Protein Family IF04272
Metagenome
Metatranscriptome
Isolate
326
Members
210
Samples
196
Scaffolds
121.35
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_003328|Ga0415639_003328_2418_2819
- Length
- 133 aa
- Sequence
- MVCLYEKEVSPVIQQESTLRVADNTGAKELKCIRVLGGSGRRYAGVGDVVVCSVRRANPGGTAKKGEVVKAVIVRTVKGIHRQDGSYVRFDENAAVIIKEDKNPRGTRIFGPVARELRDKDYMKILSLAPEVI
Sample Types
Isolate
39.9%
Metagenome
59.8%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.2%
Termitidae
20.6%
Apidae
15.6%
Kalotermitidae
5.0%
Scarabaeidae
3.5%
Formicidae
3.0%
Cambaridae
2.0%
Armadillidiidae
2.0%
Tenebrionidae
2.0%
Culicidae
1.5%
Termopsidae
1.5%
Hydrophilidae
1.0%
Passalidae
1.0%
Rhinotermitidae
1.0%
Curculionidae
1.0%
Pyralidae
0.5%
Pentatomidae
0.5%
Calliphoridae
0.5%
Hodotermitidae
0.5%
Rhaphidophoridae
0.5%
Siricidae
0.5%
Cerambycidae
0.5%
Dytiscidae
0.5%
Taxonomy
Archaea
0
Bacteria
292
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 2 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 3 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 4 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 5 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 6 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 7 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 8 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 9 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 10 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 11 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 12 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 13 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 14 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 17 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 18 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 27 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 28 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 29 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 30 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 31 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 32 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 33 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 36 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 37 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 38 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 39 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 40 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 41 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 42 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 46 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 47 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 48 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 49 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 50 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 51 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 52 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 53 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 54 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 55 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 56 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 57 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 58 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 59 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 60 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 61 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 62 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 63 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 64 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 65 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 66 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 67 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 68 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 69 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 70 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 71 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 72 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 73 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 74 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 75 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 76 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 77 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 78 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 79 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 80 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 81 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 82 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 83 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 84 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 