264 Ga0466712_141810 3300042614 Bacteria 3387
265 Ga0466712_192186 3300042614 Bacteria 7953
266 Ga0466715_013678 3300042616 Bacteria 10320
267 Ga0466715_140517 3300042616 Bacteria 2715
268 Ga0466715_148502 3300042616 Bacteria 6176
269 Ga0466715_196327 3300042616 Bacteria 39725
270 Ga0466715_327991 3300042616 Unclassified 2390
271 Ga0466715_498121 3300042616 Bacteria 9304
272 Ga0466718_048927 3300042617 Bacteria 13848
273 Ga0466718_129288 3300042617 Bacteria 1045
274 Ga0466723_070743 3300042618 Bacteria 6309
275 Ga0466726_301222 3300042619 Bacteria 3352
276 Ga0466726_358100 3300042619 Bacteria 1093
277 Ga0123357_10111153 3300009784 Bacteria 3492
278 Ga0123355_10000328 3300009826 Bacteria 61452
279 Ga0123355_10266426 3300009826 Bacteria 2388
280 Ga0123355_10272347 3300009826 Bacteria 2350
281 Ga0123355_10665232 3300009826 Bacteria 1210
282 Ga0123356_10000407 3300010049 Bacteria 48938
283 Ga0123356_10648991 3300010049 Bacteria 1222
284 Ga0123353_10054963 3300010167 Bacteria 6368
285 Ga0123353_10310659 3300010167 Bacteria 2400
286 Ga0466729_206008 3300042621 Bacteria 4714
287 Ga0466735_138619 3300042624 Bacteria 1255
288 Ga0466703_012905 3300042636 Bacteria 2808
289 Ga0466709_405698 3300042648 Bacteria 9317
290 Ga0466708_306116 3300042652 Bacteria 2043
291 Ga0466708_321419 3300042652 Bacteria 16374
292 Ga0466727_211572 3300042655 Bacteria 2116
293 Ga0466727_322952 3300042655 Bacteria 2524
294 Ga0255786_1013102 3300022815 Bacteria 1401
295 Ga0415639_014808 3300038395 Bacteria 7832
296 Ga0466690_430388 3300042590 Bacteria 7134
297 Ga0466693_100539 3300042592 Bacteria 1722
298 Ga0466694_278340 3300042594 Bacteria 1071
299 Ga0466696_166116 3300042596 Bacteria 7597
300 Ga0466696_261968 3300042596 Bacteria 8628
301 Ga0466699_034588 3300042597 Bacteria 1376
302 Ga0466706_002116 3300042599 Bacteria 9074
303 Ga0466707_258930 3300042601 Bacteria 22459
304 Ga0466714_099702 3300042603 Bacteria 27402
305 Ga0466716_180999 3300042605 Bacteria 1537
306 Ga0466719_187376 3300042606 Bacteria 5850
307 Ga0466720_062333 3300042607 Unclassified 1215
308 Ga0466720_081487 3300042607 Bacteria 31706
309 Ga0466720_093891 3300042607 Bacteria 26484
310 Ga0466722_004056 3300042609 Bacteria 7820
311 Ga0466722_040922 3300042609 Bacteria 8885
312 Ga0466722_203095 3300042609 Bacteria 7649
313 Ga0466722_265209 3300042609 Bacteria 5305
314 IMNBL1DRAFT_c0000160 3300000062 Bacteria 59589
315 Ga0068302_10129519 3300005071 Bacteria 3086
316 Ga0072941_1023015 3300005201 Bacteria 6989
317 Ga0123357_10000489 3300009784 Bacteria 38470
318 Ga0123357_10001211 3300009784 Bacteria 26983
319 Ga0466732_310007 3300042656 Bacteria 1510
320 Ga0466732_315645 3300042656 Bacteria 4738
321 Ga0562379_0080 3300056790 Bacteria 355260
322 Ga0466710_282604 3300042613 Bacteria 1839
323 Ga0466711_010880 3300042615 Bacteria 4847
324 Ga0466711_078498 3300042615 Bacteria 17443
325 Ga0466711_163307 3300042615 Bacteria 57894
326 Ga0466711_440043 3300042615 Bacteria 9116
327 Ga0466715_031955 3300042616 Bacteria 1982
328 Ga0466715_293902 3300042616 Bacteria 9723
329 Ga0466715_535953 3300042616 Bacteria 21784
330 Ga0466718_116758 3300042617 Bacteria 14641
331 Ga0466718_134544 3300042617 Bacteria 1775
332 Ga0466723_026672 3300042618 Bacteria 7452
