Protein Family IF03972
Metagenome
Metatranscriptome
Isolate
278
Members
185
Samples
183
Scaffolds
400.35
Avg Length
Representative Sequence
- ID
- 3300012848|Ga0160443_101273|Ga0160443_1012734
- Length
- 482 aa
- Sequence
- VGKEDGGSQKQNIPHDVIPEVGPTRGRSDSPDCIPAIWFGNAQSVIAPRQKSAPHGFASGARDAIAAPDIFPNTGVTRRHSFEGEEFMAKIKVANPVVDLDGDEMTRIIWQLIKDKLILPYLDLDIDATNDQVTVDAAHAIKKHGVGIKCATITPDEQRVEEFGLKQMWKSPNGTIRNILGGVIFREPIICKNVPRLVPGWTKPIVVGRHAFGDQYKATDFKFPGKGKLTIKFVGEDGQVIEKDVFDAPSAGVALAMYNLDESIREFARASMMYGLMRKWPVYLSTKNTILKAYDGRFKDIFEEVYQTEFKAKFDEIGIIYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGRTVEAEAAHGTVTRHYRQHQKGQETSTNSIASIFAWTRGLAHRAKLDDNAELAKFAATLETVCVDTVESGFMTKDLALLIGPDQPWLSTTAFLDKIDENLKTAMAA*
Sample Types
Isolate
34.2%
Metagenome
60.8%
MAG
0.0%
Metatranscriptome
5.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
16.9%
Apidae
13.5%
Termitidae
11.2%
Drosophilidae
10.7%
Formicidae
9.6%
Tenebrionidae
5.6%
Kalotermitidae
5.1%
Armadillidiidae
4.5%
Culicidae
4.5%
Elmidae
3.9%
Blattidae
2.8%
Psyllidae
2.2%
Rhinotermitidae
1.7%
Blaberidae
1.7%
Daphniidae
1.1%
Termopsidae
1.1%
Nephropidae
1.1%
Aphididae
0.6%
Muscidae
0.6%
Tryonicidae
0.6%
Passalidae
0.6%
Curculionidae
0.6%
Taxonomy
Archaea
0
Bacteria
243
Eukaryota
3
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 4 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 5 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 6 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 7 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 8 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 9 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 12 | 3300060707 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 13 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 14 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 15 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 16 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 17 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 18 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 23 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 24 | 2761201754 | Yamadazyma tenuis ATCC 10573 | Isolate | Unclassified |
| 25 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 26 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 27 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 28 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 29 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 30 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 31 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 32 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 33 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 34 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 35 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 36 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 37 | 3300007226 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 4 gut | Metagenome | Drosophilidae |
| 38 | 3300007293 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 6 gut | Metagenome | Drosophilidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 41 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 42 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 43 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 44 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 45 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 46 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 47 | 2761201709 | Ogataea arabinofermentans NRRL YB-2248 | Isolate | Unclassified |
| 48 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 49 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 50 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 51 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 52 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 53 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 57 | 3300060699 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 58 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 59 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 60 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 61 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 62 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 63 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 64 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 67 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 68 