85 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 86 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 87 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 88 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 89 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 90 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 91 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 92 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 93 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 94 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 95 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 96 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 97 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 98 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 99 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 100 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 101 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 102 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 103 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 104 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 105 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 106 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 107 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 108 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 109 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 110 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 111 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 112 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 113 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 114 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 115 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 116 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 117 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 118 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 119 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 120 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 121 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 122 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 123 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 124 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 125 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 126 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 127 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 128 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 129 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 130 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 131 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 132 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 133 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 134 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 135 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 136 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 137 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 138 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 139 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 140 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 141 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 142 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 143 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 144 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 145 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 146 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 147 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 148 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 149 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 150 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 151 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 152 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 153 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 154 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 155 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 156 | 3300060896 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 157 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 158 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 159 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 160 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 161 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 162 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 163 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 164 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 165 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 166 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 167 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 168 | 2820799971 | Unclassified Actinobacteria Th196P4bin46 | Isolate | Unclassified |
| 169 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 170 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 171 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 172 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 173 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 174 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 175 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 176 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 177 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 178 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 179 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 180 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 181 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 182 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 183 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 184 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 185 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 186 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 187 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 188 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 189 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 190 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 191 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 192 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 193 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 194 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 195 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 196 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 197 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 198 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 199 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 200 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 201 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 202 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 203 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 204 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 205 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 206 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 207 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 208 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 209 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 210 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0024154 | 3300000062 | Bacteria | 2363 |
| 2 | JGI24695J34938_10061783 | 3300002450 | Unclassified | 1593 |
| 3 | JGI24700J35501_10924065 | 3300002508 | Bacteria | 5357 |
| 4 | Ga0072940_1324024 | 3300005200 | Bacteria | 1638 |
| 5 | Ga0072941_1012258 | 3300005201 | Bacteria | 37649 |
| 6 | Ga0466718_015454 | 3300042617 | Unclassified | 1688 |
| 7 | Ga0466728_240430 | 3300042620 | Bacteria | 19472 |
| 8 | Ga0123355_10458983 | 3300009826 | Bacteria | 1600 |
| 9 | Ga0123356_10056246 | 3300010049 | Unclassified | 3665 |
| 10 | Ga0123353_10000701 | 3300010167 | Bacteria | 40961 |
| 11 | Ga0123353_10215284 | 3300010167 | Bacteria | 3009 |
| 12 | Ga0123353_10753410 | 3300010167 | Bacteria | 1355 |
| 13 | Ga0123354_10182293 | 3300010882 | Bacteria | 2391 |
| 14 | Ga0160466_100074 | 3300012809 | Bacteria | 108538 |
| 15 | Ga0415639_003328 | 3300038395 | Bacteria | 4857 |
| 16 | Ga0466706_002456 | 3300042599 | Bacteria | 2081 |
| 17 | Ga0466706_118801 | 3300042599 | Bacteria | 2908 |
| 18 | Ga0466706_156127 | 3300042599 | Unclassified | 1503 |
| 19 | Ga0466707_217817 | 3300042601 | Bacteria | 5144 |
| 20 | Ga0466707_380438 | 3300042601 | Unclassified | 2537 |
| 21 | Ga0466720_040299 | 3300042607 | Bacteria | 13637 |
| 22 | Ga0466727_131483 | 3300042655 | Bacteria | 12506 |
| 23 | Ga0466705_175607 | 3300042612 | Bacteria | 1688 |
| 24 | Ga0466705_340721 | 3300042612 | Bacteria | 18791 |
| 25 | JGI24702J35022_10003607 | 3300002462 | Bacteria | 9318 |
| 26 | JGI24702J35022_10411313 | 3300002462 | Unclassified | 818 |
| 27 | Ga0072940_1088023 | 3300005200 | Bacteria | 3651 |
| 28 | Ga0466718_147760 | 3300042617 | Bacteria | 2725 |
| 29 | Ga0466723_247108 | 3300042618 | Bacteria | 1248 |
| 30 | Ga0466726_380182 | 3300042619 | Bacteria | 2232 |
| 31 | Ga0123355_10000553 | 3300009826 | Bacteria | 50067 |
| 32 | Ga0123355_10382865 | 3300009826 | Bacteria | 1831 |
| 33 | Ga0123355_10645486 | 3300009826 | Bacteria | 1237 |
| 34 | Ga0123356_10036140 | 3300010049 | Bacteria | 4613 |
| 35 | Ga0123353_11684442 | 3300010167 | Bacteria | 795 |
| 36 | Ga0123353_12868983 | 3300010167 | Bacteria | 563 |
| 37 | Ga0160432_103527 | 3300012818 | Bacteria | 2270 |
| 38 | Ga0255572_1000839 | 3300026175 | Bacteria | 31625 |