333 Ga0466723_114888 3300042618 Bacteria 8393
334 Ga0466728_398034 3300042620 Bacteria 3825
335 Ga0123357_10177297 3300009784 Unclassified 2501
336 Ga0123355_10056013 3300009826 Bacteria 6382
337 Ga0123356_10016001 3300010049 Bacteria 7170
338 Ga0123356_10032715 3300010049 Bacteria 4864
339 Ga0123356_10089259 3300010049 Bacteria 2932
340 Ga0123356_10273979 3300010049 Bacteria 1779
341 Ga0123356_10968535 3300010049 Bacteria 1021
342 Ga0123353_10206449 3300010167 Bacteria 3085
343 Ga0123353_10268804 3300010167 Bacteria 2628
344 Ga0123354_10259772 3300010882 Bacteria 1737
345 Ga0466704_434433 3300042643 Bacteria 7839
346 Ga0466704_621429 3300042643 Bacteria 5432
347 Ga0466724_49350 3300042649 Bacteria 3692
348 Ga0466708_461535 3300042652 Bacteria 12713
349 Ga0466727_235044 3300042655 Bacteria 83297
350 Ga0466690_390812 3300042590 Bacteria 2452
351 Ga0466691_146559 3300042593 Bacteria 21127
352 Ga0466694_079114 3300042594 Bacteria 2575
353 Ga0466694_310216 3300042594 Bacteria 1279
354 Ga0466696_333818 3300042596 Bacteria 17670
355 Ga0466696_416178 3300042596 Bacteria 4286
356 Ga0466699_020206 3300042597 Bacteria 1063
357 Ga0466706_031962 3300042599 Bacteria 11375
358 Ga0466700_187577 3300042600 Bacteria 17119
359 Ga0466707_153391 3300042601 Bacteria 1695
360 Ga0466713_067968 3300042602 Bacteria 13005
361 Ga0466714_150572 3300042603 Bacteria 7586
362 Ga0466716_038207 3300042605 Bacteria 7844
363 IMNBL1DRAFT_c0003511 3300000062 Bacteria 10026
364 HBC_ctgsDRAFT_1014198 3300000333 Bacteria 1921
365 JGI24698J34947_10012496 3300002449 Bacteria 4653
366 JGI24698J34947_10054164 3300002449 Unclassified 2004
367 JGI24695J34938_10001268 3300002450 Bacteria 22165
368 JGI24695J34938_10001509 3300002450 Bacteria 19637
369 JGI24695J34938_10039037 3300002450 Bacteria 2148
370 JGI24695J34938_10066171 3300002450 Bacteria 1524
371 JGI24695J34938_10073540 3300002450 Bacteria 1423
372 CVPL010L_1000026 3300002932 Unclassified 70666
373 Ga0068305_10075335 3300005083 Bacteria 4302
374 Ga0074278_104690 3300005721 Bacteria 187534
375 Ga0562377_0010 3300056842 Bacteria 1401665
376 Ga0562374_0006 3300057007 Bacteria 2178283
377 Ga0466705_093099 3300042612 Bacteria 6207
378 Ga0466705_369479 3300042612 Bacteria 4871
379 Ga0466710_404759 3300042613 Bacteria 1366
380 Ga0466712_073181 3300042614 Bacteria 2442
381 Ga0466715_144452 3300042616 Bacteria 10674
382 Ga0466715_246918 3300042616 Bacteria 1810
383 Ga0466718_044939 3300042617 Unclassified 1667
384 Ga0466718_075853 3300042617 Bacteria 1478
385 Ga0466723_183847 3300042618 Bacteria 12292
386 Ga0466728_196476 3300042620 Bacteria 1088
387 Ga0466729_135910 3300042621 Bacteria 3817
388 Ga0123357_10041797 3300009784 Bacteria 6235
389 Ga0123357_10125567 3300009784 Bacteria 3216
390 Ga0123357_10345604 3300009784 Bacteria 1431
391 Ga0123355_10000140 3300009826 Bacteria 86312
392 Ga0123355_10000191 3300009826 Bacteria 75858
393 Ga0123355_10003213 3300009826 Bacteria 23353
394 Ga0123356_10030922 3300010049 Bacteria 5010
395 Ga0123356_10299847 3300010049 Bacteria 1711
396 Ga0123356_10320783 3300010049 Bacteria 1662
397 Ga0123356_10752047 3300010049 Bacteria 1145
398 Ga0123353_10000094 3300010167 Bacteria 101598
