Protein Family IF03996
Metagenome
Isolate
256
Members
180
Samples
146
Scaffolds
368.11
Avg Length
Representative Sequence
- ID
- 3300012849|Ga0160447_101300|Ga0160447_1013004
- Length
- 398 aa
- Sequence
- MKAERPATAASAPRPGAGLRGAMSRVVALTRKETRQVLRDPSSLAIGVLLPMLLILLFGYGLSLDVRNAPLAVVMEDSSPGAFHAVAGLSLTPYISAVPMASMQEAEALMEAHRVDGIVRVPADFSSRLARGDARIQIVVNGADANKATTILGYAGAAIGAGAVRDADRAGRHRDAPSPDGIGSVTLEPRMWFNAANSSTWYLVPGLVVLVMTLVGAFLTALVMAREWERGTLEALFVTPVRPIEILLAKIIPYFVIGMIGLALCLLAARYLFEVPMVGSLAVLVFASMLYLIVAVGIGLLISSVTRSQFLASQVALMASFLPSLMLSGFLFDLRNVPTVVYYIGHLLPATYFMELIRSLFLAGNIWPMVIRDCLILAAYAVGLMAVALAVTRKRLD*
Sample Types
Isolate
43.0%
Metagenome
57.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
15.0%
Termitidae
10.4%
Kalotermitidae
8.1%
Anthocoridae
7.5%
Muscidae
6.9%
Drosophilidae
6.4%
Tenebrionidae
6.4%
Culicidae
5.2%
Apidae
5.2%
Calliphoridae
4.6%
Armadillidiidae
3.5%
Formicidae
2.9%
Curculionidae
2.9%
Cerambycidae
2.3%
Pteromalidae
1.7%
Tephritidae
1.7%
Sarcophagidae
1.2%
Termopsidae
1.2%
Scarabaeidae
0.6%
Hodotermitidae
0.6%
Anthomyiidae
0.6%
Rhopalidae
0.6%
Pentatomidae
0.6%
Plutellidae
0.6%
Rhinotermitidae
0.6%
Carabidae
0.6%
Siricidae
0.6%
Passalidae
0.6%
Crambidae
0.6%
Elmidae
0.6%
Taxonomy
Archaea
0
Bacteria
241
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 2 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 3 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 4 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 5 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 6 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 7 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 8 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 9 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 12 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 20 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 21 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 22 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 23 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 24 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 25 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 26 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 27 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 28 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 29 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 30 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 31 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 32 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 33 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 34 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 40 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 46 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 47 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 48 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 49 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 50 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 51 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 52 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 53 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 54 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 55 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 56 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 57 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 58 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 59 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 60 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 61 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 62 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 63 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 67 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 68 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 69 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 70 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 71 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 72 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 73 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 74 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 75 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 76 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 77 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 78 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 79 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 80 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 81 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 82 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 83 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 84 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 85 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 86 