| 39 | Ga0466706_157549 | 3300042599 | Bacteria | 1176 |
| 40 | Ga0466714_006340 | 3300042603 | Bacteria | 2455 |
| 41 | Ga0466717_289737 | 3300042604 | Bacteria | 1024 |
| 42 | Ga0466731_092788 | 3300042622 | Bacteria | 1039 |
| 43 | Ga0466731_213194 | 3300042622 | Bacteria | 1004 |
| 44 | Ga0466733_195136 | 3300042659 | Bacteria | 1120 |
| 45 | Ga0562379_4734 | 3300056790 | Bacteria | 6255 |
| 46 | 2227603793 | 2225789004 | Bacteria | 2315 |
| 47 | IMNBL1DRAFT_c0025280 | 3300000062 | Bacteria | 2281 |
| 48 | AustNasuHG_c1001775 | 3300000089 | Bacteria | 7810 |
| 49 | JGI24702J35022_10012448 | 3300002462 | Bacteria | 4730 |
| 50 | Ga0072940_1097075 | 3300005200 | Bacteria | 2891 |
| 51 | Ga0466728_425423 | 3300042620 | Bacteria | 1987 |
| 52 | Ga0123353_10075100 | 3300010167 | Bacteria | 5433 |
| 53 | Ga0123353_10393883 | 3300010167 | Bacteria | 2065 |
| 54 | Ga0123353_10755298 | 3300010167 | Bacteria | 1353 |
| 55 | Ga0123353_11624119 | 3300010167 | Bacteria | 815 |
| 56 | Ga0123353_12017310 | 3300010167 | Unclassified | 706 |
| 57 | Ga0160453_109690 | 3300012814 | Unclassified | 1126 |
| 58 | Ga0160440_100031 | 3300012815 | Bacteria | 222224 |
| 59 | Ga0160448_117245 | 3300012854 | Bacteria | 1251 |
| 60 | Ga0160457_1022964 | 3300012858 | Unclassified | 871 |
| 61 | Ga0415639_118637 | 3300038395 | Bacteria | 1108 |
| 62 | Ga0466657_291877 | 3300042582 | Bacteria | 2136 |
| 63 | Ga0466693_352912 | 3300042592 | Bacteria | 1341 |
| 64 | Ga0466706_223170 | 3300042599 | Bacteria | 11130 |
| 65 | Ga0466717_090331 | 3300042604 | Unclassified | 1163 |
| 66 | Ga0466698_081315 | 3300042610 | Bacteria | 1176 |
| 67 | Ga0466730_011725 | 3300042625 | Bacteria | 8736 |
| 68 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 69 | Ga0562375_0080 | 3300056856 | Bacteria | 309561 |
| 70 | Ga0590775_17304 | 3300060896 | Bacteria | 972 |
| 71 | JGI24702J35022_10168039 | 3300002462 | Bacteria | 1239 |
| 72 | JGI24705J35276_12219518 | 3300002504 | Bacteria | 2209 |
| 73 | Ga0466718_142434 | 3300042617 | Bacteria | 1255 |
| 74 | Ga0466726_353337 | 3300042619 | Bacteria | 59989 |
| 75 | Ga0466729_159705 | 3300042621 | Bacteria | 9059 |
| 76 | Ga0123355_10004431 | 3300009826 | Bacteria | 20424 |
| 77 | Ga0123355_10197417 | 3300009826 | Unclassified | 2948 |
| 78 | Ga0123355_10529157 | 3300009826 | Bacteria | 1437 |
| 79 | Ga0123356_10803187 | 3300010049 | Unclassified | 1112 |
| 80 | Ga0123356_13483874 | 3300010049 | Bacteria | 545 |
| 81 | Ga0123353_10251636 | 3300010167 | Bacteria | 2736 |
| 82 | Ga0123353_10951934 | 3300010167 | Bacteria | 1161 |
| 83 | Ga0123353_12192902 | 3300010167 | Unclassified | 669 |
| 84 | Ga0123354_11006874 | 3300010882 | Bacteria | 536 |
| 85 | Ga0466695_105696 | 3300042595 | Bacteria | 11270 |
| 86 | Ga0466706_191347 | 3300042599 | Bacteria | 11530 |
| 87 | Ga0466700_084450 | 3300042600 | Bacteria | 4684 |
| 88 | Ga0466707_243360 | 3300042601 | Bacteria | 29608 |
| 89 | Ga0466713_025156 | 3300042602 | Bacteria | 41607 |
| 90 | Ga0466714_041056 | 3300042603 | Bacteria | 12167 |
| 91 | Ga0466714_117100 | 3300042603 | Bacteria | 1989 |
| 92 | Ga0466714_135898 | 3300042603 | Bacteria | 7216 |
| 93 | Ga0466716_404377 | 3300042605 | Bacteria | 3858 |
| 94 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 95 | Ga0466730_086863 | 3300042625 | Bacteria | 4535 |
| 96 | Ga0466724_52014 | 3300042649 | Bacteria | 5428 |
| 97 | Ga0466725_212446 | 3300042654 | Bacteria | 2282 |
| 98 | Ga0466732_246010 | 3300042656 | Bacteria | 4220 |
| 99 | AustNasuHG_c1005636 | 3300000089 | Bacteria | 4480 |
| 100 | HBC_ctgsDRAFT_1113527 | 3300000333 | Bacteria | 618 |
| 101 | JGI24702J35022_10308613 | 3300002462 | Unclassified | 935 |
| 102 | Ga0111035_103226 | 3300007901 | Unclassified | 17000 |
| 103 | Ga0466718_016351 | 3300042617 | Bacteria | 1635 |
| 104 | Ga0123357_10293049 | 3300009784 | Bacteria | 1658 |
| 105 | Ga0123356_10778552 | 3300010049 | Unclassified | 1127 |
| 106 | Ga0123353_10233784 | 3300010167 | Bacteria | 2863 |
| 107 | Ga0123353_11989615 | 3300010167 | Bacteria | 712 |
| 108 | Ga0123354_10943630 | 3300010882 | Unclassified | 561 |
| 109 | Ga0160456_100878 | 3300012820 | Bacteria | 8059 |
| 110 | Ga0160446_100672 | 3300012835 | Unclassified | 11712 |
| 111 | Ga0466706_042959 | 3300042599 | Bacteria | 1607 |
| 112 | Ga0466706_162915 | 3300042599 | Bacteria | 17654 |
| 113 | Ga0466707_273021 | 3300042601 | Bacteria | 1834 |
| 114 | Ga0466721_007819 | 3300042608 | Bacteria | 1478 |
| 115 | Ga0466704_212812 | 3300042643 | Bacteria | 35602 |
| 116 | Ga0466727_142534 | 3300042655 | Bacteria | 55597 |
| 117 | JGI24696J40584_12640608 | 3300002834 | Bacteria | 686 |
| 118 | Ga0068305_10005402 | 3300005083 | Bacteria | 29409 |
| 119 | Ga0072940_1294333 | 3300005200 | Bacteria | 1016 |