399 Ga0123353_10511817 3300010167 Bacteria 1745
400 Ga0123353_11153744 3300010167 Bacteria 1022
401 Ga0123354_10039410 3300010882 Bacteria 7323
402 Ga0466703_064825 3300042636 Bacteria 42026
403 Ga0466704_174835 3300042643 Unclassified 1130
404 Ga0466709_401116 3300042648 Bacteria 6876
405 Ga0466708_027437 3300042652 Unclassified 1951
406 Ga0415639_011170 3300038395 Bacteria 12304
407 Ga0415639_056947 3300038395 Bacteria 2543
408 Ga0466693_305759 3300042592 Bacteria 1843
409 Ga0466691_079092 3300042593 Bacteria 17061
410 Ga0466694_331366 3300042594 Bacteria 1875
411 Ga0466699_130100 3300042597 Bacteria 1834
412 Ga0466699_243828 3300042597 Bacteria 1665
413 Ga0466706_036878 3300042599 Bacteria 3335
414 Ga0466706_052347 3300042599 Bacteria 5149
415 Ga0466706_206016 3300042599 Bacteria 1662
416 Ga0466713_152963 3300042602 Bacteria 31054
417 Ga0466714_074933 3300042603 Bacteria 1386
418 Ga0466714_093645 3300042603 Bacteria 1873
419 Ga0466714_112905 3300042603 Bacteria 3979
420 Ga0466714_122902 3300042603 Bacteria 8084
421 Ga0466714_134377 3300042603 Bacteria 3841
422 Ga0466719_475707 3300042606 Bacteria 2871
423 Ga0466719_481531 3300042606 Bacteria 2252
424 Ga0466722_005212 3300042609 Bacteria 16307
425 Ga0466722_150301 3300042609 Bacteria 13111
426 Ga0466698_442228 3300042610 Bacteria 1630
427 2227507959 2225789004 Bacteria 65570
428 HBC_ctgsDRAFT_1038780 3300000333 Unclassified 1167
429 JGI24698J34947_10004049 3300002449 Bacteria 7962
430 JGI24698J34947_10004231 3300002449 Bacteria 7804
431 JGI24698J34947_10063952 3300002449 Bacteria 1801
432 Ga0068305_10066845 3300005083 Bacteria 17586
433 Ga0466733_064970 3300042659 Bacteria 1817
434 Ga0562378_0020 3300056814 Bacteria 847281
435 Ga0466705_137435 3300042612 Bacteria 5396
436 Ga0466711_108506 3300042615 Bacteria 4198
437 Ga0466711_429984 3300042615 Bacteria 3426
438 Ga0466715_318617 3300042616 Bacteria 3387
439 Ga0466715_366697 3300042616 Bacteria 28419
440 Ga0466723_005097 3300042618 Bacteria 11859
441 Ga0466726_385209 3300042619 Bacteria 1109
442 Ga0466726_479301 3300042619 Bacteria 63581
443 Ga0466728_078606 3300042620 Unclassified 1033
444 Ga0466728_255163 3300042620 Bacteria 4387
445 Ga0466728_376995 3300042620 Bacteria 2502
446 Ga0123357_10004567 3300009784 Bacteria 16299
447 Ga0123357_10041929 3300009784 Bacteria 6224
448 Ga0123357_10134841 3300009784 Bacteria 3058
449 Ga0123355_10012088 3300009826 Bacteria 13357
450 Ga0123355_10131873 3300009826 Bacteria 3849
451 Ga0123355_10137927 3300009826 Bacteria 3742
452 Ga0123356_10094366 3300010049 Unclassified 2857
453 Ga0123353_10400456 3300010167 Bacteria 2043
454 Ga0123353_10672247 3300010167 Bacteria 1460
455 Ga0123353_10725667 3300010167 Bacteria 1389
456 Ga0123353_11070036 3300010167 Bacteria 1075
457 Ga0466704_324385 3300042643 Bacteria 1225
458 Ga0466709_113294 3300042648 Bacteria 28711
459 Ga0466709_130542 3300042648 Bacteria 7312
460 Ga0466727_219070 3300042655 Bacteria 17923
461 Ga0466727_284689 3300042655 Bacteria 2387

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 67 260 0.99
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 73 313 0.93
PF08659 KR KR domain 70 220 0.87
PF23441 69 250 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.