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 87 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 88 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 89 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 90 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 91 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 92 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 93 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 94 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 95 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 96 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 97 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 98 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 99 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 100 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 101 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 102 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 103 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 104 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 105 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 106 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 107 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 108 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 109 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 110 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 111 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 112 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 113 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 114 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 115 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 116 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 117 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 118 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 119 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 120 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 121 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 122 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 123 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 124 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 125 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 126 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 127 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 128 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 129 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 130 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 131 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 132 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 133 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 134 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 135 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 136 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 137 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 138 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 139 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 140 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 141 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 142 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 143 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 144 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 145 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 146 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 147 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 148 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 149 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 150 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 151 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 152 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 153 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 154 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 155 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 156 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 157 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 158 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 159 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 160 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 161 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 162 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 163 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 164 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 165 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 166 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 167 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 168 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 169 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 170 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 171 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 172 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 173 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 174 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 175 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 176 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 177 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 178 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 179 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 180 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_371199 | 3300042612 | Bacteria | 2467 |
| 2 | Ga0466733_124227 | 3300042659 | Bacteria | 1887 |
| 3 | Ga0466705_441936 | 3300042612 | Bacteria | 25923 |
| 4 | Ga0466723_178904 | 3300042618 | Bacteria | 6659 |
| 5 | Ga0466726_458963 | 3300042619 | Bacteria | 1774 |
| 6 | Ga0123353_10001758 | 3300010167 | Bacteria | 26573 |
| 7 | Ga0123353_10006030 | 3300010167 | Bacteria | 16056 |
| 8 | Ga0466719_363700 | 3300042606 | Bacteria | 20279 |
| 9 | Ga0466698_311979 | 3300042610 | Bacteria | 2303 |
| 10 | FGTW_contig27162 | 2065487013 | Unclassified | 3126 |
| 11 | Meta3P_1002346 | 3300002464 | Bacteria | 9274 |
| 12 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 13 | Ga0068302_10031855 | 3300005071 | Bacteria | 5909 |
| 14 | Ga0072940_1191283 | 3300005200 | Bacteria | 1842 |
| 15 | Ga0074263_118791 | 3300005485 | Bacteria | 3204 |
| 16 | Ga0160456_100066 | 3300012820 | Unclassified | 156746 |
| 17 | Ga0160447_113386 | 3300012849 | Bacteria | 1616 |
| 18 | Ga0466690_318976 | 3300042590 | Bacteria | 8907 |
| 19 | Ga0466734_024402 | 3300042623 | Bacteria | 5901 |
| 20 | Ga0466730_017415 | 3300042625 | Bacteria | 24054 |
| 21 | Ga0466730_021652 | 3300042625 | Bacteria | 8183 |
| 22 | Ga0466703_075358 | 3300042636 | Bacteria | 15096 |
| 23 | Ga0466703_148786 | 3300042636 | Bacteria | 1473 |
| 24 | Ga0466708_234006 | 3300042652 | Bacteria | 6452 |
| 25 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 26 | Ga0562377_0071 | 3300056842 | Bacteria | 439264 |
| 27 | Ga0466715_128058 | 3300042616 | Bacteria | 3947 |
| 28 | Ga0466723_016418 | 3300042618 | Bacteria | 11387 |
| 29 | Ga0466726_443876 | 3300042619 | Bacteria | 144203 |
| 30 | Ga0466728_082306 | 3300042620 | Bacteria | 5824 |
| 31 | Ga0466728_361566 | 3300042620 | Bacteria | 2636 |
| 32 | Ga0123353_10000161 | 3300010167 | Bacteria | 85161 |
| 33 | Ga0160465_103788 | 3300012803 | Bacteria | 2583 |
| 34 | Ga0160471_100688 | 3300012812 | Bacteria | 8369 |
| 35 | Ga0466713_062613 | 3300042602 | Bacteria | 238473 |
| 36 | Ga0466717_067838 | 3300042604 | Bacteria | 5108 |
| 37 | Ga0063521_1000158 | 3300003973 | Bacteria | 51188 |
| 38 | Ga0074302_1135959 | 3300005316 | Bacteria | 2259 |
| 39 | Ga0247289_0101 | 3300035363 | Unclassified | 23050 |
| 40 | Ga0466734_090124 | 3300042623 | Bacteria | 4696 |
| 41 | Ga0466704_065021 | 3300042643 | Bacteria | 297957 |
| 42 | Ga0466724_38446 | 3300042649 | Bacteria | 24850 |
| 43 | Ga0466715_017465 | 3300042616 | Bacteria | 7392 |
| 44 | Ga0466715_028527 | 3300042616 | Bacteria | 28060 |
| 45 | Ga0466723_038120 | 3300042618 | Bacteria | 5972 |
| 46 | Ga0466723_087345 | 3300042618 | Bacteria | 9583 |
| 47 | Ga0466723_125654 | 3300042618 | Bacteria | 7269 |
| 48 | Ga0466723_183775 | 3300042618 | Bacteria | 6369 |
| 49 | Ga0466728_092306 | 3300042620 | Bacteria | 5807 |
| 50 | Ga0123357_10024116 | 3300009784 | Bacteria | 8184 |
| 51 | Ga0123356_10062146 | 3300010049 | Bacteria | 3488 |
| 52 | Ga0123354_10010784 | 3300010882 | Bacteria | 14101 |
| 53 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 54 | gam1t_NODE_309162_length=96519_GC=36_0_Contigs=2 | 2189573031 | Bacteria | 96529 |
| 55 | Ga0105553_1046434 | 3300007767 | Unclassified | 13198 |
| 56 | Ga0466690_376142 | 3300042590 | Bacteria | 3623 |
| 57 | Ga0466691_040547 | 3300042593 | Bacteria | 25397 |
| 58 | Ga0466734_055383 | 3300042623 | Bacteria | 30582 |
| 59 | Ga0466730_043780 | 3300042625 | Bacteria | 1386 |
| 60 | Ga0466724_44677 | 3300042649 | Bacteria | 154239 |
| 61 | Ga0466728_096746 | 3300042620 | Bacteria | 6591 |
| 62 | Ga0466716_304725 | 3300042605 | Bacteria | 23086 |
| 63 | FGTW_contig31103 | 2065487013 | Unclassified | 6092 |
| 64 | SWWA_contig03104__length_5688___numreads_91 | 2100351016 | Bacteria | 5688 |
| 65 | 2227080781 | 2225789004 | Bacteria | 168264 |
| 66 | Meta3P_1000937 | 3300002464 | Unclassified | 10224 |
| 67 | CVPL010L_1000073 | 3300002932 | Bacteria | 64100 |
| 68 | Ga0072941_1118181 | 3300005201 | Bacteria | 5584 |
| 69 | Ga0102740_1000011 | 3300007140 | Bacteria | 149332 |
| 70 | Ga0160447_101300 | 3300012849 | Bacteria | 9827 |
| 71 | Ga0265387_1000011 | 3300024582 | Bacteria | 77620 |