| 120 | Ga0466710_153421 | 3300042613 | Bacteria | 1718 |
| 121 | Ga0466718_043698 | 3300042617 | Bacteria | 5639 |
| 122 | Ga0123353_10374306 | 3300010167 | Unclassified | 2133 |
| 123 | Ga0123353_11046961 | 3300010167 | Bacteria | 1090 |
| 124 | Ga0123353_11096448 | 3300010167 | Bacteria | 1057 |
| 125 | Ga0160469_100487 | 3300012824 | Bacteria | 17913 |
| 126 | Ga0466691_093383 | 3300042593 | Bacteria | 2844 |
| 127 | Ga0466696_219591 | 3300042596 | Bacteria | 1698 |
| 128 | Ga0466706_152357 | 3300042599 | Unclassified | 3521 |
| 129 | Ga0466706_265212 | 3300042599 | Bacteria | 1909 |
| 130 | Ga0466707_166123 | 3300042601 | Bacteria | 25982 |
| 131 | Ga0466716_077310 | 3300042605 | Bacteria | 14234 |
| 132 | Ga0466722_257879 | 3300042609 | Bacteria | 4212 |
| 133 | Ga0466729_258952 | 3300042621 | Unclassified | 1536 |
| 134 | Ga0466734_107278 | 3300042623 | Bacteria | 1989 |
| 135 | Ga0466730_004134 | 3300042625 | Unclassified | 2559 |
| 136 | Ga0466725_065857 | 3300042654 | Bacteria | 1224 |
| 137 | Ga0466725_436319 | 3300042654 | Unclassified | 1118 |
| 138 | Ga0466732_081474 | 3300042656 | Bacteria | 1830 |
| 139 | Ga0562378_0727 | 3300056814 | Bacteria | 47065 |
| 140 | Ga0562375_1322 | 3300056856 | Bacteria | 34684 |
| 141 | IMNBL1DRAFT_c0000426 | 3300000062 | Bacteria | 35421 |
| 142 | JGI24697J35500_11090288 | 3300002507 | Unclassified | 1136 |
| 143 | JGI24697J35500_11270675 | 3300002507 | Bacteria | 4279 |
| 144 | Ga0068302_10000197 | 3300005071 | Bacteria | 28753 |
| 145 | Ga0072940_1088022 | 3300005200 | Bacteria | 763 |
| 146 | Ga0072941_1007162 | 3300005201 | Bacteria | 33370 |
| 147 | Ga0072941_1096920 | 3300005201 | Bacteria | 13635 |
| 148 | Ga0466718_024425 | 3300042617 | Bacteria | 5596 |
| 149 | Ga0466728_141395 | 3300042620 | Bacteria | 18755 |
| 150 | Ga0466729_100000 | 3300042621 | Bacteria | 2809 |
| 151 | Ga0123355_10155645 | 3300009826 | Bacteria | 3459 |
| 152 | Ga0123355_10526999 | 3300009826 | Bacteria | 1442 |
| 153 | Ga0123355_10622984 | 3300009826 | Bacteria | 1271 |
| 154 | Ga0123356_12338992 | 3300010049 | Bacteria | 668 |
| 155 | Ga0123353_10000033 | 3300010167 | Bacteria | 150421 |
| 156 | Ga0123353_11665883 | 3300010167 | Unclassified | 801 |
| 157 | Ga0160440_103450 | 3300012815 | Unclassified | 1539 |
| 158 | Ga0160458_120408 | 3300012832 | Bacteria | 686 |
| 159 | Ga0160433_104418 | 3300012846 | Bacteria | 2267 |
| 160 | Ga0160430_100932 | 3300012852 | Unclassified | 12770 |
| 161 | Ga0160457_1002026 | 3300012858 | Bacteria | 4717 |
| 162 | Ga0264413_148735 | 3300024493 | Bacteria | 1322 |
| 163 | Ga0415639_201838 | 3300038395 | Bacteria | 1573 |
| 164 | Ga0466714_084576 | 3300042603 | Bacteria | 3015 |
| 165 | Ga0466734_118088 | 3300042623 | Unclassified | 1005 |
| 166 | Ga0466702_061334 | 3300042635 | Bacteria | 1101 |
| 167 | Ga0466702_286161 | 3300042635 | Bacteria | 2694 |
| 168 | Ga0466709_014700 | 3300042648 | Bacteria | 1762 |
| 169 | Ga0466724_27243 | 3300042649 | Bacteria | 6777 |
| 170 | Ga0466725_462654 | 3300042654 | Bacteria | 3181 |
| 171 | Ga0562375_3766 | 3300056856 | Bacteria | 13275 |
| 172 | JGI24703J35330_11739032 | 3300002501 | Bacteria | 3256 |
| 173 | JGI24696J40584_12931166 | 3300002834 | Bacteria | 1481 |
| 174 | Ga0074263_101665 | 3300005485 | Bacteria | 1391 |
| 175 | Ga0466715_502498 | 3300042616 | Bacteria | 2293 |
| 176 | Ga0466729_156052 | 3300042621 | Bacteria | 12586 |
| 177 | Ga0123357_10748372 | 3300009784 | Bacteria | 680 |
| 178 | Ga0123355_10647649 | 3300009826 | Bacteria | 1234 |
| 179 | Ga0123355_11077843 | 3300009826 | Unclassified | 840 |
| 180 | Ga0123356_10076917 | 3300010049 | Bacteria | 3146 |
| 181 | Ga0123353_10008423 | 3300010167 | Bacteria | 14077 |
| 182 | Ga0123353_10172445 | 3300010167 | Unclassified | 3432 |
| 183 | Ga0123353_10974117 | 3300010167 | Unclassified | 1143 |
| 184 | Ga0123353_11187036 | 3300010167 | Bacteria | 1003 |
| 185 | Ga0160442_100131 | 3300012806 | Unclassified | 75763 |
| 186 | Ga0255572_1000024 | 3300026175 | Bacteria | 128087 |
| 187 | Ga0255575_1000023 | 3300026559 | Bacteria | 88290 |
| 188 | Ga0415639_106168 | 3300038395 | Bacteria | 2412 |
| 189 | Ga0466656_238355 | 3300042550 | Unclassified | 1201 |
| 190 | Ga0466706_235654 | 3300042599 | Bacteria | 1252 |
| 191 | Ga0466713_014023 | 3300042602 | Bacteria | 32520 |
| 192 | Ga0466716_537488 | 3300042605 | Bacteria | 1127 |
| 193 | Ga0466719_236594 | 3300042606 | Bacteria | 21995 |
| 194 | Ga0466730_042836 | 3300042625 | Bacteria | 1478 |
| 195 | Ga0466704_388961 | 3300042643 | Unclassified | 3106 |
| 196 | Ga0466725_323925 | 3300042654 | Bacteria | 1157 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00238 | Ribosomal_L14 | Ribosomal protein L14p/L23e | 13 | 133 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.