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 69 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 70 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 71 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 72 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 73 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 74 | 3300060763 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PP_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 75 | 3300060772 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 76 | 3300060774 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 77 | 3300061799 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 78 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 79 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 80 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 81 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 82 | 3300008519 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti | Metagenome | Formicidae |
| 83 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 84 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 85 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 86 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 87 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 88 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 89 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 93 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 94 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 95 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 96 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 97 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 98 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 99 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 100 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 101 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 102 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 103 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 104 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 105 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 106 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 107 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 108 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 109 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 110 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 111 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 112 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 113 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 114 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 115 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 116 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 117 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 118 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 119 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 120 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 121 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 122 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 123 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 124 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 125 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 126 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 127 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 128 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 129 | 3300060696 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 130 | 3300060698 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 131 | 3300060702 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 132 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 133 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 134 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 135 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 136 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 137 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 138 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 139 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 140 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 141 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 142 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 143 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 144 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 145 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 146 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 147 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 148 | 2761201758 | Scheffersomyces stipitis CBS 6054 | Isolate | Unclassified |
| 149 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 150 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 151 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 152 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 153 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 154 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 155 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 156 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 157 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 158 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 159 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 160 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 161 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 162 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 163 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 164 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 165 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 166 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 167 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 168 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 169 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 170 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 171 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 172 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 173 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 174 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 175 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 176 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 177 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 178 | 3300060896 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 179 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 180 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 181 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 182 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 183 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 184 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 185 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_055432 | 3300042659 | Bacteria | 55157 |
| 2 | Ga0466733_072856 | 3300042659 | Bacteria | 5534 |
| 3 | Ga0590798_02664 | 3300060774 | Unclassified | 1458 |
| 4 | Ga0123355_10026197 | 3300009826 | Bacteria | 9401 |
| 5 | Ga0123355_10212493 | 3300009826 | Bacteria | 2800 |
| 6 | Ga0123356_10000534 | 3300010049 | Bacteria | 42234 |
| 7 | Ga0123353_10272492 | 3300010167 | Bacteria | 2606 |
| 8 | Ga0123354_10024067 | 3300010882 | Bacteria | 9609 |
| 9 | Ga0466715_297385 | 3300042616 | Bacteria | 2421 |
| 10 | Ga0466715_362769 | 3300042616 | Bacteria | 12473 |
| 11 | Ga0466707_091425 | 3300042601 | Bacteria | 30484 |
| 12 | Ga0466722_153707 | 3300042609 | Bacteria | 1863 |
| 13 | Ga0160456_100589 | 3300012820 | Bacteria | 10923 |
| 14 | Ga0160444_100071 | 3300012841 | Bacteria | 136037 |
| 15 | Ga0160443_101762 | 3300012848 | Bacteria | 6181 |
| 16 | Ga0255572_1000001 | 3300026175 | Bacteria | 634207 |
| 17 | Ga0309903_100006 | 3300029809 | Bacteria | 89427 |
| 18 | JGI24705J35276_12238613 | 3300002504 | Bacteria | 29631 |
| 19 | Ga0123357_10000036 | 3300009784 | Bacteria | 109942 |
| 20 | Ga0466734_050162 | 3300042623 | Bacteria | 1590 |
| 21 | Ga0466708_421862 | 3300042652 | Bacteria | 102077 |
| 22 | Ga0123355_10046030 | 3300009826 | Unclassified | 7095 |
| 23 | Ga0123355_10117334 | 3300009826 | Bacteria | 4138 |
| 24 | Ga0466715_115556 | 3300042616 | Bacteria | 10345 |
| 25 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 26 | Ga0160456_100129 | 3300012820 | Unclassified | 72959 |
| 27 | Ga0160448_100179 | 3300012854 | Bacteria | 27367 |
| 28 | Ga0223688_1000440 | 3300021227 | Unclassified | 2594 |
| 29 | Ga0466691_002891 | 3300042593 | Bacteria | 9849 |
| 30 | Ga0466696_108867 | 3300042596 | Bacteria | 9437 |
| 31 | Ga0466696_215096 | 3300042596 | Bacteria | 6417 |
| 32 | HBC_ctgsDRAFT_1000965 | 3300000333 | Bacteria | 6245 |
| 33 | CVPL005W_1001336 | 3300002934 | Bacteria | 6674 |
| 34 | Ga0102735_1000665 | 3300007080 | Bacteria | 6574 |
| 35 | Ga0103264_1000525 | 3300007188 | Bacteria | 19216 |