| 72 | Ga0247289_0051 | 3300035363 | Unclassified | 36335 |
| 73 | Ga0466730_000647 | 3300042625 | Unclassified | 32103 |
| 74 | Ga0466704_271189 | 3300042643 | Unclassified | 20889 |
| 75 | Ga0466724_19274 | 3300042649 | Bacteria | 102437 |
| 76 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 77 | Ga0466723_113514 | 3300042618 | Bacteria | 20443 |
| 78 | Ga0466723_187586 | 3300042618 | Bacteria | 4328 |
| 79 | Ga0466728_037892 | 3300042620 | Bacteria | 11784 |
| 80 | Ga0123357_10056990 | 3300009784 | Bacteria | 5253 |
| 81 | Ga0123355_10089561 | 3300009826 | Bacteria | 4883 |
| 82 | Ga0466706_264193 | 3300042599 | Bacteria | 7083 |
| 83 | Ga0466721_220243 | 3300042608 | Bacteria | 4648 |
| 84 | Ga0466722_103291 | 3300042609 | Bacteria | 4161 |
| 85 | DPOL_contig12006 | 2035918003 | Bacteria | 10665 |
| 86 | Ga0063521_1000689 | 3300003973 | Bacteria | 12961 |
| 87 | Ga0072941_1009391 | 3300005201 | Bacteria | 14543 |
| 88 | Ga0104040_1029990 | 3300007149 | Bacteria | 2902 |
| 89 | Ga0160467_100045 | 3300012829 | Bacteria | 189860 |
| 90 | Ga0160444_105987 | 3300012841 | Unclassified | 1599 |
| 91 | Ga0466691_050886 | 3300042593 | Bacteria | 20825 |
| 92 | Ga0466691_103306 | 3300042593 | Bacteria | 2027 |
| 93 | Ga0466696_034318 | 3300042596 | Bacteria | 66219 |
| 94 | Ga0466696_110201 | 3300042596 | Bacteria | 27034 |
| 95 | Ga0466730_022730 | 3300042625 | Bacteria | 1872 |
| 96 | Ga0466704_504614 | 3300042643 | Bacteria | 37493 |
| 97 | Ga0466725_281223 | 3300042654 | Bacteria | 83698 |
| 98 | Ga0562375_0646 | 3300056856 | Bacteria | 64574 |
| 99 | Ga0123353_10793025 | 3300010167 | Bacteria | 1310 |
| 100 | 2227647976 | 2225789004 | Bacteria | 2019 |
| 101 | Ga0160455_100013 | 3300012837 | Bacteria | 536068 |
| 102 | Ga0160433_101483 | 3300012846 | Bacteria | 6362 |
| 103 | Ga0160433_102493 | 3300012846 | Unclassified | 3914 |
| 104 | Ga0466691_085319 | 3300042593 | Bacteria | 9620 |
| 105 | Ga0466730_002610 | 3300042625 | Unclassified | 60332 |
| 106 | Ga0466703_079223 | 3300042636 | Bacteria | 43527 |
| 107 | Ga0466703_423018 | 3300042636 | Bacteria | 4929 |
| 108 | Ga0466724_66480 | 3300042649 | Unclassified | 35069 |
| 109 | Ga0466725_336444 | 3300042654 | Bacteria | 5548 |
| 110 | Ga0466705_011084 | 3300042612 | Bacteria | 40200 |
| 111 | Ga0530661_000864 | 3300056564 | Bacteria | 18903 |
| 112 | Ga0562374_0056 | 3300057007 | Bacteria | 409125 |
| 113 | Ga0160470_100046 | 3300012813 | Bacteria | 181385 |
| 114 | Ga0466701_020286 | 3300042598 | Bacteria | 64466 |
| 115 | Ga0466707_261356 | 3300042601 | Bacteria | 8834 |
| 116 | JGI24705J35276_12237659 | 3300002504 | Bacteria | 12346 |
| 117 | CVPL010W_10002931 | 3300002931 | Bacteria | 34455 |
| 118 | Ga0074278_152663 | 3300005721 | Bacteria | 96529 |
| 119 | Ga0103260_1000043 | 3300007139 | Bacteria | 38512 |
| 120 | Ga0104147_1105105 | 3300007224 | Bacteria | 11832 |
| 121 | Ga0160472_105963 | 3300012839 | Bacteria | 1877 |
| 122 | Ga0466701_015308 | 3300042598 | Bacteria | 33931 |
| 123 | Ga0466730_032427 | 3300042625 | Bacteria | 98246 |
| 124 | Ga0466704_299806 | 3300042643 | Bacteria | 17245 |
| 125 | Ga0466709_194761 | 3300042648 | Bacteria | 11129 |
| 126 | Ga0466725_072871 | 3300042654 | Bacteria | 90604 |
| 127 | Ga0562378_0034 | 3300056814 | Bacteria | 488617 |
| 128 | Ga0466711_239920 | 3300042615 | Bacteria | 8253 |
| 129 | Ga0466711_512706 | 3300042615 | Bacteria | 6447 |
| 130 | Ga0466715_112836 | 3300042616 | Bacteria | 21635 |
| 131 | Ga0466723_051979 | 3300042618 | Bacteria | 27689 |
| 132 | Ga0466723_133902 | 3300042618 | Bacteria | 21587 |
| 133 | Ga0466723_149018 | 3300042618 | Bacteria | 14171 |
| 134 | Ga0466726_171475 | 3300042619 | Unclassified | 6016 |
| 135 | Ga0466726_207010 | 3300042619 | Bacteria | 4056 |
| 136 | Ga0466716_357276 | 3300042605 | Bacteria | 2378 |
| 137 | Ga0160453_100129 | 3300012814 | Bacteria | 77399 |
| 138 | Ga0160468_100463 | 3300012819 | Bacteria | 16537 |
| 139 | Ga0247289_0152 | 3300035363 | Bacteria | 17600 |
| 140 | Ga0466657_201827 | 3300042582 | Bacteria | 1465 |
| 141 | Ga0466691_007324 | 3300042593 | Bacteria | 21686 |
| 142 | Ga0466691_007463 | 3300042593 | Unclassified | 1584 |
| 143 | Ga0466734_010540 | 3300042623 | Bacteria | 4289 |
| 144 | Ga0466709_404658 | 3300042648 | Bacteria | 2626 |
| 145 | Ga0466708_102380 | 3300042652 | Bacteria | 19349 |
| 146 | Ga0466725_071678 | 3300042654 | Bacteria | 9691 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01061 | ABC2_membrane | ABC-2 type transporter | 200 | 361 | 0.92 |
| PF12698 | ABC2_membrane_3 | ABC-2 family transporter protein | 42 | 389 | 0.88 |
| PF12679 | ABC2_membrane_2 | ABC-2 family transporter protein | 28 | 358 | 0.76 |
| PF12730 | ABC2_membrane_4 | ABC-2 family transporter protein | 191 | 328 | 0.66 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.