| 36 | Ga0104148_1071646 | 3300007226 | Unclassified | 8745 |
| 37 | Ga0104148_1076987 | 3300007226 | Unclassified | 8282 |
| 38 | Ga0105524_100814 | 3300007733 | Bacteria | 15489 |
| 39 | Ga0111037_100208 | 3300008519 | Unclassified | 65171 |
| 40 | Ga0127649_105324 | 3300009460 | Bacteria | 14092 |
| 41 | Ga0123357_10000187 | 3300009784 | Bacteria | 57664 |
| 42 | Ga0123357_10000363 | 3300009784 | Bacteria | 42732 |
| 43 | Ga0466729_211514 | 3300042621 | Bacteria | 11662 |
| 44 | Ga0466734_070655 | 3300042623 | Bacteria | 2142 |
| 45 | Ga0466708_181194 | 3300042652 | Bacteria | 24776 |
| 46 | Ga0590816_08642 | 3300060707 | Unclassified | 1776 |
| 47 | Ga0123356_10003285 | 3300010049 | Bacteria | 16990 |
| 48 | Ga0123356_10016652 | 3300010049 | Unclassified | 7012 |
| 49 | Ga0466726_038215 | 3300042619 | Bacteria | 17256 |
| 50 | Ga0466728_390373 | 3300042620 | Bacteria | 1569 |
| 51 | Ga0160434_100001 | 3300012850 | Bacteria | 617314 |
| 52 | Ga0466657_160419 | 3300042582 | Bacteria | 8411 |
| 53 | Ga0466695_274295 | 3300042595 | Bacteria | 8469 |
| 54 | JGI24705J35276_12215089 | 3300002504 | Bacteria | 1988 |
| 55 | CVPL010W_10000013 | 3300002931 | Bacteria | 89007 |
| 56 | CVPL010W_10000113 | 3300002931 | Bacteria | 60515 |
| 57 | CVPL010W_10000148 | 3300002931 | Bacteria | 57471 |
| 58 | Ga0103264_1000029 | 3300007188 | Bacteria | 86744 |
| 59 | Ga0103264_1001813 | 3300007188 | Bacteria | 9809 |
| 60 | Ga0104148_1001728 | 3300007226 | Unclassified | 7170 |
| 61 | Ga0466734_039156 | 3300042623 | Bacteria | 2709 |
| 62 | Ga0466730_090233 | 3300042625 | Bacteria | 3413 |
| 63 | Ga0466730_097853 | 3300042625 | Bacteria | 2294 |
| 64 | Ga0466703_114865 | 3300042636 | Bacteria | 3121 |
| 65 | Ga0466703_135630 | 3300042636 | Bacteria | 132114 |
| 66 | Ga0466704_016017 | 3300042643 | Bacteria | 1787 |
| 67 | Ga0466704_563895 | 3300042643 | Bacteria | 6727 |
| 68 | Ga0123354_10071014 | 3300010882 | Bacteria | 5030 |
| 69 | Ga0466707_065538 | 3300042601 | Bacteria | 14314 |
| 70 | Ga0466713_017018 | 3300042602 | Bacteria | 51598 |
| 71 | Ga0466713_038979 | 3300042602 | Bacteria | 83101 |
| 72 | Ga0466713_096794 | 3300042602 | Bacteria | 1573 |
| 73 | Ga0160468_100100 | 3300012819 | Bacteria | 98045 |
| 74 | Ga0160469_100268 | 3300012824 | Bacteria | 37991 |
| 75 | Ga0160446_100107 | 3300012835 | Bacteria | 76250 |
| 76 | Ga0160445_100620 | 3300012847 | Bacteria | 15016 |
| 77 | Ga0160448_105902 | 3300012854 | Unclassified | 3130 |
| 78 | Ga0255809_1003433 | 3300022820 | Bacteria | 2055 |
| 79 | IMNBL1DRAFT_c0003337 | 3300000062 | Bacteria | 10417 |
| 80 | Ga0074278_148930 | 3300005721 | Bacteria | 8598 |
| 81 | Ga0104147_1005133 | 3300007224 | Unclassified | 7623 |
| 82 | Ga0104148_1063489 | 3300007226 | Unclassified | 8171 |
| 83 | Ga0466703_325066 | 3300042636 | Bacteria | 3268 |
| 84 | Ga0466703_325563 | 3300042636 | Bacteria | 3290 |
| 85 | Ga0466724_36866 | 3300042649 | Bacteria | 1582 |
| 86 | Ga0466733_087265 | 3300042659 | Bacteria | 208960 |
| 87 | Ga0590775_00076 | 3300060896 | Unclassified | 8099 |
| 88 | Ga0123356_10001905 | 3300010049 | Bacteria | 22631 |
| 89 | Ga0123356_10072261 | 3300010049 | Bacteria | 3240 |
| 90 | Ga0466713_118049 | 3300042602 | Bacteria | 5765 |
| 91 | Ga0160459_100074 | 3300012831 | Bacteria | 129853 |
| 92 | Ga0160444_100043 | 3300012841 | Bacteria | 194345 |
| 93 | Ga0160433_100307 | 3300012846 | Bacteria | 31511 |
| 94 | Ga0223682_1000916 | 3300021231 | Unclassified | 4680 |
| 95 | Ga0255572_1001541 | 3300026175 | Unclassified | 61545 |
| 96 | Ga0466692_158668 | 3300042591 | Bacteria | 509148 |
| 97 | Ga0466696_445692 | 3300042596 | Bacteria | 1627 |
| 98 | 2217985090 | 2209111014 | Bacteria | 1779 |
| 99 | CVPL005W_1000979 | 3300002934 | Bacteria | 8832 |
| 100 | Ga0068302_10243797 | 3300005071 | Bacteria | 2366 |
| 101 | Ga0111035_102120 | 3300007901 | Unclassified | 23130 |
| 102 | Ga0466704_026839 | 3300042643 | Bacteria | 19063 |
| 103 | Ga0590805_02442 | 3300060698 | Unclassified | 1579 |
| 104 | Ga0123356_10002459 | 3300010049 | Bacteria | 19778 |
| 105 | Ga0123356_10003490 | 3300010049 | Bacteria | 16445 |
| 106 | Ga0466710_395630 | 3300042613 | Bacteria | 1650 |
| 107 | Ga0466707_346834 | 3300042601 | Bacteria | 60391 |
| 108 | Ga0466713_048638 | 3300042602 | Bacteria | 3884 |
| 109 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 110 | Ga0160470_100525 | 3300012813 | Bacteria | 15116 |
| 111 | Ga0160452_100656 | 3300012834 | Bacteria | 18062 |
| 112 | Ga0160433_100089 | 3300012846 | Unclassified | 93149 |
| 113 | Ga0160457_1001897 | 3300012858 | Unclassified | 5052 |
| 114 | Ga0309902_000002 | 3300028910 | Bacteria | 357102 |
| 115 | Ga0103266_1000003 | 3300007067 | Bacteria | 141646 |
| 116 | Ga0102739_1000145 | 3300007095 | Bacteria | 20171 |
| 117 | Ga0103264_1000016 | 3300007188 | Bacteria | 116870 |
| 118 | Ga0104148_1019970 | 3300007226 | Unclassified | 9615 |
| 119 | Ga0104150_1019555 | 3300007293 | Bacteria | 4228 |
| 120 | Ga0466734_024619 | 3300042623 | Bacteria | 6452 |
| 121 | Ga0466704_217206 | 3300042643 | Bacteria | 87649 |
| 122 | Ga0466709_084097 | 3300042648 | Bacteria | 147707 |
| 123 | Ga0466724_61429 | 3300042649 | Bacteria | 356302 |
| 124 | Ga0466725_062706 | 3300042654 | Bacteria | 13510 |
| 125 | Ga0590806_02001 | 3300060699 | Bacteria | 1667 |
| 126 | Ga0590784_05173 | 3300060763 | Unclassified | 1811 |
| 127 | Ga0590796_03914 | 3300060772 | Unclassified | 1610 |
| 128 | Ga0590771_03429 | 3300061799 | Unclassified | 1604 |
| 129 | Ga0123357_10159814 | 3300009784 | Unclassified | 2705 |
| 130 | Ga0123356_10026126 | 3300010049 | Bacteria | 5487 |
| 131 | Ga0123353_10003157 | 3300010167 | Bacteria | 20713 |
| 132 | Ga0466715_594637 | 3300042616 | Bacteria | 2774 |
| 133 | Ga0466728_090059 | 3300042620 | Bacteria | 2418 |
| 134 | Ga0466713_113136 | 3300042602 | Bacteria | 8736 |
| 135 | Ga0466713_130748 | 3300042602 | Bacteria | 4669 |
| 136 | Ga0160459_101740 | 3300012831 | Bacteria | 4216 |
| 137 | Ga0160459_101818 | 3300012831 | Bacteria | 4018 |
| 138 | Ga0160458_101189 | 3300012832 | Unclassified | 5672 |
| 139 | Ga0160433_100135 | 3300012846 | Bacteria | 65985 |
| 140 | Ga0160445_101297 | 3300012847 | Bacteria | 7390 |
| 141 | Ga0160443_101273 | 3300012848 | Bacteria | 9274 |
| 142 | Ga0309904_1000001 | 3300029810 | Bacteria | 103432 |
| 143 | Ga0466696_501608 | 3300042596 | Bacteria | 2669 |
| 144 | CVPL010W_10004095 | 3300002931 | Unclassified | 16367 |
| 145 | CVPL005L_10012188 | 3300002938 | Unclassified | 8856 |
| 146 | Ga0063521_1005607 | 3300003973 | Bacteria | 2968 |
| 147 | Ga0072941_1399962 | 3300005201 | Bacteria | 1529 |
| 148 | Ga0074278_115145 | 3300005721 | Bacteria | 11654 |
| 149 | Ga0102734_1001686 | 3300007129 | Bacteria | 14601 |
| 150 | Ga0102734_1002300 | 3300007129 | Bacteria | 4522 |
| 151 | Ga0466734_131630 | 3300042623 | Bacteria | 3318 |
| 152 | Ga0466703_076733 | 3300042636 | Bacteria | 34760 |
| 153 | Ga0466704_326735 | 3300042643 | Bacteria | 2268 |
| 154 | Ga0590803_02056 | 3300060696 | Unclassified | 1674 |
| 155 | Ga0590809_02650 | 3300060702 | Bacteria | 1662 |
| 156 | Ga0123355_10153921 | 3300009826 | Bacteria | 3484 |
| 157 | Ga0123356_10017972 | 3300010049 | Bacteria | 6716 |
| 158 | Ga0123356_10029085 | 3300010049 | Bacteria | 5176 |
| 159 | Ga0123356_10218570 | 3300010049 | Bacteria | 1960 |
| 160 | Ga0123353_10154721 | 3300010167 | Bacteria | 3657 |
| 161 | Ga0160466_100001 | 3300012809 | Bacteria | 656346 |
| 162 | Ga0466713_072221 | 3300042602 | Bacteria | 33479 |
| 163 | Ga0466713_082115 | 3300042602 | Bacteria | 17794 |
| 164 | Ga0466713_110063 | 3300042602 | Bacteria | 19383 |
| 165 | Ga0466722_079582 | 3300042609 | Bacteria | 1960 |
| 166 | Ga0160472_100083 | 3300012839 | Bacteria | 154330 |
| 167 | Ga0160433_100099 | 3300012846 | Bacteria | 86801 |
| 168 | Ga0160436_1002403 | 3300012861 | Bacteria | 4760 |
| 169 | Ga0223675_1008765 | 3300021237 | Unclassified | 1976 |
| 170 | Ga0466657_374394 | 3300042582 | Bacteria | 21365 |
| 171 | Ga0466692_183910 | 3300042591 | Bacteria | 11314 |
| 172 | Ga0466696_090943 | 3300042596 | Bacteria | 22879 |
| 173 | CVPL010L_1000001 | 3300002932 | Bacteria | 547858 |
| 174 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 175 | Ga0074278_142195 | 3300005721 | Bacteria | 6979 |
| 176 | Ga0104147_1011465 | 3300007224 | Unclassified | 3342 |
| 177 | Ga0104147_1014933 | 3300007224 | Unclassified | 5839 |
| 178 | Ga0466697_162976 | 3300042611 | Bacteria | 3293 |
| 179 | Ga0466705_089186 | 3300042612 | Bacteria | 9346 |
| 180 | Ga0466703_006754 | 3300042636 | Bacteria | 3472 |
| 181 | Ga0466704_340625 | 3300042643 | Bacteria | 3354 |
| 182 | Ga0466704_482293 | 3300042643 | Bacteria | 27712 |
| 183 | Ga0466709_231555 | 3300042648 | Bacteria | 9386 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 92 | 467 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.